F323479

General Info

Members Datasets Scaffolds Average Seq Length
212 142 424 326

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2864733723|2864733811
Length 363
Sequence LPYEAPLIEMRKKIEELVQFGQEKGIDFTEEIARLEERYHRLEEEIYTGITAAQKMHLARHQQRPTALDLIQLIFTDFMELHGDRMFGDDLAVVGGLAKLNGQTVTVIGQQRGKDTKDNIARFFGSAHPEGFRKGLRLMKQADKFGRPIITFIDTKGAYPGNTAEERGQSEAIARNLMEMAKLSVPVIVVVIGEGGSGGALAMAVGNRVLMLEHAIYSAISPNGAASILWKDASKADQAAEAMKITAKDLLEMEVIEEIIPEPRGGAHRDYDEAAAAISEALVRHLQEMKGWSAEQLKQDRYEKFRKIGSVTFETPASEAESAEESESLGEAEPQTGSESIEVQASEQPLQAEPVRNLSGNAE

Samples

Sample ID Description Type Environment
1 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
2 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
3 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
4 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
7 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
8 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
9 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
10 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
11 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
12 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
13 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
14 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
15 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
16 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
17 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
18 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
19 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
20 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
21 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
22 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
23 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
24 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
25 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
26 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
27 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
28 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
29 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
30 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
31 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
32 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
33 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
34 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
35 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
36 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
37 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
38 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
39 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
40 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
41 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
42 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
43 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
44 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
45 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
46 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
47 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
48 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
49 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
50 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
51 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
52 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
53 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
54 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
55 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
56 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
57 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
58 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
59 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
60 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
61 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
62 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
63 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
64 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
65 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
66 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
67 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
68 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
69 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
70 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
71 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
72 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
73 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
74 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
75 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
76 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
77 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
78 2554235469 Sporolactobacillus laevolacticus DSM 442 Isolate Rhizosphere
79 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
80 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
81 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
82 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
83 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
84 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
85 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
86 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
87 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
88 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
89 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
90 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
91 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
92 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
93 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
94 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
95 2818991459 Paenibacillus sp. 597 Isolate Unclassified
96 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
97 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
98 2857472729 Cohnella sp. R-74144 Isolate Unclassified
99 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
100 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
101 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
102 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
103 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
104 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
105 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
106 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
107 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
108 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
109 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
110 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
111 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
112 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
113 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
114 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
115 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
116 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
117 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
118 2939593269 Lysinibacillus parviboronicapiens 736 Isolate Rhizosphere
119 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
120 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
121 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
122 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
123 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
124 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
125 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
126 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
127 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
128 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
129 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
130 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
131 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
132 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
133 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
134 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
135 8023438354 Bacillus sp. BH2 Isolate Unclassified
136 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
137 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
138 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere
139 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
140 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
141 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere
142 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 59.43
Metatranscriptomes 6.13
Isolates 34.43

Biome Distribution

Category Percentage (%)
Aerial Root 0.94
Bulb 0
Endosphere 12.74
Nodule 0.47
Rhizoplane 0.47
Rhizosphere 53.3
Stem 0
Stem Tuber 0
Unclassified 0.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10003858 3300003187 Bacteria 8111
2 JGI25151J46595_10007724 3300003187 Bacteria 5238
3 JGI25151J46595_10041309 3300003187 Bacteria 1678
4 Ga0006562J51391_1002003 3300003578 Bacteria 2928
5 Ga0055538_1000162 3300003751 Bacteria 44029
6 Ga0055538_1000234 3300003751 Bacteria 30778
7 Ga0055541_1002126 3300003841 Bacteria 4033
8 Ga0070713_100061904 3300005436 Bacteria 3133
9 Ga0099795_10001060 3300007788 Bacteria 5680
10 Ga0105244_10007657 3300009036 Bacteria 6843
11 Ga0105244_10008226 3300009036 Bacteria 6535
12 Ga0105246_10001866 3300011119 Bacteria 12691
13 Ga0157371_10140271 3300013102 Bacteria 1722
14 Ga0209784_100114 3300025224 Bacteria 89590
15 Ga0209784_100127 3300025224 Bacteria 77184
16 Ga0209784_103072 3300025224 Bacteria 1502
17 Ga0209566_100041 3300025225 Bacteria 289634
18 Ga0209566_100151 3300025225 Bacteria 79302
19 Ga0209566_100234 3300025225 Bacteria 53750
20 Ga0209566_100259 3300025225 Bacteria 50462
21 Ga0209566_102551 3300025225 Bacteria 3287
22 Ga0209437_100357 3300025233 Bacteria 51450
23 Ga0209258_101268 3300025242 Bacteria 9552
24 Ga0209675_1010973 3300025291 Bacteria 3045
25 Ga0209676_1005305 3300025292 Bacteria 6792
26 Ga0209676_1021885 3300025292 Bacteria 2132
27 Ga0209676_1030744 3300025292 Bacteria 1637
28 Ga0209025_1003688 3300025294 Bacteria 14120
29 Ga0209025_1006207 3300025294 Bacteria 9380
30 Ga0209025_1015331 3300025294 Bacteria 4632
31 Ga0209025_1017039 3300025294 Bacteria 4228
32 Ga0209025_1021717 3300025294 Bacteria 3442
33 Ga0209025_1028603 3300025294 Bacteria 2725
34 Ga0209025_1053616 3300025294 Bacteria 1579
35 Ga0265356_1001923 3300028017 Bacteria 2881
36 Ga0265770_1000102 3300030878 Bacteria 9942
37 Ga0265765_1002235 3300030879 Bacteria 1860
38 Ga0265760_10007245 3300031090 Bacteria 3177
39 Ga0265316_10048558 3300031344 Bacteria 3349
40 Ga0316575_10006828 3300031665 Bacteria 4124
41 Ga0316579_10000511 3300031691 Bacteria 12700
42 Ga0316579_10008704 3300031691 Bacteria 4241
43 Ga0316576_10017533 3300031727 Bacteria 4868
44 Ga0316576_10098019 3300031727 Bacteria 2189
45 Ga0316576_10186475 3300031727 Bacteria 1564
46 Ga0316578_10003736 3300031728 Bacteria 7036
47 Ga0316578_10012264 3300031728 Bacteria 4515
48 Ga0316578_10085561 3300031728 Bacteria 1879
49 Ga0307516_10000209 3300031730 Bacteria 75193
50 Ga0316577_10001617 3300031733 Bacteria 10747
51 Ga0316577_10022475 3300031733 Bacteria 3501
52 Ga0316583_10003302 3300032133 Bacteria 5674
53 Ga0316583_10008124 3300032133 Bacteria 3782
54 Ga0316585_10000160 3300032137 Bacteria 13339
55 Ga0316585_10001132 3300032137 Bacteria 6937
56 Ga0316593_10011618 3300032168 Bacteria 2564
57 Ga0316593_10051764 3300032168 Bacteria 1389
58 Ga0316586_1005258 3300033527 Bacteria 1810
59 Ga0316588_1006522 3300033528 Bacteria 2335
60 Ga0316588_1019329 3300033528 Bacteria 1533
61 Ga0316587_1001629 3300033529 Bacteria 2824
62 Ga0316587_1010155 3300033529 Bacteria 1503
63 Ga0316596_1011261 3300033541 Bacteria 2181
64 Ga0316574_0019996 3300035398 Bacteria 3958
65 Ga0316574_0021541 3300035398 Bacteria 3828
66 Ga0316574_0227334 3300035398 Bacteria 1194
67 Ga0316574_0249631 3300035398 Bacteria 1134
68 Ga0316582_0004050 3300036647 Bacteria 7324
69 Ga0316582_0014617 3300036647 Bacteria 4461
70 Ga0316584_0003482 3300036712 Bacteria 10243
71 Ga0316584_0004136 3300036712 Bacteria 9575
72 Ga0395900_0560859 3300037418 Bacteria 1086
73 Ga0436362_0808556 3300039453 Bacteria 1261
74 Ga0439439_0000170 3300041406 Bacteria 9720
75 Ga0439433_0027536 3300041999 Bacteria 1290
76 Ga0439449_0000041 3300042007 Bacteria 39285
77 Ga0439462_0001277 3300042015 Bacteria 5517
78 Ga0451577_0001975 3300042876 Bacteria 25721
79 Ga0453683_0000257 3300044673 Bacteria 69856
80 Ga0453683_0012439 3300044673 Bacteria 5575
81 Ga0453684_0000762 3300044712 Bacteria 111891
82 Ga0453684_0014897 3300044712 Bacteria 12368
83 Ga0453684_0072634 3300044712 Bacteria 4342
84 Ga0453684_0090419 3300044712 Bacteria 3782
85 Ga0453684_0125363 3300044712 Bacteria 3092
86 Ga0453684_0464024 3300044712 Unclassified 1407
87 Ga0451576_0211798 3300045051 Bacteria 2024
88 Ga0495605_0039283 3300046474 Bacteria 2372
89 Ga0495585_0092539 3300046492 Bacteria 1627
90 Ga0495606_0122904 3300046507 Bacteria 1552
91 Ga0496110_0362463 3300048913 Bacteria 1321
92 Ga0496116_0000932 3300048919 Bacteria 35960
93 Ga0496116_0007198 3300048919 Bacteria 9938
94 Ga0496116_0009617 3300048919 Bacteria 8222
95 Ga0496116_0023205 3300048919 Bacteria 4626
96 Ga0496116_0031937 3300048919 Bacteria 3759
97 Ga0496116_0073097 3300048919 Bacteria 2164
98 Ga0496116_0141032 3300048919 Bacteria 1356
99 Ga0496117_0013582 3300048920 Bacteria 7093
100 Ga0496117_0035074 3300048920 Bacteria 3771
101 Ga0496117_0171617 3300048920 Bacteria 1258
102 Ga0496118_0005035 3300048921 Bacteria 15244
103 Ga0496119_0001614 3300048922 Bacteria 26712
104 Ga0496119_0008484 3300048922 Bacteria 9017
105 Ga0496119_0043300 3300048922 Bacteria 2846
106 Ga0496120_0000791 3300048923 Bacteria 45642
107 Ga0496121_0017459 3300048924 Bacteria 7332
108 Ga0496121_0112674 3300048924 Bacteria 2072
109 Ga0496121_0135153 3300048924 Bacteria 1838
110 Ga0496121_0237462 3300048924 Bacteria 1272
111 Ga0496122_0006039 3300048925 Bacteria 14122
112 Ga0496122_0015147 3300048925 Bacteria 7390
113 Ga0496122_0016642 3300048925 Bacteria 6935
114 Ga0496122_0022248 3300048925 Bacteria 5642
115 Ga0496122_0081890 3300048925 Bacteria 2244
116 Ga0496122_0117030 3300048925 Bacteria 1731
117 Ga0496123_0050571 3300048926 Bacteria 2775
118 Ga0496123_0102090 3300048926 Bacteria 1666
119 Ga0496124_0000512 3300048927 Bacteria 66825
120 Ga0496124_0001430 3300048927 Bacteria 35320
121 Ga0496124_0078482 3300048927 Bacteria 2721
122 Ga0496124_0089309 3300048927 Bacteria 2516
123 Ga0496125_0000535 3300048928 Bacteria 65395
124 Ga0496125_0004666 3300048928 Bacteria 15625
125 Ga0496125_0239544 3300048928 Bacteria 1153
126 Ga0496126_0008724 3300048929 Bacteria 10886
127 Ga0496126_0035300 3300048929 Bacteria 4688
128 Ga0496126_0261649 3300048929 Bacteria 1438
129 Ga0501306_000057 3300049127 Bacteria 5953
130 Ga0501032_0039582 3300049569 Bacteria 3206
131 Ga0501033_0030301 3300049570 Bacteria 4066
132 Ga0501036_0056679 3300049572 Bacteria 3320
133 Ga0501037_0002622 3300049573 Bacteria 12973
134 Ga0501039_0070430 3300049575 Bacteria 2717
135 Ga0501043_0001912 3300049579 Bacteria 17850
136 Ga0501070_0243147 3300049586 Bacteria 1473
137 Ga0501080_0028820 3300049742 Bacteria 5169
138 Ga0501035_0038088 3300049822 Bacteria 4354
139 Ga0501044_0015709 3300049823 Bacteria 8153
140 2864733811 2864733723 Bacteria 6770668
141 2511178397 2510917027 Bacteria 5287437
142 2524186915 2524023129 Bacteria 6762600
143 2550904784 2548877040 Bacteria 7507281
144 2556062981 2554235469 Bacteria 3590176
145 2563926209 2563366752 Bacteria 4961801
146 2571532138 2571042143 Bacteria 6986194
147 2573041713 2571042588 Bacteria 5045676
148 2580931651 2579778775 Bacteria 5360914
149 2587740872 2585428059 Bacteria 8696589
150 2621274449 2619619294 Bacteria 5575484
151 2643737718 2643221543 Bacteria 6628015
152 2644427857 2643221676 Bacteria 8119172
153 2723603134 2721755693 Bacteria 6126117
154 2728533814 2728368933 Bacteria 7044283
155 2730139163 2728369359 Bacteria 5621728
156 2753808528 2751185905 Bacteria 6142767
157 2791213639 2788500588 Bacteria 4584915
158 2791214808 2788500588 Bacteria 4584915
159 2793186268 2791355222 Bacteria 5898266
160 2802436313 2802428803 Bacteria 5806948
161 2819627823 2818991451 Bacteria 4697364
162 2819629604 2818991451 Bacteria 4697364
163 2819672044 2818991459 Bacteria 8736032
164 2821113910 2821111986 Bacteria 6894338
165 2857455937 2857453340 Bacteria 8090534
166 2857476687 2857472729 Bacteria 6568124
167 2865007870 2865002811 Bacteria 6333767
168 2881639273 2881636855 Bacteria 5205297
169 2885530266 2885526491 Bacteria 7164189
170 2888580686 2888578766 Bacteria 6743310
171 2889044484 2889042446 Bacteria 7618936
172 2889050657 2889049205 Bacteria 7524325
173 2889279097 2889276214 Bacteria 5979355
174 2904165827 2904162308 Bacteria 7086713
175 2904491362 2904490793 Bacteria 7046938
176 2904599445 2904595352 Bacteria 6124848
177 2904607619 2904606771 Bacteria 4684500
178 2904609594 2904606771 Bacteria 4684500
179 2904758942 2904755435 Bacteria 7986759
180 2907204316 2907202186 Bacteria 6632024
181 2915609487 2915606848 Bacteria 6032732
182 2919160636 2919160200 Bacteria 6929020
183 2919426152 2919425241 Bacteria 8055701
184 2929208160 2929206907 Bacteria 5918291
185 2931387918 2931384279 Bacteria 7299545
186 2938651421 2938649242 Bacteria 7118381
187 2939595325 2939593269 Bacteria 4798695
188 2939681726 2939679117 Bacteria 6921672
189 2939706045 2939702853 Bacteria 5139229
190 2945993478 2945991243 Bacteria 7008369
191 2946056232 2946053406 Bacteria 6978655
192 2968562700 2968558590 Bacteria 6956864
193 2971406707 2971403814 Bacteria 7370929
194 2971412045 2971410472 Bacteria 8311090
195 2971515320 2971511577 Bacteria 5404012
196 2980181415 2980176882 Bacteria 5397533
197 2984528623 2984527788 Bacteria 5288478
198 2984534726 2984532647 Bacteria 5288506
199 2988227728 2988225383 Bacteria 7221625
200 2996634173 2996632988 Bacteria 6921523
201 2996711089 2996706504 Bacteria 5757485
202 648169501 648028048 Bacteria 5394884
203 8002323272 8002317523 Bacteria 8051857
204 8023439501 8023438354 Bacteria 5779374
205 8054467475 8054465665 Bacteria 7323556
206 8054803900 8054795415 Bacteria 9785225
207 8055534607 8055531788 Bacteria 5249694
208 8055535880 8055531788 Bacteria 5249694
209 8055637150 8055632911 Bacteria 5283357
210 8056535048 8056533031 Bacteria 8964429
211 8057734195 8057733483 Bacteria 6578323
212 8057978491 8057977335 Bacteria 5694872
213 JGI25151J46595_10003858
214 JGI25151J46595_10007724
215 JGI25151J46595_10041309
216 Ga0006562J51391_1002003
217 Ga0055538_1000162
218 Ga0055538_1000234
219 Ga0055541_1002126
220 Ga0070713_100061904
221 Ga0099795_10001060
222 Ga0105244_10007657
223 Ga0105244_10008226
224 Ga0105246_10001866
225 Ga0157371_10140271
226 Ga0209784_100114
227 Ga0209784_100127
228 Ga0209784_103072
229 Ga0209566_100041
230 Ga0209566_100151
231 Ga0209566_100234
232 Ga0209566_100259
233 Ga0209566_102551
234 Ga0209437_100357
235 Ga0209258_101268
236 Ga0209675_1010973
237 Ga0209676_1005305
238 Ga0209676_1021885
239 Ga0209676_1030744
240 Ga0209025_1003688
241 Ga0209025_1006207
242 Ga0209025_1015331
243 Ga0209025_1017039
244 Ga0209025_1021717
245 Ga0209025_1028603
246 Ga0209025_1053616
247 Ga0265356_1001923
248 Ga0265770_1000102
249 Ga0265765_1002235
250 Ga0265760_10007245
251 Ga0265316_10048558
252 Ga0316575_10006828
253 Ga0316579_10000511
254 Ga0316579_10008704
255 Ga0316576_10017533
256 Ga0316576_10098019
257 Ga0316576_10186475
258 Ga0316578_10003736
259 Ga0316578_10012264
260 Ga0316578_10085561
261 Ga0307516_10000209
262 Ga0316577_10001617
263 Ga0316577_10022475
264 Ga0316583_10003302
265 Ga0316583_10008124
266 Ga0316585_10000160
267 Ga0316585_10001132
268 Ga0316593_10011618
269 Ga0316593_10051764
270 Ga0316586_1005258
271 Ga0316588_1006522
272 Ga0316588_1019329
273 Ga0316587_1001629
274 Ga0316587_1010155
275 Ga0316596_1011261
276 Ga0316574_0019996
277 Ga0316574_0021541
278 Ga0316574_0227334
279 Ga0316574_0249631
280 Ga0316582_0004050
281 Ga0316582_0014617
282 Ga0316584_0003482
283 Ga0316584_0004136
284 Ga0395900_0560859
285 Ga0436362_0808556
286 Ga0439439_0000170
287 Ga0439433_0027536
288 Ga0439449_0000041
289 Ga0439462_0001277
290 Ga0451577_0001975
291 Ga0453683_0000257
292 Ga0453683_0012439
293 Ga0453684_0000762
294 Ga0453684_0014897
295 Ga0453684_0072634
296 Ga0453684_0090419
297 Ga0453684_0125363
298 Ga0453684_0464024
299 Ga0451576_0211798
300 Ga0495605_0039283
301 Ga0495585_0092539
302 Ga0495606_0122904
303 Ga0496110_0362463
304 Ga0496116_0000932
305 Ga0496116_0007198
306 Ga0496116_0009617
307 Ga0496116_0023205
308 Ga0496116_0031937
309 Ga0496116_0073097
310 Ga0496116_0141032
311 Ga0496117_0013582
312 Ga0496117_0035074
313 Ga0496117_0171617
314 Ga0496118_0005035
315 Ga0496119_0001614
316 Ga0496119_0008484
317 Ga0496119_0043300
318 Ga0496120_0000791
319 Ga0496121_0017459
320 Ga0496121_0112674
321 Ga0496121_0135153
322 Ga0496121_0237462
323 Ga0496122_0006039
324 Ga0496122_0015147
325 Ga0496122_0016642
326 Ga0496122_0022248
327 Ga0496122_0081890
328 Ga0496122_0117030
329 Ga0496123_0050571
330 Ga0496123_0102090
331 Ga0496124_0000512
332 Ga0496124_0001430
333 Ga0496124_0078482
334 Ga0496124_0089309
335 Ga0496125_0000535
336 Ga0496125_0004666
337 Ga0496125_0239544
338 Ga0496126_0008724
339 Ga0496126_0035300
340 Ga0496126_0261649
341 Ga0501306_000057
342 Ga0501032_0039582
343 Ga0501033_0030301
344 Ga0501036_0056679
345 Ga0501037_0002622
346 Ga0501039_0070430
347 Ga0501043_0001912
348 Ga0501070_0243147
349 Ga0501080_0028820
350 Ga0501035_0038088
351 Ga0501044_0015709
352 2864733811
353 2511178397
354 2524186915
355 2550904784
356 2556062981
357 2563926209
358 2571532138
359 2573041713
360 2580931651
361 2587740872
362 2621274449
363 2643737718
364 2644427857
365 2723603134
366 2728533814
367 2730139163
368 2753808528
369 2791213639
370 2791214808
371 2793186268
372 2802436313
373 2819627823
374 2819629604
375 2819672044
376 2821113910
377 2857455937
378 2857476687
379 2865007870
380 2881639273
381 2885530266
382 2888580686
383 2889044484
384 2889050657
385 2889279097
386 2904165827
387 2904491362
388 2904599445
389 2904607619
390 2904609594
391 2904758942
392 2907204316
393 2915609487
394 2919160636
395 2919426152
396 2929208160
397 2931387918
398 2938651421
399 2939595325
400 2939681726
401 2939706045
402 2945993478
403 2946056232
404 2968562700
405 2971406707
406 2971412045
407 2971515320
408 2980181415
409 2984528623
410 2984534726
411 2988227728
412 2996634173
413 2996711089
414 648169501
415 8002323272
416 8023439501
417 8054467475
418 8054803900
419 8055534607
420 8055535880
421 8055637150
422 8056535048
423 8057734195
424 8057978491

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03255

ACCA

Acetyl co-enzyme A carboxylase carboxyltransferase-like

1

309

0.99

PF01039

Carboxyl_trans

Carboxyl transferase domain

75

303

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f9i-assembly1.cif.gz_C crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus 0.9303 4 315
5kdr-assembly1.cif.gz_A-2 the crystal structure of carboxyltransferase from staphylococcus aureus bound to the antimicrobial agent moiramide b. 0.9286 5 315
2f9i-assembly1.cif.gz_A crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus 0.9278 2 315
2f9i-assembly1.cif.gz_C crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus 0.9272 4 315
5kdr-assembly1.cif.gz_A-2 the crystal structure of carboxyltransferase from staphylococcus aureus bound to the antimicrobial agent moiramide b. 0.9256 5 315
ID Description Score Start End Superfamily
af_Q2FXM7_1_314_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9542 4 315 3.90.226.10
af_Q2FXM7_1_314_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9454 4 315 3.90.226.10
af_P9WQH9_238_492_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9103 53 311 3.90.226.10
af_P9WQH9_238_492_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9001 53 311 3.90.226.10
4l6wA02 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8703 79 289 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A3R8XDR9-F1-model_v4 deleted 0.975 63 152
AF-A0A0P9DLY9-F1-model_v4 acetyl-CoA carboxytransferase (EC 2.1.3.15) 0.973 53 161 GO:0003989
GO:0005524
GO:0006633
GO:0009317
GO:0016743
GO:2001295
AF-A0A099DAY5-F1-model_v4 deleted 0.9704 173 295
AF-A0A2G4G3K3-F1-model_v4 acetyl-CoA carboxytransferase (EC 2.1.3.15) 0.9676 5 262 GO:0003989
GO:0005524
GO:0006633
GO:0009317
GO:0016743
GO:2001295
AF-A0A258Z5K8-F1-model_v4 deleted 0.9671 1 311

Map