F323394

General Info

Members Datasets Scaffolds Average Seq Length
212 146 212 145

Family's Representative Sequence

Representative Sequence 3300050512|nmdc:mga0n895_143795_c1|nmdc:mga0n895_143795_c1_1919_2395
Length 158
Sequence MTARNLDRELDMDSAIASPLPDQSEEGAGEVSLVRLYVLRAAYLLLVVGVGAMILPPVISHEPTARGVIPSLLCGVWLLAFLGLLHPLKMLPLLMFELAWKTVWLLAFGLPQYLSGQLPPTFAEDSFNIAFGVLLMPLVIPWPYVWRHYVKRPGARWR

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
66 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
102 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
103 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
104 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
105 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
106 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
107 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
108 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
109 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
110 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
111 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
112 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
113 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
114 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
115 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
116 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
117 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
118 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
119 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
120 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
123 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
124 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
125 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
126 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
127 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
128 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
129 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
130 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
131 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
132 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
133 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
134 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
135 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
136 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
137 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
138 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
139 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
140 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
141 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
142 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
143 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
144 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
145 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
146 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.42
Nodule 0
Rhizoplane 2.36
Rhizosphere 94.81
Stem 0
Stem Tuber 0
Unclassified 1.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1004069 3300001915 Bacteria 3323
2 JGI24740J21852_10009825 3300001979 Bacteria 3722
3 JGI24739J22299_10006120 3300001989 Bacteria 4547
4 JGI24737J22298_10014164 3300001990 Bacteria 2590
5 JGI24735J21928_10007905 3300002067 Bacteria 3454
6 Ga0065714_10121199 3300005288 Bacteria 1338
7 Ga0065707_10276566 3300005295 Unclassified 1058
8 Ga0070658_10116159 3300005327 Bacteria 2220
9 Ga0070676_11016591 3300005328 Bacteria 623
10 Ga0070683_100018390 3300005329 Bacteria 6189
11 Ga0070683_100297131 3300005329 Unclassified 1536
12 Ga0068869_100249262 3300005334 Bacteria 1418
13 Ga0070680_100238608 3300005336 Bacteria 1536
14 Ga0070660_100071100 3300005339 Bacteria 2716
15 Ga0070689_100680537 3300005340 Bacteria 897
16 Ga0070687_100352026 3300005343 Bacteria 951
17 Ga0070661_100005367 3300005344 Bacteria 8836
18 Ga0070661_100036908 3300005344 Bacteria 3553
19 Ga0070692_10019940 3300005345 Bacteria 3244
20 Ga0070668_100046887 3300005347 Bacteria 3321
21 Ga0070669_100019230 3300005353 Bacteria 4878
22 Ga0070669_101437242 3300005353 Unclassified 599
23 Ga0070671_100210214 3300005355 Unclassified 1650
24 Ga0070688_100176297 3300005365 Bacteria 1479
25 Ga0070659_101041535 3300005366 Bacteria 719
26 Ga0070705_100160964 3300005440 Bacteria 1500
27 Ga0070663_100006315 3300005455 Bacteria 7115
28 Ga0070663_100066589 3300005455 Bacteria 2610
29 Ga0070662_100016748 3300005457 Bacteria 4926
30 Ga0070662_100429443 3300005457 Bacteria 1094
31 Ga0070679_100287952 3300005530 Bacteria 1594
32 Ga0070679_100695087 3300005530 Bacteria 960
33 Ga0070684_100027521 3300005535 Bacteria 4800
34 Ga0068853_100001982 3300005539 Bacteria 15099
35 Ga0070686_100000281 3300005544 Bacteria 34343
36 Ga0070696_100040310 3300005546 Bacteria 3225
37 Ga0070693_100013359 3300005547 Bacteria 4180
38 Ga0068855_100022763 3300005563 Bacteria 7509
39 Ga0070664_100005898 3300005564 Bacteria 9893
40 Ga0070664_100018874 3300005564 Bacteria 5669
41 Ga0070664_100164149 3300005564 Bacteria 1967
42 Ga0068857_100031382 3300005577 Unclassified 4695
43 Ga0068857_100032469 3300005577 Bacteria 4616
44 Ga0068857_100201108 3300005577 Bacteria 1816
45 Ga0068854_100004168 3300005578 Bacteria 9092
46 Ga0068854_100250679 3300005578 Bacteria 1413
47 Ga0068856_100319416 3300005614 Bacteria 1570
48 Ga0068852_100021513 3300005616 Bacteria 5153
49 Ga0068859_100045450 3300005617 Bacteria 4412
50 Ga0068859_100051168 3300005617 Bacteria 4151
51 Ga0068864_100018114 3300005618 Bacteria 5877
52 Ga0068864_100181915 3300005618 Bacteria 1922
53 Ga0068861_100047067 3300005719 Bacteria 3255
54 Ga0068861_101623976 3300005719 Bacteria 637
55 Ga0068851_10706405 3300005834 Bacteria 621
56 Ga0068870_10009751 3300005840 Unclassified 4380
57 Ga0068870_10175198 3300005840 Bacteria 1283
58 Ga0068858_100011033 3300005842 Bacteria 8540
59 Ga0068858_101278090 3300005842 Unclassified 722
60 Ga0068860_100069198 3300005843 Bacteria 3354
61 Ga0068862_100003985 3300005844 Bacteria 12532
62 Ga0068862_100022080 3300005844 Bacteria 5324
63 Ga0068862_100209839 3300005844 Bacteria 1759
64 Ga0075431_100028287 3300006847 Bacteria 5757
65 Ga0075433_10268070 3300006852 Bacteria 1513
66 Ga0075429_100012150 3300006880 Bacteria 7464
67 Ga0097620_100045449 3300006931 Bacteria 4412
68 Ga0097620_100051166 3300006931 Bacteria 4151
69 Ga0111539_10180657 3300009094 Bacteria 2464
70 Ga0105245_10289464 3300009098 Bacteria 1604
71 Ga0114129_10253425 3300009147 Bacteria 2362
72 Ga0114129_11227125 3300009147 Bacteria 933
73 Ga0105238_10000545 3300009551 Bacteria 39378
74 Ga0105249_11269391 3300009553 Bacteria 808
75 Ga0105239_11687047 3300010375 Bacteria 733
76 Ga0105246_10142766 3300011119 Bacteria 1802
77 Ga0105246_10373181 3300011119 Unclassified 1176
78 Ga0157373_10023871 3300013100 Bacteria 4431
79 Ga0157373_10638850 3300013100 Unclassified 777
80 Ga0157370_10486040 3300013104 Bacteria 1134
81 Ga0157374_10026954 3300013296 Bacteria 5176
82 Ga0157374_10038488 3300013296 Bacteria 4396
83 Ga0157374_11001545 3300013296 Bacteria 855
84 Ga0157372_10022460 3300013307 Bacteria 6828
85 Ga0157372_10039635 3300013307 Bacteria 5200
86 Ga0157375_10369802 3300013308 Bacteria 1600
87 Ga0157377_10108027 3300014745 Bacteria 1668
88 Ga0157379_10922266 3300014968 Bacteria 829
89 Ga0163161_11163546 3300017792 Bacteria 665
90 Ga0213876_10000274 3300021384 Bacteria 47640
91 Ga0207647_10038132 3300025904 Bacteria 3040
92 Ga0207645_10816519 3300025907 Bacteria 634
93 Ga0207643_10005528 3300025908 Bacteria 6755
94 Ga0207705_10002034 3300025909 Bacteria 15735
95 Ga0207654_10621449 3300025911 Bacteria 772
96 Ga0207707_10015004 3300025912 Bacteria 6746
97 Ga0207707_11400179 3300025912 Bacteria 558
98 Ga0207660_10029730 3300025917 Bacteria 3751
99 Ga0207662_10183570 3300025918 Bacteria 1347
100 Ga0207662_10428497 3300025918 Bacteria 901
101 Ga0207657_10006440 3300025919 Bacteria 12168
102 Ga0207649_10006561 3300025920 Bacteria 6321
103 Ga0207652_10013090 3300025921 Bacteria 6716
104 Ga0207681_10072954 3300025923 Bacteria 2399
105 Ga0207694_10000424 3300025924 Bacteria 39415
106 Ga0207687_10009501 3300025927 Bacteria 6360
107 Ga0207644_10597432 3300025931 Unclassified 916
108 Ga0207690_10002712 3300025932 Bacteria 10687
109 Ga0207706_10002375 3300025933 Bacteria 18376
110 Ga0207706_10272344 3300025933 Bacteria 1477
111 Ga0207706_10643438 3300025933 Bacteria 908
112 Ga0207670_10131254 3300025936 Bacteria 1836
113 Ga0207689_10243323 3300025942 Bacteria 1487
114 Ga0207661_10111711 3300025944 Bacteria 2312
115 Ga0207679_10013578 3300025945 Bacteria 5338
116 Ga0207679_10136995 3300025945 Bacteria 1973
117 Ga0207667_10068199 3300025949 Bacteria 3704
118 Ga0207651_10109825 3300025960 Bacteria 2067
119 Ga0207712_10365265 3300025961 Bacteria 1204
120 Ga0207712_11103057 3300025961 Bacteria 706
121 Ga0207640_10026469 3300025981 Bacteria 3522
122 Ga0207640_10971219 3300025981 Bacteria 746
123 Ga0207703_10514258 3300026035 Bacteria 1125
124 Ga0207703_10891850 3300026035 Bacteria 851
125 Ga0207639_10011915 3300026041 Bacteria 6049
126 Ga0207678_10005555 3300026067 Bacteria 11267
127 Ga0207678_10005815 3300026067 Bacteria 10993
128 Ga0207678_11375157 3300026067 Bacteria 624
129 Ga0207676_10041333 3300026095 Unclassified 3538
130 Ga0207674_10004591 3300026116 Bacteria 16580
131 Ga0207674_10008155 3300026116 Bacteria 12145
132 Ga0207674_10219681 3300026116 Bacteria 1849
133 Ga0207675_101444082 3300026118 Bacteria 709
134 Ga0207698_10011478 3300026142 Bacteria 5748
135 Ga0207428_10420067 3300027907 Bacteria 977
136 Ga0268265_10056956 3300028380 Bacteria 2976
137 Ga0268265_10792446 3300028380 Bacteria 923
138 Ga0268264_10229305 3300028381 Bacteria 1714
139 Ga0268264_10446445 3300028381 Bacteria 1252
140 Ga0307509_10062257 3300031507 Bacteria 3935
141 Ga0307408_100340172 3300031548 Bacteria 1270
142 Ga0307408_100464723 3300031548 Bacteria 1100
143 Ga0307408_101590401 3300031548 Bacteria 620
144 Ga0265314_10001052 3300031711 Bacteria 32112
145 Ga0307405_10127732 3300031731 Bacteria 1751
146 Ga0307405_10143311 3300031731 Bacteria 1669
147 Ga0307413_10014555 3300031824 Bacteria 4001
148 Ga0307413_10064875 3300031824 Bacteria 2271
149 Ga0307413_10554827 3300031824 Bacteria 932
150 Ga0307410_10139578 3300031852 Bacteria 1791
151 Ga0307410_10317415 3300031852 Bacteria 1235
152 Ga0307410_10427352 3300031852 Bacteria 1076
153 Ga0307410_11997168 3300031852 Unclassified 517
154 Ga0307406_10051947 3300031901 Bacteria 2605
155 Ga0307406_10090839 3300031901 Bacteria 2056
156 Ga0307406_10450382 3300031901 Bacteria 1032
157 Ga0307407_10237036 3300031903 Bacteria 1242
158 Ga0307412_10232217 3300031911 Bacteria 1421
159 Ga0307412_10603249 3300031911 Bacteria 930
160 Ga0307409_100157763 3300031995 Bacteria 1980
161 Ga0307416_100225161 3300032002 Bacteria 1803
162 Ga0307414_10049885 3300032004 Bacteria 2896
163 Ga0307414_10298427 3300032004 Bacteria 1362
164 Ga0307414_10432624 3300032004 Unclassified 1150
165 Ga0307414_10495921 3300032004 Bacteria 1079
166 Ga0307414_10577956 3300032004 Bacteria 1005
167 Ga0307414_10809542 3300032004 Bacteria 855
168 Ga0307411_10131052 3300032005 Bacteria 1832
169 Ga0307411_10485300 3300032005 Bacteria 1041
170 Ga0307411_10500247 3300032005 Bacteria 1027
171 Ga0307415_100146190 3300032126 Bacteria 1813
172 Ga0307415_100198523 3300032126 Bacteria 1589
173 Ga0307415_100217552 3300032126 Bacteria 1529
174 Ga0307415_101230251 3300032126 Bacteria 707
175 Ga0373945_0309776 3300035116 Bacteria 678
176 Ga0373943_0097313 3300035170 Bacteria 1533
177 Ga0373943_0405226 3300035170 Bacteria 788
178 Ga0373942_0115235 3300035207 Bacteria 835
179 Ga0395899_0172399 3300037312 Bacteria 1523
180 Ga0395900_0290922 3300037418 Bacteria 1622
181 Ga0395900_0948925 3300037418 Bacteria 782
182 Ga0395900_1609315 3300037418 Unclassified 561
183 Ga0395898_1469931 3300037466 Unclassified 608
184 Ga0395905_0140386 3300037471 Bacteria 2273
185 Ga0395905_0245591 3300037471 Bacteria 1672
186 Ga0395901_0506522 3300038443 Bacteria 1228
187 Ga0436365_0257402 3300039437 Bacteria 164674
188 Ga0451797_0770475 3300041453 Bacteria 630
189 Ga0450906_018326 3300042145 Bacteria 1257
190 Ga0451576_0084533 3300045051 Bacteria 3301
191 Ga0495592_0093341 3300046454 Bacteria 2155
192 Ga0495580_0019086 3300046472 Bacteria 5098
193 Ga0495607_0167280 3300046501 Bacteria 1113
194 Ga0495597_0175144 3300046542 Bacteria 869
195 Ga0495625_0000404 3300046660 Bacteria 65897
196 Ga0495625_0331317 3300046660 Bacteria 967
197 Ga0495613_0061529 3300046689 Bacteria 2749
198 Ga0495684_0180403 3300047471 Bacteria 1565
199 Ga0496101_0217485 3300048904 Bacteria 1482
200 Ga0496104_0980954 3300048907 Unclassified 749
201 Ga0496112_1390266 3300048915 Unclassified 617
202 Ga0496113_0562045 3300048916 Bacteria 915
203 Ga0501242_044186 3300049674 Unclassified 638
204 nmdc:mga05p37_1464482_c1 3300050507 Bacteria 683
205 nmdc:mga09592_9821_c2 3300050508 Bacteria 7443
206 nmdc:mga08y16_153114_c1 3300050511 Bacteria 2396
207 nmdc:mga0n895_143795_c1 3300050512 Bacteria 2414
208 nmdc:mga0n895_273601_c1 3300050512 Bacteria 1713
209 nmdc:mga08x19_868388_c1 3300050514 Bacteria 641
210 Ga0500562_006070 3300053108 Bacteria 3042
211 Ga0500559_0198990 3300053136 Bacteria 945
212 Ga0500616_0008457 3300053153 Bacteria 6388

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013100 Ga0157373_10638850 Ga0157373_106388501 126
2 3300013307 Ga0157372_10039635 Ga0157372_100396354 126
3 3300021384 Ga0213876_10000274 Ga0213876_1000027446 128
4 3300039437 Ga0436365_0257402 Ga0436365_0257402_116452_116847 128
5 3300048907 Ga0496104_0980954 Ga0496104_0980954_20_421 128
6 3300005288 Ga0065714_10121199 Ga0065714_101211993 130
7 3300005343 Ga0070687_100352026 Ga0070687_1003520261 130
8 3300005844 Ga0068862_100003985 Ga0068862_1000039855 130
9 3300025918 Ga0207662_10428497 Ga0207662_104284971 130
10 3300053108 Ga0500562_006070 Ga0500562_006070_845_1309 130
11 3300053136 Ga0500559_0198990 Ga0500559_0198990_464_877 130
12 3300053153 Ga0500616_0008457 Ga0500616_0008457_4522_4986 130
13 3300009551 Ga0105238_10000545 Ga0105238_100005453 131
14 3300025924 Ga0207694_10000424 Ga0207694_100004243 131
15 3300025933 Ga0207706_10272344 Ga0207706_102723443 131
16 3300031852 Ga0307410_10139578 Ga0307410_101395782 131
17 3300031995 Ga0307409_100157763 Ga0307409_1001577632 131
18 3300032002 Ga0307416_100225161 Ga0307416_1002251613 131
19 3300032005 Ga0307411_10500247 Ga0307411_105002471 131
20 3300032126 Ga0307415_100146190 Ga0307415_1001461901 131
21 3300005577 Ga0068857_100031382 Ga0068857_1000313822 132
22 3300005618 Ga0068864_100018114 Ga0068864_1000181145 132
23 3300005840 Ga0068870_10009751 Ga0068870_100097514 132
24 3300005844 Ga0068862_100209839 Ga0068862_1002098393 132
25 3300009553 Ga0105249_11269391 Ga0105249_112693911 132
26 3300010375 Ga0105239_11687047 Ga0105239_116870472 132
27 3300011119 Ga0105246_10142766 Ga0105246_101427663 132
28 3300013308 Ga0157375_10369802 Ga0157375_103698022 132
29 3300014968 Ga0157379_10922266 Ga0157379_109222662 132
30 3300025908 Ga0207643_10005528 Ga0207643_100055284 132
31 3300025961 Ga0207712_11103057 Ga0207712_111030572 132
32 3300026067 Ga0207678_11375157 Ga0207678_113751572 132
33 3300026095 Ga0207676_10041333 Ga0207676_100413332 132
34 3300026116 Ga0207674_10004591 Ga0207674_1000459112 132
35 3300028380 Ga0268265_10792446 Ga0268265_107924462 132
36 3300045051 Ga0451576_0084533 Ga0451576_0084533_1579_2028 132
37 3300046501 Ga0495607_0167280 Ga0495607_0167280_573_1022 132
38 3300046454 Ga0495592_0093341 Ga0495592_0093341_1702_2103 133
39 3300046542 Ga0495597_0175144 Ga0495597_0175144_272_694 136
40 3300046660 Ga0495625_0000404 Ga0495625_0000404_41984_42406 136
41 3300005328 Ga0070676_11016591 Ga0070676_110165912 137
42 3300005329 Ga0070683_100297131 Ga0070683_1002971312 137
43 3300005334 Ga0068869_100249262 Ga0068869_1002492622 137
44 3300005340 Ga0070689_100680537 Ga0070689_1006805372 137
45 3300005353 Ga0070669_101437242 Ga0070669_1014372421 137
46 3300005365 Ga0070688_100176297 Ga0070688_1001762972 137
47 3300005440 Ga0070705_100160964 Ga0070705_1001609643 137
48 3300005457 Ga0070662_100429443 Ga0070662_1004294432 137
49 3300005530 Ga0070679_100695087 Ga0070679_1006950872 137
50 3300005546 Ga0070696_100040310 Ga0070696_1000403103 137
51 3300005564 Ga0070664_100164149 Ga0070664_1001641493 137
52 3300005577 Ga0068857_100201108 Ga0068857_1002011083 137
53 3300005578 Ga0068854_100250679 Ga0068854_1002506793 137
54 3300005617 Ga0068859_100045450 Ga0068859_1000454506 137
55 3300005840 Ga0068870_10175198 Ga0068870_101751983 137
56 3300005844 Ga0068862_100022080 Ga0068862_1000220802 137
57 3300006852 Ga0075433_10268070 Ga0075433_102680703 137
58 3300006931 Ga0097620_100045449 Ga0097620_1000454496 137
59 3300009094 Ga0111539_10180657 Ga0111539_101806575 137
60 3300014745 Ga0157377_10108027 Ga0157377_101080272 137
61 3300025907 Ga0207645_10816519 Ga0207645_108165191 137
62 3300025912 Ga0207707_11400179 Ga0207707_114001791 137
63 3300025918 Ga0207662_10183570 Ga0207662_101835705 137
64 3300025933 Ga0207706_10643438 Ga0207706_106434381 137
65 3300025936 Ga0207670_10131254 Ga0207670_101312542 137
66 3300025942 Ga0207689_10243323 Ga0207689_102433233 137
67 3300025945 Ga0207679_10136995 Ga0207679_101369953 137
68 3300025960 Ga0207651_10109825 Ga0207651_101098253 137
69 3300025981 Ga0207640_10971219 Ga0207640_109712191 137
70 3300026116 Ga0207674_10219681 Ga0207674_102196814 137
71 3300026118 Ga0207675_101444082 Ga0207675_1014440822 137
72 3300027907 Ga0207428_10420067 Ga0207428_104200672 137
73 3300028380 Ga0268265_10056956 Ga0268265_100569564 137
74 3300028381 Ga0268264_10446445 Ga0268264_104464453 137
75 3300048916 Ga0496113_0562045 Ga0496113_0562045_446_880 137
76 3300050511 nmdc:mga08y16_153114_c1 nmdc:mga08y16_153114_c1_981_1415 137
77 3300050512 nmdc:mga0n895_273601_c1 nmdc:mga0n895_273601_c1_364_798 137
78 3300035170 Ga0373943_0405226 Ga0373943_0405226_314_739 141
79 3300005295 Ga0065707_10276566 Ga0065707_102765662 142
80 3300013296 Ga0157374_10038488 Ga0157374_100384882 144
81 3300032005 Ga0307411_10485300 Ga0307411_104853002 144
82 3300035207 Ga0373942_0115235 Ga0373942_0115235_24_458 144
83 3300048904 Ga0496101_0217485 Ga0496101_0217485_859_1293 144
84 3300005347 Ga0070668_100046887 Ga0070668_1000468875 145
85 3300005355 Ga0070671_100210214 Ga0070671_1002102143 145
86 3300013296 Ga0157374_11001545 Ga0157374_110015452 145
87 3300025931 Ga0207644_10597432 Ga0207644_105974322 145
88 3300031507 Ga0307509_10062257 Ga0307509_100622573 145
89 3300031548 Ga0307408_100340172 Ga0307408_1003401722 145
90 3300031548 Ga0307408_100464723 Ga0307408_1004647232 145
91 3300031548 Ga0307408_101590401 Ga0307408_1015904012 145
92 3300031731 Ga0307405_10127732 Ga0307405_101277323 145
93 3300031731 Ga0307405_10143311 Ga0307405_101433113 145
94 3300031824 Ga0307413_10014555 Ga0307413_100145555 145
95 3300031824 Ga0307413_10064875 Ga0307413_100648752 145
96 3300031824 Ga0307413_10554827 Ga0307413_105548271 145
97 3300031852 Ga0307410_10317415 Ga0307410_103174153 145
98 3300031852 Ga0307410_10427352 Ga0307410_104273522 145
99 3300031852 Ga0307410_11997168 Ga0307410_119971681 145
100 3300031901 Ga0307406_10051947 Ga0307406_100519472 145
101 3300031901 Ga0307406_10090839 Ga0307406_100908394 145
102 3300031901 Ga0307406_10450382 Ga0307406_104503822 145
103 3300031903 Ga0307407_10237036 Ga0307407_102370362 145
104 3300031911 Ga0307412_10232217 Ga0307412_102322174 145
105 3300031911 Ga0307412_10603249 Ga0307412_106032491 145
106 3300032004 Ga0307414_10049885 Ga0307414_100498852 145
107 3300032004 Ga0307414_10298427 Ga0307414_102984271 145
108 3300032004 Ga0307414_10432624 Ga0307414_104326242 145
109 3300032004 Ga0307414_10495921 Ga0307414_104959212 145
110 3300032004 Ga0307414_10577956 Ga0307414_105779563 145
111 3300032004 Ga0307414_10809542 Ga0307414_108095422 145
112 3300032005 Ga0307411_10131052 Ga0307411_101310522 145
113 3300032126 Ga0307415_100198523 Ga0307415_1001985232 145
114 3300032126 Ga0307415_100217552 Ga0307415_1002175522 145
115 3300032126 Ga0307415_101230251 Ga0307415_1012302512 145
116 3300035170 Ga0373943_0097313 Ga0373943_0097313_658_1179 145
117 3300042145 Ga0450906_018326 Ga0450906_018326_51_494 145
118 3300046660 Ga0495625_0331317 Ga0495625_0331317_292_732 145
119 3300049674 Ga0501242_044186 Ga0501242_044186_108_548 145
120 3300001915 JGI24741J21665_1004069 JGI24741J21665_10040693 146
121 3300001979 JGI24740J21852_10009825 JGI24740J21852_100098253 146
122 3300001989 JGI24739J22299_10006120 JGI24739J22299_100061203 146
123 3300001990 JGI24737J22298_10014164 JGI24737J22298_100141643 146
124 3300002067 JGI24735J21928_10007905 JGI24735J21928_100079053 146
125 3300005327 Ga0070658_10116159 Ga0070658_101161592 146
126 3300005329 Ga0070683_100018390 Ga0070683_1000183903 146
127 3300005336 Ga0070680_100238608 Ga0070680_1002386083 146
128 3300005339 Ga0070660_100071100 Ga0070660_1000711002 146
129 3300005344 Ga0070661_100005367 Ga0070661_1000053674 146
130 3300005344 Ga0070661_100036908 Ga0070661_1000369083 146
131 3300005345 Ga0070692_10019940 Ga0070692_100199403 146
132 3300005353 Ga0070669_100019230 Ga0070669_1000192305 146
133 3300005366 Ga0070659_101041535 Ga0070659_1010415352 146
134 3300005455 Ga0070663_100006315 Ga0070663_1000063155 146
135 3300005455 Ga0070663_100066589 Ga0070663_1000665894 146
136 3300005457 Ga0070662_100016748 Ga0070662_1000167484 146
137 3300005530 Ga0070679_100287952 Ga0070679_1002879524 146
138 3300005535 Ga0070684_100027521 Ga0070684_1000275213 146
139 3300005539 Ga0068853_100001982 Ga0068853_1000019829 146
140 3300005544 Ga0070686_100000281 Ga0070686_10000028135 146
141 3300005547 Ga0070693_100013359 Ga0070693_1000133593 146
142 3300005563 Ga0068855_100022763 Ga0068855_1000227634 146
143 3300005564 Ga0070664_100005898 Ga0070664_1000058988 146
144 3300005564 Ga0070664_100018874 Ga0070664_1000188746 146
145 3300005577 Ga0068857_100032469 Ga0068857_1000324694 146
146 3300005578 Ga0068854_100004168 Ga0068854_1000041684 146
147 3300005614 Ga0068856_100319416 Ga0068856_1003194162 146
148 3300005616 Ga0068852_100021513 Ga0068852_1000215133 146
149 3300005617 Ga0068859_100051168 Ga0068859_1000511681 146
150 3300005618 Ga0068864_100181915 Ga0068864_1001819152 146
151 3300005719 Ga0068861_100047067 Ga0068861_1000470675 146
152 3300005719 Ga0068861_101623976 Ga0068861_1016239762 146
153 3300005834 Ga0068851_10706405 Ga0068851_107064051 146
154 3300005842 Ga0068858_100011033 Ga0068858_1000110335 146
155 3300005842 Ga0068858_101278090 Ga0068858_1012780902 146
156 3300005843 Ga0068860_100069198 Ga0068860_1000691985 146
157 3300006847 Ga0075431_100028287 Ga0075431_1000282873 146
158 3300006880 Ga0075429_100012150 Ga0075429_1000121503 146
159 3300006931 Ga0097620_100051166 Ga0097620_1000511661 146
160 3300009098 Ga0105245_10289464 Ga0105245_102894642 146
161 3300009147 Ga0114129_10253425 Ga0114129_102534253 146
162 3300009147 Ga0114129_11227125 Ga0114129_112271251 146
163 3300011119 Ga0105246_10373181 Ga0105246_103731811 146
164 3300013100 Ga0157373_10023871 Ga0157373_100238714 146
165 3300013104 Ga0157370_10486040 Ga0157370_104860401 146
166 3300013296 Ga0157374_10026954 Ga0157374_100269543 146
167 3300013307 Ga0157372_10022460 Ga0157372_100224604 146
168 3300017792 Ga0163161_11163546 Ga0163161_111635461 146
169 3300025904 Ga0207647_10038132 Ga0207647_100381324 146
170 3300025909 Ga0207705_10002034 Ga0207705_1000203418 146
171 3300025911 Ga0207654_10621449 Ga0207654_106214492 146
172 3300025912 Ga0207707_10015004 Ga0207707_100150041 146
173 3300025917 Ga0207660_10029730 Ga0207660_100297304 146
174 3300025919 Ga0207657_10006440 Ga0207657_100064403 146
175 3300025920 Ga0207649_10006561 Ga0207649_100065611 146
176 3300025921 Ga0207652_10013090 Ga0207652_100130902 146
177 3300025923 Ga0207681_10072954 Ga0207681_100729544 146
178 3300025927 Ga0207687_10009501 Ga0207687_100095015 146
179 3300025932 Ga0207690_10002712 Ga0207690_100027124 146
180 3300025933 Ga0207706_10002375 Ga0207706_100023754 146
181 3300025944 Ga0207661_10111711 Ga0207661_101117112 146
182 3300025945 Ga0207679_10013578 Ga0207679_100135783 146
183 3300025949 Ga0207667_10068199 Ga0207667_100681993 146
184 3300025961 Ga0207712_10365265 Ga0207712_103652653 146
185 3300025981 Ga0207640_10026469 Ga0207640_100264693 146
186 3300026035 Ga0207703_10514258 Ga0207703_105142582 146
187 3300026035 Ga0207703_10891850 Ga0207703_108918502 146
188 3300026041 Ga0207639_10011915 Ga0207639_100119156 146
189 3300026067 Ga0207678_10005555 Ga0207678_100055552 146
190 3300026067 Ga0207678_10005815 Ga0207678_100058156 146
191 3300026116 Ga0207674_10008155 Ga0207674_100081553 146
192 3300026142 Ga0207698_10011478 Ga0207698_100114781 146
193 3300028381 Ga0268264_10229305 Ga0268264_102293052 146
194 3300031711 Ga0265314_10001052 Ga0265314_1000105226 146
195 3300035116 Ga0373945_0309776 Ga0373945_0309776_170_613 146
196 3300037312 Ga0395899_0172399 Ga0395899_0172399_118_558 146
197 3300037418 Ga0395900_0290922 Ga0395900_0290922_462_902 146
198 3300037418 Ga0395900_0948925 Ga0395900_0948925_107_547 146
199 3300037418 Ga0395900_1609315 Ga0395900_1609315_48_491 146
200 3300037466 Ga0395898_1469931 Ga0395898_1469931_118_558 146
201 3300037471 Ga0395905_0140386 Ga0395905_0140386_671_1114 146
202 3300037471 Ga0395905_0245591 Ga0395905_0245591_160_600 146
203 3300038443 Ga0395901_0506522 Ga0395901_0506522_438_878 146
204 3300041453 Ga0451797_0770475 Ga0451797_0770475_56_496 146
205 3300046472 Ga0495580_0019086 Ga0495580_0019086_704_1147 146
206 3300046689 Ga0495613_0061529 Ga0495613_0061529_1406_1849 146
207 3300047471 Ga0495684_0180403 Ga0495684_0180403_1045_1488 146
208 3300048915 Ga0496112_1390266 Ga0496112_1390266_68_511 146
209 3300050507 nmdc:mga05p37_1464482_c1 nmdc:mga05p37_1464482_c1_80_520 146
210 3300050508 nmdc:mga09592_9821_c2 nmdc:mga09592_9821_c2_613_1056 146
211 3300050512 nmdc:mga0n895_143795_c1 nmdc:mga0n895_143795_c1_1919_2395 146
212 3300050514 nmdc:mga08x19_868388_c1 nmdc:mga08x19_868388_c1_187_627 146

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xdi-assembly1.cif.gz_C tail structure of bacteriophage ssv19 0.5105 11 84
7xdi-assembly1.cif.gz_C tail structure of bacteriophage ssv19 0.4956 11 84
7vrc-assembly1.cif.gz_A structure of the yeast snf11/snf2 complex 0.4489 22 127
7y15-assembly1.cif.gz_R cryo-em structure of apo-state mrgd-gi complex 0.4221 23 138
7vrc-assembly1.cif.gz_A structure of the yeast snf11/snf2 complex 0.4008 22 127
ID Description Score Start End Superfamily
af_Q9C0W9_106_228_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.6598 71 135 3.30.40.10
af_F6NXK9_9_185_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.5607 4 144 1.20.120.550
af_C0PV55_1_138_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.5568 19 141 1.20.140.150
af_F6NXK9_9_185_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.5431 4 144 1.20.120.550
af_Q06346_1_221_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.5186 23 144 1.20.140.150
ID Description Score Start End GO Terms
AF-A0A0U2Z6K1-F1-model_v4 Uncharacterized protein 0.9527 19 146 GO:0016020
AF-A0A4Q8QLM0-F1-model_v4 DoxX family protein 0.9448 19 139 GO:0016020
AF-A0A1H9J3I7-F1-model_v4 Uncharacterized protein 0.9444 19 146 GO:0016020
AF-A0A2N8KXA1-F1-model_v4 Uncharacterized protein 0.9441 17 146 GO:0016020
AF-A0A2P1PQZ9-F1-model_v4 Uncharacterized protein 0.9422 19 146 GO:0016020

Feature Viewer

pLDDT pTM Quality
87.16 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map