F323394
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 212 | 146 | 212 | 145 |
Family's Representative Sequence
| Representative Sequence | 3300050512|nmdc:mga0n895_143795_c1|nmdc:mga0n895_143795_c1_1919_2395 |
| Length | 158 |
| Sequence | MTARNLDRELDMDSAIASPLPDQSEEGAGEVSLVRLYVLRAAYLLLVVGVGAMILPPVISHEPTARGVIPSLLCGVWLLAFLGLLHPLKMLPLLMFELAWKTVWLLAFGLPQYLSGQLPPTFAEDSFNIAFGVLLMPLVIPWPYVWRHYVKRPGARWR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 29 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 33 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 35 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 36 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 37 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 38 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 39 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 40 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 41 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 42 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 43 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 44 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 45 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 46 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 47 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 48 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 49 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 66 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 99 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 102 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 103 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 104 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 105 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 106 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 107 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 108 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 109 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 110 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 111 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 112 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 113 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 114 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 115 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 116 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 117 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 118 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 119 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 120 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 121 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 122 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 123 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 124 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 125 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 126 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 127 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 135 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 136 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 137 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 138 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 139 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 140 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 141 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 142 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 143 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 144 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 145 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 146 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.42 |
| Nodule | 0 |
| Rhizoplane | 2.36 |
| Rhizosphere | 94.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.42 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1004069 | 3300001915 | Bacteria | 3323 |
| 2 | JGI24740J21852_10009825 | 3300001979 | Bacteria | 3722 |
| 3 | JGI24739J22299_10006120 | 3300001989 | Bacteria | 4547 |
| 4 | JGI24737J22298_10014164 | 3300001990 | Bacteria | 2590 |
| 5 | JGI24735J21928_10007905 | 3300002067 | Bacteria | 3454 |
| 6 | Ga0065714_10121199 | 3300005288 | Bacteria | 1338 |
| 7 | Ga0065707_10276566 | 3300005295 | Unclassified | 1058 |
| 8 | Ga0070658_10116159 | 3300005327 | Bacteria | 2220 |
| 9 | Ga0070676_11016591 | 3300005328 | Bacteria | 623 |
| 10 | Ga0070683_100018390 | 3300005329 | Bacteria | 6189 |
| 11 | Ga0070683_100297131 | 3300005329 | Unclassified | 1536 |
| 12 | Ga0068869_100249262 | 3300005334 | Bacteria | 1418 |
| 13 | Ga0070680_100238608 | 3300005336 | Bacteria | 1536 |
| 14 | Ga0070660_100071100 | 3300005339 | Bacteria | 2716 |
| 15 | Ga0070689_100680537 | 3300005340 | Bacteria | 897 |
| 16 | Ga0070687_100352026 | 3300005343 | Bacteria | 951 |
| 17 | Ga0070661_100005367 | 3300005344 | Bacteria | 8836 |
| 18 | Ga0070661_100036908 | 3300005344 | Bacteria | 3553 |
| 19 | Ga0070692_10019940 | 3300005345 | Bacteria | 3244 |
| 20 | Ga0070668_100046887 | 3300005347 | Bacteria | 3321 |
| 21 | Ga0070669_100019230 | 3300005353 | Bacteria | 4878 |
| 22 | Ga0070669_101437242 | 3300005353 | Unclassified | 599 |
| 23 | Ga0070671_100210214 | 3300005355 | Unclassified | 1650 |
| 24 | Ga0070688_100176297 | 3300005365 | Bacteria | 1479 |
| 25 | Ga0070659_101041535 | 3300005366 | Bacteria | 719 |
| 26 | Ga0070705_100160964 | 3300005440 | Bacteria | 1500 |
| 27 | Ga0070663_100006315 | 3300005455 | Bacteria | 7115 |
| 28 | Ga0070663_100066589 | 3300005455 | Bacteria | 2610 |
| 29 | Ga0070662_100016748 | 3300005457 | Bacteria | 4926 |
| 30 | Ga0070662_100429443 | 3300005457 | Bacteria | 1094 |
| 31 | Ga0070679_100287952 | 3300005530 | Bacteria | 1594 |
| 32 | Ga0070679_100695087 | 3300005530 | Bacteria | 960 |
| 33 | Ga0070684_100027521 | 3300005535 | Bacteria | 4800 |
| 34 | Ga0068853_100001982 | 3300005539 | Bacteria | 15099 |
| 35 | Ga0070686_100000281 | 3300005544 | Bacteria | 34343 |
| 36 | Ga0070696_100040310 | 3300005546 | Bacteria | 3225 |
| 37 | Ga0070693_100013359 | 3300005547 | Bacteria | 4180 |
| 38 | Ga0068855_100022763 | 3300005563 | Bacteria | 7509 |
| 39 | Ga0070664_100005898 | 3300005564 | Bacteria | 9893 |
| 40 | Ga0070664_100018874 | 3300005564 | Bacteria | 5669 |
| 41 | Ga0070664_100164149 | 3300005564 | Bacteria | 1967 |
| 42 | Ga0068857_100031382 | 3300005577 | Unclassified | 4695 |
| 43 | Ga0068857_100032469 | 3300005577 | Bacteria | 4616 |
| 44 | Ga0068857_100201108 | 3300005577 | Bacteria | 1816 |
| 45 | Ga0068854_100004168 | 3300005578 | Bacteria | 9092 |
| 46 | Ga0068854_100250679 | 3300005578 | Bacteria | 1413 |
| 47 | Ga0068856_100319416 | 3300005614 | Bacteria | 1570 |
| 48 | Ga0068852_100021513 | 3300005616 | Bacteria | 5153 |
| 49 | Ga0068859_100045450 | 3300005617 | Bacteria | 4412 |
| 50 | Ga0068859_100051168 | 3300005617 | Bacteria | 4151 |
| 51 | Ga0068864_100018114 | 3300005618 | Bacteria | 5877 |
| 52 | Ga0068864_100181915 | 3300005618 | Bacteria | 1922 |
| 53 | Ga0068861_100047067 | 3300005719 | Bacteria | 3255 |
| 54 | Ga0068861_101623976 | 3300005719 | Bacteria | 637 |
| 55 | Ga0068851_10706405 | 3300005834 | Bacteria | 621 |
| 56 | Ga0068870_10009751 | 3300005840 | Unclassified | 4380 |
| 57 | Ga0068870_10175198 | 3300005840 | Bacteria | 1283 |
| 58 | Ga0068858_100011033 | 3300005842 | Bacteria | 8540 |
| 59 | Ga0068858_101278090 | 3300005842 | Unclassified | 722 |
| 60 | Ga0068860_100069198 | 3300005843 | Bacteria | 3354 |
| 61 | Ga0068862_100003985 | 3300005844 | Bacteria | 12532 |
| 62 | Ga0068862_100022080 | 3300005844 | Bacteria | 5324 |
| 63 | Ga0068862_100209839 | 3300005844 | Bacteria | 1759 |
| 64 | Ga0075431_100028287 | 3300006847 | Bacteria | 5757 |
| 65 | Ga0075433_10268070 | 3300006852 | Bacteria | 1513 |
| 66 | Ga0075429_100012150 | 3300006880 | Bacteria | 7464 |
| 67 | Ga0097620_100045449 | 3300006931 | Bacteria | 4412 |
| 68 | Ga0097620_100051166 | 3300006931 | Bacteria | 4151 |
| 69 | Ga0111539_10180657 | 3300009094 | Bacteria | 2464 |
| 70 | Ga0105245_10289464 | 3300009098 | Bacteria | 1604 |
| 71 | Ga0114129_10253425 | 3300009147 | Bacteria | 2362 |
| 72 | Ga0114129_11227125 | 3300009147 | Bacteria | 933 |
| 73 | Ga0105238_10000545 | 3300009551 | Bacteria | 39378 |
| 74 | Ga0105249_11269391 | 3300009553 | Bacteria | 808 |
| 75 | Ga0105239_11687047 | 3300010375 | Bacteria | 733 |
| 76 | Ga0105246_10142766 | 3300011119 | Bacteria | 1802 |
| 77 | Ga0105246_10373181 | 3300011119 | Unclassified | 1176 |
| 78 | Ga0157373_10023871 | 3300013100 | Bacteria | 4431 |
| 79 | Ga0157373_10638850 | 3300013100 | Unclassified | 777 |
| 80 | Ga0157370_10486040 | 3300013104 | Bacteria | 1134 |
| 81 | Ga0157374_10026954 | 3300013296 | Bacteria | 5176 |
| 82 | Ga0157374_10038488 | 3300013296 | Bacteria | 4396 |
| 83 | Ga0157374_11001545 | 3300013296 | Bacteria | 855 |
| 84 | Ga0157372_10022460 | 3300013307 | Bacteria | 6828 |
| 85 | Ga0157372_10039635 | 3300013307 | Bacteria | 5200 |
| 86 | Ga0157375_10369802 | 3300013308 | Bacteria | 1600 |
| 87 | Ga0157377_10108027 | 3300014745 | Bacteria | 1668 |
| 88 | Ga0157379_10922266 | 3300014968 | Bacteria | 829 |
| 89 | Ga0163161_11163546 | 3300017792 | Bacteria | 665 |
| 90 | Ga0213876_10000274 | 3300021384 | Bacteria | 47640 |
| 91 | Ga0207647_10038132 | 3300025904 | Bacteria | 3040 |
| 92 | Ga0207645_10816519 | 3300025907 | Bacteria | 634 |
| 93 | Ga0207643_10005528 | 3300025908 | Bacteria | 6755 |
| 94 | Ga0207705_10002034 | 3300025909 | Bacteria | 15735 |
| 95 | Ga0207654_10621449 | 3300025911 | Bacteria | 772 |
| 96 | Ga0207707_10015004 | 3300025912 | Bacteria | 6746 |
| 97 | Ga0207707_11400179 | 3300025912 | Bacteria | 558 |
| 98 | Ga0207660_10029730 | 3300025917 | Bacteria | 3751 |
| 99 | Ga0207662_10183570 | 3300025918 | Bacteria | 1347 |
| 100 | Ga0207662_10428497 | 3300025918 | Bacteria | 901 |
| 101 | Ga0207657_10006440 | 3300025919 | Bacteria | 12168 |
| 102 | Ga0207649_10006561 | 3300025920 | Bacteria | 6321 |
| 103 | Ga0207652_10013090 | 3300025921 | Bacteria | 6716 |
| 104 | Ga0207681_10072954 | 3300025923 | Bacteria | 2399 |
| 105 | Ga0207694_10000424 | 3300025924 | Bacteria | 39415 |
| 106 | Ga0207687_10009501 | 3300025927 | Bacteria | 6360 |
| 107 | Ga0207644_10597432 | 3300025931 | Unclassified | 916 |
| 108 | Ga0207690_10002712 | 3300025932 | Bacteria | 10687 |
| 109 | Ga0207706_10002375 | 3300025933 | Bacteria | 18376 |
| 110 | Ga0207706_10272344 | 3300025933 | Bacteria | 1477 |
| 111 | Ga0207706_10643438 | 3300025933 | Bacteria | 908 |
| 112 | Ga0207670_10131254 | 3300025936 | Bacteria | 1836 |
| 113 | Ga0207689_10243323 | 3300025942 | Bacteria | 1487 |
| 114 | Ga0207661_10111711 | 3300025944 | Bacteria | 2312 |
| 115 | Ga0207679_10013578 | 3300025945 | Bacteria | 5338 |
| 116 | Ga0207679_10136995 | 3300025945 | Bacteria | 1973 |
| 117 | Ga0207667_10068199 | 3300025949 | Bacteria | 3704 |
| 118 | Ga0207651_10109825 | 3300025960 | Bacteria | 2067 |
| 119 | Ga0207712_10365265 | 3300025961 | Bacteria | 1204 |
| 120 | Ga0207712_11103057 | 3300025961 | Bacteria | 706 |
| 121 | Ga0207640_10026469 | 3300025981 | Bacteria | 3522 |
| 122 | Ga0207640_10971219 | 3300025981 | Bacteria | 746 |
| 123 | Ga0207703_10514258 | 3300026035 | Bacteria | 1125 |
| 124 | Ga0207703_10891850 | 3300026035 | Bacteria | 851 |
| 125 | Ga0207639_10011915 | 3300026041 | Bacteria | 6049 |
| 126 | Ga0207678_10005555 | 3300026067 | Bacteria | 11267 |
| 127 | Ga0207678_10005815 | 3300026067 | Bacteria | 10993 |
| 128 | Ga0207678_11375157 | 3300026067 | Bacteria | 624 |
| 129 | Ga0207676_10041333 | 3300026095 | Unclassified | 3538 |
| 130 | Ga0207674_10004591 | 3300026116 | Bacteria | 16580 |
| 131 | Ga0207674_10008155 | 3300026116 | Bacteria | 12145 |
| 132 | Ga0207674_10219681 | 3300026116 | Bacteria | 1849 |
| 133 | Ga0207675_101444082 | 3300026118 | Bacteria | 709 |
| 134 | Ga0207698_10011478 | 3300026142 | Bacteria | 5748 |
| 135 | Ga0207428_10420067 | 3300027907 | Bacteria | 977 |
| 136 | Ga0268265_10056956 | 3300028380 | Bacteria | 2976 |
| 137 | Ga0268265_10792446 | 3300028380 | Bacteria | 923 |
| 138 | Ga0268264_10229305 | 3300028381 | Bacteria | 1714 |
| 139 | Ga0268264_10446445 | 3300028381 | Bacteria | 1252 |
| 140 | Ga0307509_10062257 | 3300031507 | Bacteria | 3935 |
| 141 | Ga0307408_100340172 | 3300031548 | Bacteria | 1270 |
| 142 | Ga0307408_100464723 | 3300031548 | Bacteria | 1100 |
| 143 | Ga0307408_101590401 | 3300031548 | Bacteria | 620 |
| 144 | Ga0265314_10001052 | 3300031711 | Bacteria | 32112 |
| 145 | Ga0307405_10127732 | 3300031731 | Bacteria | 1751 |
| 146 | Ga0307405_10143311 | 3300031731 | Bacteria | 1669 |
| 147 | Ga0307413_10014555 | 3300031824 | Bacteria | 4001 |
| 148 | Ga0307413_10064875 | 3300031824 | Bacteria | 2271 |
| 149 | Ga0307413_10554827 | 3300031824 | Bacteria | 932 |
| 150 | Ga0307410_10139578 | 3300031852 | Bacteria | 1791 |
| 151 | Ga0307410_10317415 | 3300031852 | Bacteria | 1235 |
| 152 | Ga0307410_10427352 | 3300031852 | Bacteria | 1076 |
| 153 | Ga0307410_11997168 | 3300031852 | Unclassified | 517 |
| 154 | Ga0307406_10051947 | 3300031901 | Bacteria | 2605 |
| 155 | Ga0307406_10090839 | 3300031901 | Bacteria | 2056 |
| 156 | Ga0307406_10450382 | 3300031901 | Bacteria | 1032 |
| 157 | Ga0307407_10237036 | 3300031903 | Bacteria | 1242 |
| 158 | Ga0307412_10232217 | 3300031911 | Bacteria | 1421 |
| 159 | Ga0307412_10603249 | 3300031911 | Bacteria | 930 |
| 160 | Ga0307409_100157763 | 3300031995 | Bacteria | 1980 |
| 161 | Ga0307416_100225161 | 3300032002 | Bacteria | 1803 |
| 162 | Ga0307414_10049885 | 3300032004 | Bacteria | 2896 |
| 163 | Ga0307414_10298427 | 3300032004 | Bacteria | 1362 |
| 164 | Ga0307414_10432624 | 3300032004 | Unclassified | 1150 |
| 165 | Ga0307414_10495921 | 3300032004 | Bacteria | 1079 |
| 166 | Ga0307414_10577956 | 3300032004 | Bacteria | 1005 |
| 167 | Ga0307414_10809542 | 3300032004 | Bacteria | 855 |
| 168 | Ga0307411_10131052 | 3300032005 | Bacteria | 1832 |
| 169 | Ga0307411_10485300 | 3300032005 | Bacteria | 1041 |
| 170 | Ga0307411_10500247 | 3300032005 | Bacteria | 1027 |
| 171 | Ga0307415_100146190 | 3300032126 | Bacteria | 1813 |
| 172 | Ga0307415_100198523 | 3300032126 | Bacteria | 1589 |
| 173 | Ga0307415_100217552 | 3300032126 | Bacteria | 1529 |
| 174 | Ga0307415_101230251 | 3300032126 | Bacteria | 707 |
| 175 | Ga0373945_0309776 | 3300035116 | Bacteria | 678 |
| 176 | Ga0373943_0097313 | 3300035170 | Bacteria | 1533 |
| 177 | Ga0373943_0405226 | 3300035170 | Bacteria | 788 |
| 178 | Ga0373942_0115235 | 3300035207 | Bacteria | 835 |
| 179 | Ga0395899_0172399 | 3300037312 | Bacteria | 1523 |
| 180 | Ga0395900_0290922 | 3300037418 | Bacteria | 1622 |
| 181 | Ga0395900_0948925 | 3300037418 | Bacteria | 782 |
| 182 | Ga0395900_1609315 | 3300037418 | Unclassified | 561 |
| 183 | Ga0395898_1469931 | 3300037466 | Unclassified | 608 |
| 184 | Ga0395905_0140386 | 3300037471 | Bacteria | 2273 |
| 185 | Ga0395905_0245591 | 3300037471 | Bacteria | 1672 |
| 186 | Ga0395901_0506522 | 3300038443 | Bacteria | 1228 |
| 187 | Ga0436365_0257402 | 3300039437 | Bacteria | 164674 |
| 188 | Ga0451797_0770475 | 3300041453 | Bacteria | 630 |
| 189 | Ga0450906_018326 | 3300042145 | Bacteria | 1257 |
| 190 | Ga0451576_0084533 | 3300045051 | Bacteria | 3301 |
| 191 | Ga0495592_0093341 | 3300046454 | Bacteria | 2155 |
| 192 | Ga0495580_0019086 | 3300046472 | Bacteria | 5098 |
| 193 | Ga0495607_0167280 | 3300046501 | Bacteria | 1113 |
| 194 | Ga0495597_0175144 | 3300046542 | Bacteria | 869 |
| 195 | Ga0495625_0000404 | 3300046660 | Bacteria | 65897 |
| 196 | Ga0495625_0331317 | 3300046660 | Bacteria | 967 |
| 197 | Ga0495613_0061529 | 3300046689 | Bacteria | 2749 |
| 198 | Ga0495684_0180403 | 3300047471 | Bacteria | 1565 |
| 199 | Ga0496101_0217485 | 3300048904 | Bacteria | 1482 |
| 200 | Ga0496104_0980954 | 3300048907 | Unclassified | 749 |
| 201 | Ga0496112_1390266 | 3300048915 | Unclassified | 617 |
| 202 | Ga0496113_0562045 | 3300048916 | Bacteria | 915 |
| 203 | Ga0501242_044186 | 3300049674 | Unclassified | 638 |
| 204 | nmdc:mga05p37_1464482_c1 | 3300050507 | Bacteria | 683 |
| 205 | nmdc:mga09592_9821_c2 | 3300050508 | Bacteria | 7443 |
| 206 | nmdc:mga08y16_153114_c1 | 3300050511 | Bacteria | 2396 |
| 207 | nmdc:mga0n895_143795_c1 | 3300050512 | Bacteria | 2414 |
| 208 | nmdc:mga0n895_273601_c1 | 3300050512 | Bacteria | 1713 |
| 209 | nmdc:mga08x19_868388_c1 | 3300050514 | Bacteria | 641 |
| 210 | Ga0500562_006070 | 3300053108 | Bacteria | 3042 |
| 211 | Ga0500559_0198990 | 3300053136 | Bacteria | 945 |
| 212 | Ga0500616_0008457 | 3300053153 | Bacteria | 6388 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013100 | Ga0157373_10638850 | Ga0157373_106388501 | 126 |
| 2 | 3300013307 | Ga0157372_10039635 | Ga0157372_100396354 | 126 |
| 3 | 3300021384 | Ga0213876_10000274 | Ga0213876_1000027446 | 128 |
| 4 | 3300039437 | Ga0436365_0257402 | Ga0436365_0257402_116452_116847 | 128 |
| 5 | 3300048907 | Ga0496104_0980954 | Ga0496104_0980954_20_421 | 128 |
| 6 | 3300005288 | Ga0065714_10121199 | Ga0065714_101211993 | 130 |
| 7 | 3300005343 | Ga0070687_100352026 | Ga0070687_1003520261 | 130 |
| 8 | 3300005844 | Ga0068862_100003985 | Ga0068862_1000039855 | 130 |
| 9 | 3300025918 | Ga0207662_10428497 | Ga0207662_104284971 | 130 |
| 10 | 3300053108 | Ga0500562_006070 | Ga0500562_006070_845_1309 | 130 |
| 11 | 3300053136 | Ga0500559_0198990 | Ga0500559_0198990_464_877 | 130 |
| 12 | 3300053153 | Ga0500616_0008457 | Ga0500616_0008457_4522_4986 | 130 |
| 13 | 3300009551 | Ga0105238_10000545 | Ga0105238_100005453 | 131 |
| 14 | 3300025924 | Ga0207694_10000424 | Ga0207694_100004243 | 131 |
| 15 | 3300025933 | Ga0207706_10272344 | Ga0207706_102723443 | 131 |
| 16 | 3300031852 | Ga0307410_10139578 | Ga0307410_101395782 | 131 |
| 17 | 3300031995 | Ga0307409_100157763 | Ga0307409_1001577632 | 131 |
| 18 | 3300032002 | Ga0307416_100225161 | Ga0307416_1002251613 | 131 |
| 19 | 3300032005 | Ga0307411_10500247 | Ga0307411_105002471 | 131 |
| 20 | 3300032126 | Ga0307415_100146190 | Ga0307415_1001461901 | 131 |
| 21 | 3300005577 | Ga0068857_100031382 | Ga0068857_1000313822 | 132 |
| 22 | 3300005618 | Ga0068864_100018114 | Ga0068864_1000181145 | 132 |
| 23 | 3300005840 | Ga0068870_10009751 | Ga0068870_100097514 | 132 |
| 24 | 3300005844 | Ga0068862_100209839 | Ga0068862_1002098393 | 132 |
| 25 | 3300009553 | Ga0105249_11269391 | Ga0105249_112693911 | 132 |
| 26 | 3300010375 | Ga0105239_11687047 | Ga0105239_116870472 | 132 |
| 27 | 3300011119 | Ga0105246_10142766 | Ga0105246_101427663 | 132 |
| 28 | 3300013308 | Ga0157375_10369802 | Ga0157375_103698022 | 132 |
| 29 | 3300014968 | Ga0157379_10922266 | Ga0157379_109222662 | 132 |
| 30 | 3300025908 | Ga0207643_10005528 | Ga0207643_100055284 | 132 |
| 31 | 3300025961 | Ga0207712_11103057 | Ga0207712_111030572 | 132 |
| 32 | 3300026067 | Ga0207678_11375157 | Ga0207678_113751572 | 132 |
| 33 | 3300026095 | Ga0207676_10041333 | Ga0207676_100413332 | 132 |
| 34 | 3300026116 | Ga0207674_10004591 | Ga0207674_1000459112 | 132 |
| 35 | 3300028380 | Ga0268265_10792446 | Ga0268265_107924462 | 132 |
| 36 | 3300045051 | Ga0451576_0084533 | Ga0451576_0084533_1579_2028 | 132 |
| 37 | 3300046501 | Ga0495607_0167280 | Ga0495607_0167280_573_1022 | 132 |
| 38 | 3300046454 | Ga0495592_0093341 | Ga0495592_0093341_1702_2103 | 133 |
| 39 | 3300046542 | Ga0495597_0175144 | Ga0495597_0175144_272_694 | 136 |
| 40 | 3300046660 | Ga0495625_0000404 | Ga0495625_0000404_41984_42406 | 136 |
| 41 | 3300005328 | Ga0070676_11016591 | Ga0070676_110165912 | 137 |
| 42 | 3300005329 | Ga0070683_100297131 | Ga0070683_1002971312 | 137 |
| 43 | 3300005334 | Ga0068869_100249262 | Ga0068869_1002492622 | 137 |
| 44 | 3300005340 | Ga0070689_100680537 | Ga0070689_1006805372 | 137 |
| 45 | 3300005353 | Ga0070669_101437242 | Ga0070669_1014372421 | 137 |
| 46 | 3300005365 | Ga0070688_100176297 | Ga0070688_1001762972 | 137 |
| 47 | 3300005440 | Ga0070705_100160964 | Ga0070705_1001609643 | 137 |
| 48 | 3300005457 | Ga0070662_100429443 | Ga0070662_1004294432 | 137 |
| 49 | 3300005530 | Ga0070679_100695087 | Ga0070679_1006950872 | 137 |
| 50 | 3300005546 | Ga0070696_100040310 | Ga0070696_1000403103 | 137 |
| 51 | 3300005564 | Ga0070664_100164149 | Ga0070664_1001641493 | 137 |
| 52 | 3300005577 | Ga0068857_100201108 | Ga0068857_1002011083 | 137 |
| 53 | 3300005578 | Ga0068854_100250679 | Ga0068854_1002506793 | 137 |
| 54 | 3300005617 | Ga0068859_100045450 | Ga0068859_1000454506 | 137 |
| 55 | 3300005840 | Ga0068870_10175198 | Ga0068870_101751983 | 137 |
| 56 | 3300005844 | Ga0068862_100022080 | Ga0068862_1000220802 | 137 |
| 57 | 3300006852 | Ga0075433_10268070 | Ga0075433_102680703 | 137 |
| 58 | 3300006931 | Ga0097620_100045449 | Ga0097620_1000454496 | 137 |
| 59 | 3300009094 | Ga0111539_10180657 | Ga0111539_101806575 | 137 |
| 60 | 3300014745 | Ga0157377_10108027 | Ga0157377_101080272 | 137 |
| 61 | 3300025907 | Ga0207645_10816519 | Ga0207645_108165191 | 137 |
| 62 | 3300025912 | Ga0207707_11400179 | Ga0207707_114001791 | 137 |
| 63 | 3300025918 | Ga0207662_10183570 | Ga0207662_101835705 | 137 |
| 64 | 3300025933 | Ga0207706_10643438 | Ga0207706_106434381 | 137 |
| 65 | 3300025936 | Ga0207670_10131254 | Ga0207670_101312542 | 137 |
| 66 | 3300025942 | Ga0207689_10243323 | Ga0207689_102433233 | 137 |
| 67 | 3300025945 | Ga0207679_10136995 | Ga0207679_101369953 | 137 |
| 68 | 3300025960 | Ga0207651_10109825 | Ga0207651_101098253 | 137 |
| 69 | 3300025981 | Ga0207640_10971219 | Ga0207640_109712191 | 137 |
| 70 | 3300026116 | Ga0207674_10219681 | Ga0207674_102196814 | 137 |
| 71 | 3300026118 | Ga0207675_101444082 | Ga0207675_1014440822 | 137 |
| 72 | 3300027907 | Ga0207428_10420067 | Ga0207428_104200672 | 137 |
| 73 | 3300028380 | Ga0268265_10056956 | Ga0268265_100569564 | 137 |
| 74 | 3300028381 | Ga0268264_10446445 | Ga0268264_104464453 | 137 |
| 75 | 3300048916 | Ga0496113_0562045 | Ga0496113_0562045_446_880 | 137 |
| 76 | 3300050511 | nmdc:mga08y16_153114_c1 | nmdc:mga08y16_153114_c1_981_1415 | 137 |
| 77 | 3300050512 | nmdc:mga0n895_273601_c1 | nmdc:mga0n895_273601_c1_364_798 | 137 |
| 78 | 3300035170 | Ga0373943_0405226 | Ga0373943_0405226_314_739 | 141 |
| 79 | 3300005295 | Ga0065707_10276566 | Ga0065707_102765662 | 142 |
| 80 | 3300013296 | Ga0157374_10038488 | Ga0157374_100384882 | 144 |
| 81 | 3300032005 | Ga0307411_10485300 | Ga0307411_104853002 | 144 |
| 82 | 3300035207 | Ga0373942_0115235 | Ga0373942_0115235_24_458 | 144 |
| 83 | 3300048904 | Ga0496101_0217485 | Ga0496101_0217485_859_1293 | 144 |
| 84 | 3300005347 | Ga0070668_100046887 | Ga0070668_1000468875 | 145 |
| 85 | 3300005355 | Ga0070671_100210214 | Ga0070671_1002102143 | 145 |
| 86 | 3300013296 | Ga0157374_11001545 | Ga0157374_110015452 | 145 |
| 87 | 3300025931 | Ga0207644_10597432 | Ga0207644_105974322 | 145 |
| 88 | 3300031507 | Ga0307509_10062257 | Ga0307509_100622573 | 145 |
| 89 | 3300031548 | Ga0307408_100340172 | Ga0307408_1003401722 | 145 |
| 90 | 3300031548 | Ga0307408_100464723 | Ga0307408_1004647232 | 145 |
| 91 | 3300031548 | Ga0307408_101590401 | Ga0307408_1015904012 | 145 |
| 92 | 3300031731 | Ga0307405_10127732 | Ga0307405_101277323 | 145 |
| 93 | 3300031731 | Ga0307405_10143311 | Ga0307405_101433113 | 145 |
| 94 | 3300031824 | Ga0307413_10014555 | Ga0307413_100145555 | 145 |
| 95 | 3300031824 | Ga0307413_10064875 | Ga0307413_100648752 | 145 |
| 96 | 3300031824 | Ga0307413_10554827 | Ga0307413_105548271 | 145 |
| 97 | 3300031852 | Ga0307410_10317415 | Ga0307410_103174153 | 145 |
| 98 | 3300031852 | Ga0307410_10427352 | Ga0307410_104273522 | 145 |
| 99 | 3300031852 | Ga0307410_11997168 | Ga0307410_119971681 | 145 |
| 100 | 3300031901 | Ga0307406_10051947 | Ga0307406_100519472 | 145 |
| 101 | 3300031901 | Ga0307406_10090839 | Ga0307406_100908394 | 145 |
| 102 | 3300031901 | Ga0307406_10450382 | Ga0307406_104503822 | 145 |
| 103 | 3300031903 | Ga0307407_10237036 | Ga0307407_102370362 | 145 |
| 104 | 3300031911 | Ga0307412_10232217 | Ga0307412_102322174 | 145 |
| 105 | 3300031911 | Ga0307412_10603249 | Ga0307412_106032491 | 145 |
| 106 | 3300032004 | Ga0307414_10049885 | Ga0307414_100498852 | 145 |
| 107 | 3300032004 | Ga0307414_10298427 | Ga0307414_102984271 | 145 |
| 108 | 3300032004 | Ga0307414_10432624 | Ga0307414_104326242 | 145 |
| 109 | 3300032004 | Ga0307414_10495921 | Ga0307414_104959212 | 145 |
| 110 | 3300032004 | Ga0307414_10577956 | Ga0307414_105779563 | 145 |
| 111 | 3300032004 | Ga0307414_10809542 | Ga0307414_108095422 | 145 |
| 112 | 3300032005 | Ga0307411_10131052 | Ga0307411_101310522 | 145 |
| 113 | 3300032126 | Ga0307415_100198523 | Ga0307415_1001985232 | 145 |
| 114 | 3300032126 | Ga0307415_100217552 | Ga0307415_1002175522 | 145 |
| 115 | 3300032126 | Ga0307415_101230251 | Ga0307415_1012302512 | 145 |
| 116 | 3300035170 | Ga0373943_0097313 | Ga0373943_0097313_658_1179 | 145 |
| 117 | 3300042145 | Ga0450906_018326 | Ga0450906_018326_51_494 | 145 |
| 118 | 3300046660 | Ga0495625_0331317 | Ga0495625_0331317_292_732 | 145 |
| 119 | 3300049674 | Ga0501242_044186 | Ga0501242_044186_108_548 | 145 |
| 120 | 3300001915 | JGI24741J21665_1004069 | JGI24741J21665_10040693 | 146 |
| 121 | 3300001979 | JGI24740J21852_10009825 | JGI24740J21852_100098253 | 146 |
| 122 | 3300001989 | JGI24739J22299_10006120 | JGI24739J22299_100061203 | 146 |
| 123 | 3300001990 | JGI24737J22298_10014164 | JGI24737J22298_100141643 | 146 |
| 124 | 3300002067 | JGI24735J21928_10007905 | JGI24735J21928_100079053 | 146 |
| 125 | 3300005327 | Ga0070658_10116159 | Ga0070658_101161592 | 146 |
| 126 | 3300005329 | Ga0070683_100018390 | Ga0070683_1000183903 | 146 |
| 127 | 3300005336 | Ga0070680_100238608 | Ga0070680_1002386083 | 146 |
| 128 | 3300005339 | Ga0070660_100071100 | Ga0070660_1000711002 | 146 |
| 129 | 3300005344 | Ga0070661_100005367 | Ga0070661_1000053674 | 146 |
| 130 | 3300005344 | Ga0070661_100036908 | Ga0070661_1000369083 | 146 |
| 131 | 3300005345 | Ga0070692_10019940 | Ga0070692_100199403 | 146 |
| 132 | 3300005353 | Ga0070669_100019230 | Ga0070669_1000192305 | 146 |
| 133 | 3300005366 | Ga0070659_101041535 | Ga0070659_1010415352 | 146 |
| 134 | 3300005455 | Ga0070663_100006315 | Ga0070663_1000063155 | 146 |
| 135 | 3300005455 | Ga0070663_100066589 | Ga0070663_1000665894 | 146 |
| 136 | 3300005457 | Ga0070662_100016748 | Ga0070662_1000167484 | 146 |
| 137 | 3300005530 | Ga0070679_100287952 | Ga0070679_1002879524 | 146 |
| 138 | 3300005535 | Ga0070684_100027521 | Ga0070684_1000275213 | 146 |
| 139 | 3300005539 | Ga0068853_100001982 | Ga0068853_1000019829 | 146 |
| 140 | 3300005544 | Ga0070686_100000281 | Ga0070686_10000028135 | 146 |
| 141 | 3300005547 | Ga0070693_100013359 | Ga0070693_1000133593 | 146 |
| 142 | 3300005563 | Ga0068855_100022763 | Ga0068855_1000227634 | 146 |
| 143 | 3300005564 | Ga0070664_100005898 | Ga0070664_1000058988 | 146 |
| 144 | 3300005564 | Ga0070664_100018874 | Ga0070664_1000188746 | 146 |
| 145 | 3300005577 | Ga0068857_100032469 | Ga0068857_1000324694 | 146 |
| 146 | 3300005578 | Ga0068854_100004168 | Ga0068854_1000041684 | 146 |
| 147 | 3300005614 | Ga0068856_100319416 | Ga0068856_1003194162 | 146 |
| 148 | 3300005616 | Ga0068852_100021513 | Ga0068852_1000215133 | 146 |
| 149 | 3300005617 | Ga0068859_100051168 | Ga0068859_1000511681 | 146 |
| 150 | 3300005618 | Ga0068864_100181915 | Ga0068864_1001819152 | 146 |
| 151 | 3300005719 | Ga0068861_100047067 | Ga0068861_1000470675 | 146 |
| 152 | 3300005719 | Ga0068861_101623976 | Ga0068861_1016239762 | 146 |
| 153 | 3300005834 | Ga0068851_10706405 | Ga0068851_107064051 | 146 |
| 154 | 3300005842 | Ga0068858_100011033 | Ga0068858_1000110335 | 146 |
| 155 | 3300005842 | Ga0068858_101278090 | Ga0068858_1012780902 | 146 |
| 156 | 3300005843 | Ga0068860_100069198 | Ga0068860_1000691985 | 146 |
| 157 | 3300006847 | Ga0075431_100028287 | Ga0075431_1000282873 | 146 |
| 158 | 3300006880 | Ga0075429_100012150 | Ga0075429_1000121503 | 146 |
| 159 | 3300006931 | Ga0097620_100051166 | Ga0097620_1000511661 | 146 |
| 160 | 3300009098 | Ga0105245_10289464 | Ga0105245_102894642 | 146 |
| 161 | 3300009147 | Ga0114129_10253425 | Ga0114129_102534253 | 146 |
| 162 | 3300009147 | Ga0114129_11227125 | Ga0114129_112271251 | 146 |
| 163 | 3300011119 | Ga0105246_10373181 | Ga0105246_103731811 | 146 |
| 164 | 3300013100 | Ga0157373_10023871 | Ga0157373_100238714 | 146 |
| 165 | 3300013104 | Ga0157370_10486040 | Ga0157370_104860401 | 146 |
| 166 | 3300013296 | Ga0157374_10026954 | Ga0157374_100269543 | 146 |
| 167 | 3300013307 | Ga0157372_10022460 | Ga0157372_100224604 | 146 |
| 168 | 3300017792 | Ga0163161_11163546 | Ga0163161_111635461 | 146 |
| 169 | 3300025904 | Ga0207647_10038132 | Ga0207647_100381324 | 146 |
| 170 | 3300025909 | Ga0207705_10002034 | Ga0207705_1000203418 | 146 |
| 171 | 3300025911 | Ga0207654_10621449 | Ga0207654_106214492 | 146 |
| 172 | 3300025912 | Ga0207707_10015004 | Ga0207707_100150041 | 146 |
| 173 | 3300025917 | Ga0207660_10029730 | Ga0207660_100297304 | 146 |
| 174 | 3300025919 | Ga0207657_10006440 | Ga0207657_100064403 | 146 |
| 175 | 3300025920 | Ga0207649_10006561 | Ga0207649_100065611 | 146 |
| 176 | 3300025921 | Ga0207652_10013090 | Ga0207652_100130902 | 146 |
| 177 | 3300025923 | Ga0207681_10072954 | Ga0207681_100729544 | 146 |
| 178 | 3300025927 | Ga0207687_10009501 | Ga0207687_100095015 | 146 |
| 179 | 3300025932 | Ga0207690_10002712 | Ga0207690_100027124 | 146 |
| 180 | 3300025933 | Ga0207706_10002375 | Ga0207706_100023754 | 146 |
| 181 | 3300025944 | Ga0207661_10111711 | Ga0207661_101117112 | 146 |
| 182 | 3300025945 | Ga0207679_10013578 | Ga0207679_100135783 | 146 |
| 183 | 3300025949 | Ga0207667_10068199 | Ga0207667_100681993 | 146 |
| 184 | 3300025961 | Ga0207712_10365265 | Ga0207712_103652653 | 146 |
| 185 | 3300025981 | Ga0207640_10026469 | Ga0207640_100264693 | 146 |
| 186 | 3300026035 | Ga0207703_10514258 | Ga0207703_105142582 | 146 |
| 187 | 3300026035 | Ga0207703_10891850 | Ga0207703_108918502 | 146 |
| 188 | 3300026041 | Ga0207639_10011915 | Ga0207639_100119156 | 146 |
| 189 | 3300026067 | Ga0207678_10005555 | Ga0207678_100055552 | 146 |
| 190 | 3300026067 | Ga0207678_10005815 | Ga0207678_100058156 | 146 |
| 191 | 3300026116 | Ga0207674_10008155 | Ga0207674_100081553 | 146 |
| 192 | 3300026142 | Ga0207698_10011478 | Ga0207698_100114781 | 146 |
| 193 | 3300028381 | Ga0268264_10229305 | Ga0268264_102293052 | 146 |
| 194 | 3300031711 | Ga0265314_10001052 | Ga0265314_1000105226 | 146 |
| 195 | 3300035116 | Ga0373945_0309776 | Ga0373945_0309776_170_613 | 146 |
| 196 | 3300037312 | Ga0395899_0172399 | Ga0395899_0172399_118_558 | 146 |
| 197 | 3300037418 | Ga0395900_0290922 | Ga0395900_0290922_462_902 | 146 |
| 198 | 3300037418 | Ga0395900_0948925 | Ga0395900_0948925_107_547 | 146 |
| 199 | 3300037418 | Ga0395900_1609315 | Ga0395900_1609315_48_491 | 146 |
| 200 | 3300037466 | Ga0395898_1469931 | Ga0395898_1469931_118_558 | 146 |
| 201 | 3300037471 | Ga0395905_0140386 | Ga0395905_0140386_671_1114 | 146 |
| 202 | 3300037471 | Ga0395905_0245591 | Ga0395905_0245591_160_600 | 146 |
| 203 | 3300038443 | Ga0395901_0506522 | Ga0395901_0506522_438_878 | 146 |
| 204 | 3300041453 | Ga0451797_0770475 | Ga0451797_0770475_56_496 | 146 |
| 205 | 3300046472 | Ga0495580_0019086 | Ga0495580_0019086_704_1147 | 146 |
| 206 | 3300046689 | Ga0495613_0061529 | Ga0495613_0061529_1406_1849 | 146 |
| 207 | 3300047471 | Ga0495684_0180403 | Ga0495684_0180403_1045_1488 | 146 |
| 208 | 3300048915 | Ga0496112_1390266 | Ga0496112_1390266_68_511 | 146 |
| 209 | 3300050507 | nmdc:mga05p37_1464482_c1 | nmdc:mga05p37_1464482_c1_80_520 | 146 |
| 210 | 3300050508 | nmdc:mga09592_9821_c2 | nmdc:mga09592_9821_c2_613_1056 | 146 |
| 211 | 3300050512 | nmdc:mga0n895_143795_c1 | nmdc:mga0n895_143795_c1_1919_2395 | 146 |
| 212 | 3300050514 | nmdc:mga08x19_868388_c1 | nmdc:mga08x19_868388_c1_187_627 | 146 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7xdi-assembly1.cif.gz_C | tail structure of bacteriophage ssv19 | 0.5105 | 11 | 84 |
| 7xdi-assembly1.cif.gz_C | tail structure of bacteriophage ssv19 | 0.4956 | 11 | 84 |
| 7vrc-assembly1.cif.gz_A | structure of the yeast snf11/snf2 complex | 0.4489 | 22 | 127 |
| 7y15-assembly1.cif.gz_R | cryo-em structure of apo-state mrgd-gi complex | 0.4221 | 23 | 138 |
| 7vrc-assembly1.cif.gz_A | structure of the yeast snf11/snf2 complex | 0.4008 | 22 | 127 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9C0W9_106_228_3.30.40.10 | Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) | 0.6598 | 71 | 135 | 3.30.40.10 |
| af_F6NXK9_9_185_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.5607 | 4 | 144 | 1.20.120.550 |
| af_C0PV55_1_138_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.5568 | 19 | 141 | 1.20.140.150 |
| af_F6NXK9_9_185_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.5431 | 4 | 144 | 1.20.120.550 |
| af_Q06346_1_221_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.5186 | 23 | 144 | 1.20.140.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0U2Z6K1-F1-model_v4 | Uncharacterized protein | 0.9527 | 19 | 146 |
GO:0016020
|
| AF-A0A4Q8QLM0-F1-model_v4 | DoxX family protein | 0.9448 | 19 | 139 |
GO:0016020
|
| AF-A0A1H9J3I7-F1-model_v4 | Uncharacterized protein | 0.9444 | 19 | 146 |
GO:0016020
|
| AF-A0A2N8KXA1-F1-model_v4 | Uncharacterized protein | 0.9441 | 17 | 146 |
GO:0016020
|
| AF-A0A2P1PQZ9-F1-model_v4 | Uncharacterized protein | 0.9422 | 19 | 146 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar