F323279

General Info

Members Datasets Scaffolds Average Seq Length
212 171 424 214

Family's Representative Sequence

Representative Sequence 3300048904|Ga0496101_0113056|Ga0496101_0113056_466_1179
Length 237
Sequence MHANQEATMSTKPVPTKDASGEAKAATVNMKFEIVVLPVSDVDRAKEFYAKLGWRLDADFAAGNDWRAVQFTPPGSGCSVIFGKNVTAAAPGEAQGLYLIVSDIEAARAELLRCGVEVSEVFHSDGVYAGRDENYLFGRRRISGPDPEHRSYRSFASFKDPDGNGWLFQELTTRLPGRIDSAATTFASAKDLANAMRRASKAHGEHEARTGGQRDENWPDWYASYMVAEQSGEELPQ

Samples

Sample ID Description Type Environment
1 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
64 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
85 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
88 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
89 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
90 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
91 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
92 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
93 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
94 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
95 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
96 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
97 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
98 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
99 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
100 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
101 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
103 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
104 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
105 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
106 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
107 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
108 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
109 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
110 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
111 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
112 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
113 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
114 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
115 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
116 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
117 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
118 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
119 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
120 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
121 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
122 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
123 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
124 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
125 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
126 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
127 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
128 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
129 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
130 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
131 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
132 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
133 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
134 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
135 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
136 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
137 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
138 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
139 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
140 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
141 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
142 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
143 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
144 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
145 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
146 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
147 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
148 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
153 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
154 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
155 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
157 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
158 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
159 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
160 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
161 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
162 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
163 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
164 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
165 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
166 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
167 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
168 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
169 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
170 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
171 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.64
Metatranscriptomes 0
Isolates 2.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.89
Nodule 0
Rhizoplane 5.66
Rhizosphere 87.26
Stem 0
Stem Tuber 0
Unclassified 0.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496101_0113056 3300048904 Bacteria 2046
2 rootL2_10100721 3300003322 Bacteria 4866
3 Ga0065712_10081890 3300005290 Bacteria 2955
4 Ga0065715_10033199 3300005293 Bacteria 1823
5 Ga0070683_100148343 3300005329 Bacteria 2223
6 Ga0070690_100234075 3300005330 Bacteria 1293
7 Ga0070666_10028501 3300005335 Bacteria 3665
8 Ga0070682_100114083 3300005337 Bacteria 1805
9 Ga0070660_100133920 3300005339 Bacteria 1985
10 Ga0070661_100121950 3300005344 Bacteria 1953
11 Ga0070668_100048616 3300005347 Bacteria 3262
12 Ga0070673_100069043 3300005364 Bacteria 2831
13 Ga0070688_100095667 3300005365 Bacteria 1950
14 Ga0070667_100148608 3300005367 Bacteria 2057
15 Ga0070714_100241666 3300005435 Bacteria 1667
16 Ga0070713_100035040 3300005436 Bacteria 4038
17 Ga0070713_100709517 3300005436 Bacteria 961
18 Ga0070710_10061542 3300005437 Bacteria 2138
19 Ga0070710_10516155 3300005437 Bacteria 820
20 Ga0070700_100009436 3300005441 Bacteria 5356
21 Ga0070694_100108427 3300005444 Bacteria 1975
22 Ga0070663_100168781 3300005455 Bacteria 1690
23 Ga0070681_10145922 3300005458 Bacteria 2295
24 Ga0068867_100820957 3300005459 Bacteria 831
25 Ga0070685_10030266 3300005466 Bacteria 3015
26 Ga0070699_100627159 3300005518 Bacteria 981
27 Ga0070679_100010487 3300005530 Bacteria 8790
28 Ga0070684_100078488 3300005535 Bacteria 2917
29 Ga0068853_100710614 3300005539 Bacteria 959
30 Ga0070665_100058924 3300005548 Bacteria 3849
31 Ga0070704_100395967 3300005549 Bacteria 1177
32 Ga0070704_100572893 3300005549 Bacteria 989
33 Ga0068861_100034516 3300005719 Bacteria 3741
34 Ga0068863_100299166 3300005841 Unclassified 1561
35 Ga0081540_1050067 3300005983 Bacteria 2078
36 Ga0070717_10068410 3300006028 Bacteria 2956
37 Ga0075432_10022484 3300006058 Bacteria 2157
38 Ga0070716_100128718 3300006173 Bacteria 1597
39 Ga0070712_100038626 3300006175 Bacteria 3263
40 Ga0097621_100005703 3300006237 Bacteria 8795
41 Ga0097621_100109079 3300006237 Bacteria 2338
42 Ga0068871_100141758 3300006358 Bacteria 2044
43 Ga0075428_100041411 3300006844 Bacteria 5066
44 Ga0075428_100497307 3300006844 Bacteria 1305
45 Ga0075430_100272093 3300006846 Bacteria 1402
46 Ga0075431_100066591 3300006847 Bacteria 3719
47 Ga0075433_10014795 3300006852 Bacteria 6386
48 Ga0075434_100040308 3300006871 Bacteria 4625
49 Ga0075434_100281979 3300006871 Bacteria 1681
50 Ga0075429_100047646 3300006880 Bacteria 3728
51 Ga0068865_100687274 3300006881 Bacteria 873
52 Ga0075435_100010447 3300007076 Bacteria 6793
53 Ga0111539_10041008 3300009094 Bacteria 5569
54 Ga0111539_10301517 3300009094 Bacteria 1865
55 Ga0105245_10050876 3300009098 Bacteria 3714
56 Ga0105245_10061861 3300009098 Bacteria 3376
57 Ga0105245_10188766 3300009098 Bacteria 1973
58 Ga0114129_10088336 3300009147 Bacteria 4297
59 Ga0105243_10044442 3300009148 Bacteria 3485
60 Ga0105241_10121393 3300009174 Bacteria 2105
61 Ga0105242_10216771 3300009176 Bacteria 1708
62 Ga0105242_10563917 3300009176 Bacteria 1094
63 Ga0105248_10096001 3300009177 Bacteria 3338
64 Ga0105238_10450491 3300009551 Bacteria 1284
65 Ga0105249_10103279 3300009553 Bacteria 2684
66 Ga0105249_10206603 3300009553 Bacteria 1925
67 Ga0105239_10177333 3300010375 Bacteria 2384
68 Ga0105239_10517672 3300010375 Bacteria 1357
69 Ga0157369_10203264 3300013105 Bacteria 2079
70 Ga0157374_10067544 3300013296 Bacteria 3361
71 Ga0157374_10500223 3300013296 Bacteria 1220
72 Ga0157378_10019483 3300013297 Bacteria 5965
73 Ga0157378_10589755 3300013297 Bacteria 1121
74 Ga0163162_10033702 3300013306 Bacteria 5090
75 Ga0163162_10552153 3300013306 Bacteria 1280
76 Ga0163162_10613558 3300013306 Bacteria 1213
77 Ga0157380_10105054 3300014326 Bacteria 2361
78 Ga0157376_10000036 3300014969 Bacteria 145496
79 Ga0157376_10049244 3300014969 Bacteria 3489
80 Ga0213872_10002678 3300021361 Bacteria 10303
81 Ga0207697_10001566 3300025315 Bacteria 12358
82 Ga0207692_10048047 3300025898 Bacteria 2146
83 Ga0207692_10153249 3300025898 Bacteria 1322
84 Ga0207693_10044988 3300025915 Bacteria 3468
85 Ga0207663_10082250 3300025916 Bacteria 2111
86 Ga0207657_10275960 3300025919 Bacteria 1335
87 Ga0207657_10535329 3300025919 Bacteria 916
88 Ga0207652_10383585 3300025921 Bacteria 1268
89 Ga0207694_10260381 3300025924 Bacteria 1421
90 Ga0207700_10037170 3300025928 Bacteria 3524
91 Ga0207690_10052750 3300025932 Bacteria 2725
92 Ga0207706_10336192 3300025933 Bacteria 1314
93 Ga0207686_10247775 3300025934 Bacteria 1300
94 Ga0207704_10504187 3300025938 Bacteria 976
95 Ga0207704_10713547 3300025938 Bacteria 831
96 Ga0207665_10099008 3300025939 Bacteria 2032
97 Ga0207689_10133316 3300025942 Bacteria 2045
98 Ga0207712_10175527 3300025961 Bacteria 1679
99 Ga0207712_10328300 3300025961 Bacteria 1265
100 Ga0207678_10440889 3300026067 Bacteria 1131
101 Ga0207708_10019271 3300026075 Bacteria 5140
102 Ga0207702_10602666 3300026078 Bacteria 1078
103 Ga0207675_100104497 3300026118 Bacteria 2670
104 Ga0207698_10180699 3300026142 Bacteria 1869
105 Ga0207428_10004359 3300027907 Bacteria 13508
106 Ga0268266_10186757 3300028379 Bacteria 1890
107 Ga0268265_10881943 3300028380 Bacteria 877
108 Ga0265319_1035836 3300028563 Bacteria 1700
109 Ga0265338_10016501 3300028800 Bacteria 8030
110 Ga0265338_10036527 3300028800 Bacteria 4699
111 Ga0265338_10111867 3300028800 Bacteria 2197
112 Ga0265325_10007294 3300031241 Bacteria 6638
113 Ga0265327_10013425 3300031251 Bacteria 5439
114 Ga0307413_10035006 3300031824 Bacteria 2877
115 Ga0307413_10212186 3300031824 Bacteria 1407
116 Ga0307410_10149376 3300031852 Bacteria 1738
117 Ga0307410_10572732 3300031852 Bacteria 939
118 Ga0307414_10064850 3300032004 Bacteria 2603
119 Ga0307414_10926487 3300032004 Bacteria 800
120 Ga0307411_10169441 3300032005 Bacteria 1645
121 Ga0307411_10372485 3300032005 Bacteria 1172
122 Ga0373953_0155486 3300035117 Bacteria 981
123 Ga0373954_0005355 3300035118 Bacteria 5543
124 Ga0373956_0016275 3300035119 Bacteria 3122
125 Ga0373957_0009997 3300035120 Bacteria 3121
126 Ga0373927_0507301 3300035695 Bacteria 797
127 Ga0373947_0157283 3300035725 Bacteria 1468
128 Ga0373947_0231160 3300035725 Bacteria 1218
129 Ga0373937_0044409 3300036401 Bacteria 4058
130 Ga0373937_0792784 3300036401 Bacteria 895
131 Ga0395899_0296980 3300037312 Bacteria 1094
132 Ga0395900_0273591 3300037418 Bacteria 1683
133 Ga0395905_0219761 3300037471 Bacteria 1778
134 Ga0395901_0074437 3300038443 Bacteria 3543
135 Ga0436361_0176972 3300039447 Bacteria 12941
136 Ga0436361_0992731 3300039447 Bacteria 3984
137 Ga0439448_0067932 3300042005 Bacteria 1185
138 Ga0439440_0016740 3300042993 Bacteria 1609
139 Ga0466967_0110093 3300045976 Bacteria 2529
140 Ga0495592_0237726 3300046454 Bacteria 1210
141 Ga0495638_0001869 3300046460 Bacteria 18200
142 Ga0495639_0003192 3300046475 Bacteria 7120
143 Ga0495662_0046954 3300046476 Bacteria 2085
144 Ga0495664_0209768 3300046477 Bacteria 1180
145 Ga0495585_0066406 3300046492 Bacteria 1975
146 Ga0495608_0033335 3300046511 Bacteria 3482
147 Ga0495608_0068210 3300046511 Bacteria 2326
148 Ga0495608_0081062 3300046511 Bacteria 2109
149 Ga0495610_0011985 3300046512 Bacteria 5253
150 Ga0495628_0012335 3300046516 Bacteria 7205
151 Ga0495630_0000829 3300046517 Bacteria 21787
152 Ga0495644_0206137 3300046523 Bacteria 759
153 Ga0495652_0048595 3300046529 Bacteria 3634
154 Ga0495652_0488229 3300046529 Bacteria 856
155 Ga0495587_0037844 3300046536 Bacteria 2894
156 Ga0495622_0093369 3300046557 Bacteria 1382
157 Ga0495667_0036756 3300046559 Bacteria 3266
158 Ga0495611_0001489 3300046648 Bacteria 11639
159 Ga0495625_0029838 3300046660 Bacteria 4074
160 Ga0495635_0031252 3300046663 Bacteria 3698
161 Ga0495657_0447365 3300046675 Bacteria 757
162 Ga0495646_0393826 3300046680 Bacteria 721
163 Ga0495647_0021399 3300046681 Bacteria 2328
164 Ga0495613_0566697 3300046689 Bacteria 759
165 Ga0495581_0034302 3300047315 Bacteria 2936
166 Ga0495581_0523489 3300047315 Bacteria 689
167 Ga0495604_0116350 3300047317 Bacteria 1941
168 Ga0495672_0032217 3300047320 Bacteria 3264
169 Ga0495675_0011229 3300047444 Bacteria 5619
170 Ga0495602_0317583 3300048088 Bacteria 1134
171 Ga0496101_0639581 3300048904 Bacteria 841
172 Ga0496102_0548443 3300048905 Bacteria 1079
173 Ga0496102_0559897 3300048905 Bacteria 1066
174 Ga0496104_0136382 3300048907 Bacteria 2358
175 Ga0496105_0160818 3300048908 Bacteria 1844
176 Ga0496105_0379678 3300048908 Bacteria 1125
177 Ga0496106_0001447 3300048909 Bacteria 17813
178 Ga0496115_0002159 3300048918 Bacteria 14064
179 Ga0496115_0014507 3300048918 Bacteria 5966
180 Ga0496115_0247010 3300048918 Bacteria 1470
181 Ga0496117_0171153 3300048920 Bacteria 1260
182 Ga0496118_0058706 3300048921 Bacteria 2872
183 Ga0496121_0000212 3300048924 Bacteria 127508
184 Ga0496124_0000391 3300048927 Bacteria 79955
185 Ga0496125_0122706 3300048928 Bacteria 1849
186 Ga0496126_0012660 3300048929 Bacteria 8631
187 Ga0501034_0249303 3300049571 Bacteria 1720
188 Ga0501038_0120746 3300049574 Bacteria 2162
189 Ga0501043_0244681 3300049579 Bacteria 1383
190 Ga0501047_0010962 3300049581 Bacteria 8576
191 Ga0501068_0470035 3300049584 Bacteria 814
192 Ga0501070_0052857 3300049586 Bacteria 3371
193 Ga0501249_001375 3300049679 Bacteria 5021
194 Ga0501035_0149954 3300049822 Bacteria 2024
195 Ga0501044_0577940 3300049823 Bacteria 1018
196 nmdc:mga05p37_412248_c1 3300050507 Bacteria 1575
197 nmdc:mga05p37_700735_c1 3300050507 Bacteria 1125
198 nmdc:mga09592_46312_c1 3300050508 Bacteria 3664
199 nmdc:mga0qj67_326833_c1 3300050509 Bacteria 1241
200 nmdc:mga06r32_40243_c1 3300050510 Bacteria 4436
201 nmdc:mga0n895_148483_c1 3300050512 Bacteria 2373
202 nmdc:mga0rr50_313771_c1 3300050513 Bacteria 1314
203 nmdc:mga0a205_6568_c1 3300050515 Bacteria 10520
204 Ga0500562_006803 3300053108 Bacteria 2883
205 Ga0500588_0055367 3300053146 Bacteria 1252
206 Ga0500588_0060846 3300053146 Bacteria 1209
207 Ga0500645_009417 3300053730 Bacteria 3282
208 2770198820 2767802442 Bacteria 5747986
209 2812348322 2811994878 Bacteria 5992952
210 2844536827 2844533157 Bacteria 7517899
211 2857528984 2857524615 Bacteria 6615449
212 2891973974 2891968417 Bacteria 5821697
213 Ga0496101_0113056
214 rootL2_10100721
215 Ga0065712_10081890
216 Ga0065715_10033199
217 Ga0070683_100148343
218 Ga0070690_100234075
219 Ga0070666_10028501
220 Ga0070682_100114083
221 Ga0070660_100133920
222 Ga0070661_100121950
223 Ga0070668_100048616
224 Ga0070673_100069043
225 Ga0070688_100095667
226 Ga0070667_100148608
227 Ga0070714_100241666
228 Ga0070713_100035040
229 Ga0070713_100709517
230 Ga0070710_10061542
231 Ga0070710_10516155
232 Ga0070700_100009436
233 Ga0070694_100108427
234 Ga0070663_100168781
235 Ga0070681_10145922
236 Ga0068867_100820957
237 Ga0070685_10030266
238 Ga0070699_100627159
239 Ga0070679_100010487
240 Ga0070684_100078488
241 Ga0068853_100710614
242 Ga0070665_100058924
243 Ga0070704_100395967
244 Ga0070704_100572893
245 Ga0068861_100034516
246 Ga0068863_100299166
247 Ga0081540_1050067
248 Ga0070717_10068410
249 Ga0075432_10022484
250 Ga0070716_100128718
251 Ga0070712_100038626
252 Ga0097621_100005703
253 Ga0097621_100109079
254 Ga0068871_100141758
255 Ga0075428_100041411
256 Ga0075428_100497307
257 Ga0075430_100272093
258 Ga0075431_100066591
259 Ga0075433_10014795
260 Ga0075434_100040308
261 Ga0075434_100281979
262 Ga0075429_100047646
263 Ga0068865_100687274
264 Ga0075435_100010447
265 Ga0111539_10041008
266 Ga0111539_10301517
267 Ga0105245_10050876
268 Ga0105245_10061861
269 Ga0105245_10188766
270 Ga0114129_10088336
271 Ga0105243_10044442
272 Ga0105241_10121393
273 Ga0105242_10216771
274 Ga0105242_10563917
275 Ga0105248_10096001
276 Ga0105238_10450491
277 Ga0105249_10103279
278 Ga0105249_10206603
279 Ga0105239_10177333
280 Ga0105239_10517672
281 Ga0157369_10203264
282 Ga0157374_10067544
283 Ga0157374_10500223
284 Ga0157378_10019483
285 Ga0157378_10589755
286 Ga0163162_10033702
287 Ga0163162_10552153
288 Ga0163162_10613558
289 Ga0157380_10105054
290 Ga0157376_10000036
291 Ga0157376_10049244
292 Ga0213872_10002678
293 Ga0207697_10001566
294 Ga0207692_10048047
295 Ga0207692_10153249
296 Ga0207693_10044988
297 Ga0207663_10082250
298 Ga0207657_10275960
299 Ga0207657_10535329
300 Ga0207652_10383585
301 Ga0207694_10260381
302 Ga0207700_10037170
303 Ga0207690_10052750
304 Ga0207706_10336192
305 Ga0207686_10247775
306 Ga0207704_10504187
307 Ga0207704_10713547
308 Ga0207665_10099008
309 Ga0207689_10133316
310 Ga0207712_10175527
311 Ga0207712_10328300
312 Ga0207678_10440889
313 Ga0207708_10019271
314 Ga0207702_10602666
315 Ga0207675_100104497
316 Ga0207698_10180699
317 Ga0207428_10004359
318 Ga0268266_10186757
319 Ga0268265_10881943
320 Ga0265319_1035836
321 Ga0265338_10016501
322 Ga0265338_10036527
323 Ga0265338_10111867
324 Ga0265325_10007294
325 Ga0265327_10013425
326 Ga0307413_10035006
327 Ga0307413_10212186
328 Ga0307410_10149376
329 Ga0307410_10572732
330 Ga0307414_10064850
331 Ga0307414_10926487
332 Ga0307411_10169441
333 Ga0307411_10372485
334 Ga0373953_0155486
335 Ga0373954_0005355
336 Ga0373956_0016275
337 Ga0373957_0009997
338 Ga0373927_0507301
339 Ga0373947_0157283
340 Ga0373947_0231160
341 Ga0373937_0044409
342 Ga0373937_0792784
343 Ga0395899_0296980
344 Ga0395900_0273591
345 Ga0395905_0219761
346 Ga0395901_0074437
347 Ga0436361_0176972
348 Ga0436361_0992731
349 Ga0439448_0067932
350 Ga0439440_0016740
351 Ga0466967_0110093
352 Ga0495592_0237726
353 Ga0495638_0001869
354 Ga0495639_0003192
355 Ga0495662_0046954
356 Ga0495664_0209768
357 Ga0495585_0066406
358 Ga0495608_0033335
359 Ga0495608_0068210
360 Ga0495608_0081062
361 Ga0495610_0011985
362 Ga0495628_0012335
363 Ga0495630_0000829
364 Ga0495644_0206137
365 Ga0495652_0048595
366 Ga0495652_0488229
367 Ga0495587_0037844
368 Ga0495622_0093369
369 Ga0495667_0036756
370 Ga0495611_0001489
371 Ga0495625_0029838
372 Ga0495635_0031252
373 Ga0495657_0447365
374 Ga0495646_0393826
375 Ga0495647_0021399
376 Ga0495613_0566697
377 Ga0495581_0034302
378 Ga0495581_0523489
379 Ga0495604_0116350
380 Ga0495672_0032217
381 Ga0495675_0011229
382 Ga0495602_0317583
383 Ga0496101_0639581
384 Ga0496102_0548443
385 Ga0496102_0559897
386 Ga0496104_0136382
387 Ga0496105_0160818
388 Ga0496105_0379678
389 Ga0496106_0001447
390 Ga0496115_0002159
391 Ga0496115_0014507
392 Ga0496115_0247010
393 Ga0496117_0171153
394 Ga0496118_0058706
395 Ga0496121_0000212
396 Ga0496124_0000391
397 Ga0496125_0122706
398 Ga0496126_0012660
399 Ga0501034_0249303
400 Ga0501038_0120746
401 Ga0501043_0244681
402 Ga0501047_0010962
403 Ga0501068_0470035
404 Ga0501070_0052857
405 Ga0501249_001375
406 Ga0501035_0149954
407 Ga0501044_0577940
408 nmdc:mga05p37_412248_c1
409 nmdc:mga05p37_700735_c1
410 nmdc:mga09592_46312_c1
411 nmdc:mga0qj67_326833_c1
412 nmdc:mga06r32_40243_c1
413 nmdc:mga0n895_148483_c1
414 nmdc:mga0rr50_313771_c1
415 nmdc:mga0a205_6568_c1
416 Ga0500562_006803
417 Ga0500588_0055367
418 Ga0500588_0060846
419 Ga0500645_009417
420 2770198820
421 2812348322
422 2844536827
423 2857528984
424 2891973974

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

31

168

0.88

PF22677

Ble-like_N

Bleomycin resistance protein-like N-terminal

31

64

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ump-assembly1.cif.gz_B crystal structure of tnms3, an antibiotic binding protein from streptomyces sp. cb03234 0.8488 16 155
5ujp-assembly1.cif.gz_B the crystal structure of a glyoxalase/bleomycin resistance protein from streptomyces sp. cb03234 0.8336 19 154
5ujp-assembly1.cif.gz_B the crystal structure of a glyoxalase/bleomycin resistance protein from streptomyces sp. cb03234 0.827 19 154
5ump-assembly1.cif.gz_B crystal structure of tnms3, an antibiotic binding protein from streptomyces sp. cb03234 0.8233 16 155
5umq-assembly1.cif.gz_A crystal structure of tnms1, an antibiotic binding protein from streptomyces sp. cb03234 0.8226 16 154
ID Description Score Start End Superfamily
5ujpB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8329 19 154 3.10.180.10
5ujpB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8263 19 154 3.10.180.10
5uhjB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8138 18 152 3.10.180.10
4hc5C00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8014 18 154 3.10.180.10
af_Q8III5_2_235_3.30.830.10 Alpha Beta;2-Layer Sandwich;Cytochrome Bc1 Complex; Chain A, domain 1;Metalloenzyme, LuxS/M16 peptidase-like 0.7908 42 71 3.30.830.10
ID Description Score Start End GO Terms
AF-A0A387BKC5-F1-model_v4 Glyoxalase 0.9743 16 162
AF-A0A1E7N204-F1-model_v4 VOC domain-containing protein 0.9734 16 163
AF-A0A4R3GGE2-F1-model_v4 Catechol 2,3-dioxygenase-like lactoylglutathione lyase family enzyme 0.9692 17 161 GO:0016829
GO:0051213
AF-A0A387BKC5-F1-model_v4 Glyoxalase 0.9678 16 162
AF-A0A535B260-F1-model_v4 Glyoxalase 0.961 16 107

Map