F322907

General Info

Members Datasets Scaffolds Average Seq Length
212 185 424 108

Family's Representative Sequence

Representative Sequence 3300025909|Ga0207705_10912540|Ga0207705_109125402
Length 109
Sequence MSIATDIATASASPCQACGACCSYSRNWPRFTIEDDTALDLIPAQFVNARLSGMRCSALTGKVGEATACGIYAVRPEVCRTCMPGDTECAMARRRFGLPVLPARDDIDE

Samples

Sample ID Description Type Environment
1 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
30 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
39 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
40 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
48 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
49 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
50 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
68 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
70 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
71 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
72 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
73 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
74 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
75 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
76 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
77 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
78 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
79 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
80 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
81 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
82 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
83 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
84 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
85 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
86 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
87 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
88 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
89 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
90 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
91 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
92 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
93 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
94 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
95 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
96 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
97 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
98 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
99 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
100 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
101 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
102 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
103 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
104 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
105 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
106 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
107 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
108 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
109 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
110 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
111 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
112 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
113 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
114 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
115 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
116 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
117 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
118 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
119 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
120 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
121 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
122 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
123 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
124 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
125 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
126 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
127 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
128 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
129 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
130 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
131 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
132 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
133 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
134 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
135 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
136 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
137 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
138 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
139 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
140 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
141 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
142 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
143 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
144 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
145 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
146 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
157 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
158 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
159 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
160 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
162 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
163 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
164 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
165 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
166 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
167 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
168 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
169 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
170 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
171 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
172 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
173 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
174 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
175 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
176 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
177 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
178 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
179 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
180 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
181 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
182 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
183 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
184 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
185 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.58
Metatranscriptomes 0
Isolates 1.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.6
Nodule 0.94
Rhizoplane 7.08
Rhizosphere 80.66
Stem 0
Stem Tuber 0
Unclassified 6.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207705_10912540 3300025909 Bacteria 680
2 rootL2_10186248 3300003322 Bacteria 1991
3 Ga0070690_100143649 3300005330 Bacteria 1622
4 Ga0068869_101715218 3300005334 Bacteria 561
5 Ga0070680_100321670 3300005336 Bacteria 1313
6 Ga0068868_100345779 3300005338 Bacteria 1273
7 Ga0070660_100028099 3300005339 Bacteria 4205
8 Ga0070660_100381130 3300005339 Bacteria 1164
9 Ga0070689_100004689 3300005340 Bacteria 9265
10 Ga0070692_10327620 3300005345 Bacteria 944
11 Ga0070675_100605279 3300005354 Bacteria 994
12 Ga0070673_101389729 3300005364 Bacteria 660
13 Ga0070688_101789134 3300005365 Unclassified 504
14 Ga0070714_100004471 3300005435 Bacteria 10536
15 Ga0070714_100226508 3300005435 Bacteria 1721
16 Ga0070713_100024195 3300005436 Bacteria 4727
17 Ga0070713_100882325 3300005436 Bacteria 860
18 Ga0070713_100917632 3300005436 Bacteria 843
19 Ga0070713_101337726 3300005436 Bacteria 694
20 Ga0070681_10303882 3300005458 Bacteria 1505
21 Ga0070706_100281577 3300005467 Bacteria 1552
22 Ga0068853_100205648 3300005539 Bacteria 1793
23 Ga0068853_100356498 3300005539 Bacteria 1361
24 Ga0070696_100065878 3300005546 Bacteria 2540
25 Ga0068854_100477176 3300005578 Bacteria 1046
26 Ga0068856_100000137 3300005614 Bacteria 73762
27 Ga0070702_100381760 3300005615 Bacteria 1002
28 Ga0068852_101436835 3300005616 Bacteria 712
29 Ga0068864_101503041 3300005618 Bacteria 676
30 Ga0068866_10679921 3300005718 Bacteria 704
31 Ga0068861_100244109 3300005719 Bacteria 1529
32 Ga0068862_100059221 3300005844 Bacteria 3288
33 Ga0070717_10001116 3300006028 Bacteria 18122
34 Ga0070717_11711876 3300006028 Bacteria 569
35 Ga0075365_10056869 3300006038 Bacteria 2601
36 Ga0075364_10659775 3300006051 Unclassified 714
37 Ga0070716_100074505 3300006173 Bacteria 2006
38 Ga0075428_100121044 3300006844 Bacteria 2850
39 Ga0075428_100252588 3300006844 Bacteria 1900
40 Ga0075431_100209211 3300006847 Bacteria 1993
41 Ga0075431_100767108 3300006847 Bacteria 939
42 Ga0099794_10002476 3300007265 Bacteria 6813
43 Ga0111539_10181524 3300009094 Bacteria 2458
44 Ga0111539_10381369 3300009094 Bacteria 1641
45 Ga0114129_10031828 3300009147 Bacteria 7457
46 Ga0114129_11452683 3300009147 Bacteria 844
47 Ga0105249_11757858 3300009553 Bacteria 693
48 Ga0105239_10901864 3300010375 Bacteria 1015
49 Ga0105246_10363835 3300011119 Bacteria 1189
50 Ga0157373_10081789 3300013100 Bacteria 2277
51 Ga0157371_10179737 3300013102 Bacteria 1513
52 Ga0157370_11048263 3300013104 Bacteria 737
53 Ga0163162_10191679 3300013306 Unclassified 2172
54 Ga0163162_11397650 3300013306 Bacteria 796
55 Ga0157372_12294009 3300013307 Bacteria 620
56 Ga0157375_10259499 3300013308 Bacteria 1899
57 Ga0163163_10242075 3300014325 Bacteria 1854
58 Ga0157380_10142443 3300014326 Bacteria 2061
59 Ga0157380_11062153 3300014326 Bacteria 847
60 Ga0182008_10690883 3300014497 Bacteria 582
61 Ga0163161_11511519 3300017792 Bacteria 590
62 Ga0213876_10168383 3300021384 Unclassified 1166
63 Ga0207642_10534580 3300025899 Bacteria 722
64 Ga0207699_10466265 3300025906 Bacteria 908
65 Ga0207684_10331385 3300025910 Bacteria 1311
66 Ga0207657_10020015 3300025919 Bacteria 6338
67 Ga0207687_10257055 3300025927 Bacteria 1391
68 Ga0207700_10175565 3300025928 Bacteria 1790
69 Ga0207700_10307010 3300025928 Bacteria 1371
70 Ga0207664_10016865 3300025929 Bacteria 5340
71 Ga0207690_10294771 3300025932 Bacteria 1267
72 Ga0207670_10072528 3300025936 Bacteria 2384
73 Ga0207665_10071156 3300025939 Bacteria 2374
74 Ga0207665_10077558 3300025939 Bacteria 2281
75 Ga0207711_10488588 3300025941 Unclassified 1147
76 Ga0207667_11233641 3300025949 Bacteria 726
77 Ga0207651_10636470 3300025960 Bacteria 935
78 Ga0207677_11934157 3300026023 Unclassified 548
79 Ga0207639_11094787 3300026041 Bacteria 747
80 Ga0207702_10000063 3300026078 Bacteria 123034
81 Ga0209588_1044647 3300027671 Bacteria 1433
82 Ga0209588_1059310 3300027671 Bacteria 1238
83 Ga0207428_10113700 3300027907 Bacteria 2080
84 Ga0268265_10093861 3300028380 Bacteria 2405
85 Ga0265318_10024688 3300028577 Bacteria 2382
86 Ga0265332_10002593 3300031238 Bacteria 9145
87 Ga0265320_10497745 3300031240 Bacteria 538
88 Ga0265325_10114169 3300031241 Bacteria 1309
89 Ga0265340_10003205 3300031247 Bacteria 9281
90 Ga0265340_10009289 3300031247 Bacteria 5281
91 Ga0265339_10145101 3300031249 Bacteria 1204
92 Ga0265331_10219846 3300031250 Unclassified 854
93 Ga0265316_10148312 3300031344 Bacteria 1758
94 Ga0307513_10558074 3300031456 Bacteria 857
95 Ga0265314_10056891 3300031711 Bacteria 2690
96 Ga0265342_10000139 3300031712 Bacteria 81785
97 Ga0307516_10515161 3300031730 Bacteria 850
98 Ga0307410_11462781 3300031852 Bacteria 601
99 Ga0373923_0412025 3300035111 Bacteria 651
100 Ga0373932_0319326 3300035112 Bacteria 584
101 Ga0373953_0083918 3300035117 Bacteria 1327
102 Ga0373956_0399000 3300035119 Bacteria 656
103 Ga0373957_0182847 3300035120 Bacteria 869
104 Ga0373955_0239235 3300035172 Bacteria 1087
105 Ga0373931_0044827 3300035691 Unclassified 2334
106 Ga0373935_0497355 3300035692 Bacteria 885
107 Ga0373947_0075638 3300035725 Bacteria 2074
108 Ga0373937_0002237 3300036401 Bacteria 16169
109 Ga0373925_0295047 3300037068 Bacteria 1308
110 Ga0395900_1139726 3300037418 Bacteria 696
111 Ga0395900_1597548 3300037418 Bacteria 563
112 Ga0436364_1167975 3300037853 Bacteria 1970
113 Ga0436365_0388360 3300039437 Bacteria 905
114 Ga0439466_0196252 3300041411 Bacteria 614
115 Ga0451793_1418413 3300041452 Bacteria 737
116 Ga0466969_0057080 3300044656 Bacteria 1904
117 Ga0466966_0001463 3300044684 Bacteria 15199
118 Ga0466961_0000601 3300044693 Bacteria 22652
119 Ga0466959_0020323 3300045049 Bacteria 4891
120 Ga0466958_0068149 3300045836 Bacteria 2175
121 Ga0495651_0009405 3300046462 Bacteria 7507
122 Ga0495605_0022653 3300046474 Bacteria 3314
123 Ga0495662_0607587 3300046476 Bacteria 535
124 Ga0495664_0318042 3300046477 Bacteria 939
125 Ga0495584_0032027 3300046491 Bacteria 2662
126 Ga0495606_0003722 3300046507 Bacteria 15900
127 Ga0495610_0095689 3300046512 Bacteria 1338
128 Ga0495628_0490525 3300046516 Bacteria 888
129 Ga0495643_0283694 3300046522 Bacteria 761
130 Ga0495652_0352940 3300046529 Bacteria 1053
131 Ga0495587_0539988 3300046536 Bacteria 644
132 Ga0495597_0191840 3300046542 Bacteria 822
133 Ga0495667_0941338 3300046559 Bacteria 529
134 Ga0495625_0305796 3300046660 Bacteria 1016
135 Ga0495657_0046244 3300046675 Bacteria 2949
136 Ga0495599_0357921 3300046678 Bacteria 874
137 Ga0495613_0462409 3300046689 Unclassified 858
138 Ga0495624_0960189 3300046690 Unclassified 502
139 Ga0495600_0394894 3300046809 Bacteria 861
140 Ga0495660_0040468 3300046810 Bacteria 2583
141 Ga0495636_0228172 3300047318 Bacteria 856
142 Ga0495672_0025023 3300047320 Bacteria 3830
143 Ga0495676_0742095 3300047321 Unclassified 634
144 Ga0495680_0237081 3300047322 Bacteria 1297
145 Ga0495685_030803 3300047447 Bacteria 1845
146 Ga0495686_0380621 3300047472 Bacteria 761
147 Ga0495626_0061575 3300048091 Bacteria 1706
148 Ga0496100_0621773 3300048903 Bacteria 840
149 Ga0496101_0095624 3300048904 Unclassified 2216
150 Ga0496103_0054419 3300048906 Bacteria 2480
151 Ga0496104_0005920 3300048907 Bacteria 10705
152 Ga0496105_0014282 3300048908 Bacteria 6320
153 Ga0496106_0016259 3300048909 Bacteria 5505
154 Ga0496108_0002250 3300048911 Bacteria 15457
155 Ga0496109_0023952 3300048912 Bacteria 5422
156 Ga0496110_0105079 3300048913 Unclassified 2533
157 Ga0496111_0064197 3300048914 Bacteria 2663
158 Ga0496112_0032127 3300048915 Bacteria 5095
159 Ga0496113_0021103 3300048916 Bacteria 4591
160 Ga0496114_0068317 3300048917 Bacteria 2983
161 Ga0496115_0017602 3300048918 Bacteria 5469
162 Ga0496119_0024118 3300048922 Bacteria 4289
163 Ga0496121_0002689 3300048924 Bacteria 26584
164 Ga0496121_0296278 3300048924 Bacteria 1100
165 Ga0501032_0189010 3300049569 Bacteria 1346
166 Ga0501032_0317663 3300049569 Bacteria 1005
167 Ga0501033_0026715 3300049570 Bacteria 4342
168 Ga0501036_0192603 3300049572 Bacteria 1715
169 Ga0501037_0046687 3300049573 Bacteria 3176
170 Ga0501038_0987582 3300049574 Bacteria 618
171 Ga0501039_0223937 3300049575 Bacteria 1478
172 Ga0501042_0170613 3300049578 Bacteria 1570
173 Ga0501043_1317596 3300049579 Bacteria 503
174 Ga0501046_0655376 3300049580 Bacteria 742
175 Ga0501047_0370814 3300049581 Bacteria 1266
176 Ga0501069_0257869 3300049585 Bacteria 1018
177 Ga0501070_0188878 3300049586 Bacteria 1694
178 Ga0501070_0328451 3300049586 Bacteria 1243
179 Ga0501073_0514270 3300049589 Bacteria 828
180 Ga0501079_0291326 3300049741 Bacteria 1277
181 Ga0501035_0088777 3300049822 Bacteria 2723
182 Ga0501035_0217036 3300049822 Bacteria 1634
183 Ga0501044_0076769 3300049823 Bacteria 3389
184 Ga0501044_0655566 3300049823 Bacteria 938
185 Ga0501044_0671616 3300049823 Bacteria 923
186 nmdc:mga03683_339050_c1 3300050489 Bacteria 710
187 nmdc:mga0yw44_68930_c1 3300050492 Bacteria 2189
188 nmdc:mga0k408_196134_c1 3300050493 Bacteria 1205
189 nmdc:mga05p37_7451_c1 3300050507 Bacteria 12904
190 nmdc:mga05p37_811061_c1 3300050507 Bacteria 1022
191 nmdc:mga06r32_238739_c1 3300050510 Bacteria 1805
192 nmdc:mga06r32_859540_c1 3300050510 Unclassified 865
193 nmdc:mga08y16_107203_c1 3300050511 Bacteria 2908
194 nmdc:mga08y16_341056_c1 3300050511 Bacteria 1540
195 nmdc:mga0n895_50383_c1 3300050512 Bacteria 4082
196 nmdc:mga08x19_304459_c1 3300050514 Bacteria 1107
197 Ga0495601_0416480 3300053077 Bacteria 870
198 Ga0495612_0343229 3300053078 Bacteria 674
199 Ga0495595_0087546 3300053084 Bacteria 1491
200 Ga0495619_0007098 3300053085 Bacteria 7090
201 Ga0500647_0085628 3300053091 Bacteria 1511
202 Ga0500651_0786034 3300053093 Bacteria 503
203 Ga0500556_0415931 3300053104 Bacteria 514
204 Ga0500557_000088 3300053105 Bacteria 31829
205 Ga0500595_048995 3300053119 Bacteria 1317
206 Ga0500618_140156 3300053125 Bacteria 550
207 Ga0500568_0007618 3300053139 Bacteria 5292
208 Ga0500634_0128681 3300053161 Bacteria 1219
209 Ga0500625_025808 3300053729 Bacteria 2781
210 2513627476 2513237092 Bacteria 8341956
211 2821448215 2821443989 Bacteria 7658172
212 2849082219 2849076700 Bacteria 7039503
213 Ga0207705_10912540
214 rootL2_10186248
215 Ga0070690_100143649
216 Ga0068869_101715218
217 Ga0070680_100321670
218 Ga0068868_100345779
219 Ga0070660_100028099
220 Ga0070660_100381130
221 Ga0070689_100004689
222 Ga0070692_10327620
223 Ga0070675_100605279
224 Ga0070673_101389729
225 Ga0070688_101789134
226 Ga0070714_100004471
227 Ga0070714_100226508
228 Ga0070713_100024195
229 Ga0070713_100882325
230 Ga0070713_100917632
231 Ga0070713_101337726
232 Ga0070681_10303882
233 Ga0070706_100281577
234 Ga0068853_100205648
235 Ga0068853_100356498
236 Ga0070696_100065878
237 Ga0068854_100477176
238 Ga0068856_100000137
239 Ga0070702_100381760
240 Ga0068852_101436835
241 Ga0068864_101503041
242 Ga0068866_10679921
243 Ga0068861_100244109
244 Ga0068862_100059221
245 Ga0070717_10001116
246 Ga0070717_11711876
247 Ga0075365_10056869
248 Ga0075364_10659775
249 Ga0070716_100074505
250 Ga0075428_100121044
251 Ga0075428_100252588
252 Ga0075431_100209211
253 Ga0075431_100767108
254 Ga0099794_10002476
255 Ga0111539_10181524
256 Ga0111539_10381369
257 Ga0114129_10031828
258 Ga0114129_11452683
259 Ga0105249_11757858
260 Ga0105239_10901864
261 Ga0105246_10363835
262 Ga0157373_10081789
263 Ga0157371_10179737
264 Ga0157370_11048263
265 Ga0163162_10191679
266 Ga0163162_11397650
267 Ga0157372_12294009
268 Ga0157375_10259499
269 Ga0163163_10242075
270 Ga0157380_10142443
271 Ga0157380_11062153
272 Ga0182008_10690883
273 Ga0163161_11511519
274 Ga0213876_10168383
275 Ga0207642_10534580
276 Ga0207699_10466265
277 Ga0207684_10331385
278 Ga0207657_10020015
279 Ga0207687_10257055
280 Ga0207700_10175565
281 Ga0207700_10307010
282 Ga0207664_10016865
283 Ga0207690_10294771
284 Ga0207670_10072528
285 Ga0207665_10071156
286 Ga0207665_10077558
287 Ga0207711_10488588
288 Ga0207667_11233641
289 Ga0207651_10636470
290 Ga0207677_11934157
291 Ga0207639_11094787
292 Ga0207702_10000063
293 Ga0209588_1044647
294 Ga0209588_1059310
295 Ga0207428_10113700
296 Ga0268265_10093861
297 Ga0265318_10024688
298 Ga0265332_10002593
299 Ga0265320_10497745
300 Ga0265325_10114169
301 Ga0265340_10003205
302 Ga0265340_10009289
303 Ga0265339_10145101
304 Ga0265331_10219846
305 Ga0265316_10148312
306 Ga0307513_10558074
307 Ga0265314_10056891
308 Ga0265342_10000139
309 Ga0307516_10515161
310 Ga0307410_11462781
311 Ga0373923_0412025
312 Ga0373932_0319326
313 Ga0373953_0083918
314 Ga0373956_0399000
315 Ga0373957_0182847
316 Ga0373955_0239235
317 Ga0373931_0044827
318 Ga0373935_0497355
319 Ga0373947_0075638
320 Ga0373937_0002237
321 Ga0373925_0295047
322 Ga0395900_1139726
323 Ga0395900_1597548
324 Ga0436364_1167975
325 Ga0436365_0388360
326 Ga0439466_0196252
327 Ga0451793_1418413
328 Ga0466969_0057080
329 Ga0466966_0001463
330 Ga0466961_0000601
331 Ga0466959_0020323
332 Ga0466958_0068149
333 Ga0495651_0009405
334 Ga0495605_0022653
335 Ga0495662_0607587
336 Ga0495664_0318042
337 Ga0495584_0032027
338 Ga0495606_0003722
339 Ga0495610_0095689
340 Ga0495628_0490525
341 Ga0495643_0283694
342 Ga0495652_0352940
343 Ga0495587_0539988
344 Ga0495597_0191840
345 Ga0495667_0941338
346 Ga0495625_0305796
347 Ga0495657_0046244
348 Ga0495599_0357921
349 Ga0495613_0462409
350 Ga0495624_0960189
351 Ga0495600_0394894
352 Ga0495660_0040468
353 Ga0495636_0228172
354 Ga0495672_0025023
355 Ga0495676_0742095
356 Ga0495680_0237081
357 Ga0495685_030803
358 Ga0495686_0380621
359 Ga0495626_0061575
360 Ga0496100_0621773
361 Ga0496101_0095624
362 Ga0496103_0054419
363 Ga0496104_0005920
364 Ga0496105_0014282
365 Ga0496106_0016259
366 Ga0496108_0002250
367 Ga0496109_0023952
368 Ga0496110_0105079
369 Ga0496111_0064197
370 Ga0496112_0032127
371 Ga0496113_0021103
372 Ga0496114_0068317
373 Ga0496115_0017602
374 Ga0496119_0024118
375 Ga0496121_0002689
376 Ga0496121_0296278
377 Ga0501032_0189010
378 Ga0501032_0317663
379 Ga0501033_0026715
380 Ga0501036_0192603
381 Ga0501037_0046687
382 Ga0501038_0987582
383 Ga0501039_0223937
384 Ga0501042_0170613
385 Ga0501043_1317596
386 Ga0501046_0655376
387 Ga0501047_0370814
388 Ga0501069_0257869
389 Ga0501070_0188878
390 Ga0501070_0328451
391 Ga0501073_0514270
392 Ga0501079_0291326
393 Ga0501035_0088777
394 Ga0501035_0217036
395 Ga0501044_0076769
396 Ga0501044_0655566
397 Ga0501044_0671616
398 nmdc:mga03683_339050_c1
399 nmdc:mga0yw44_68930_c1
400 nmdc:mga0k408_196134_c1
401 nmdc:mga05p37_7451_c1
402 nmdc:mga05p37_811061_c1
403 nmdc:mga06r32_238739_c1
404 nmdc:mga06r32_859540_c1
405 nmdc:mga08y16_107203_c1
406 nmdc:mga08y16_341056_c1
407 nmdc:mga0n895_50383_c1
408 nmdc:mga08x19_304459_c1
409 Ga0495601_0416480
410 Ga0495612_0343229
411 Ga0495595_0087546
412 Ga0495619_0007098
413 Ga0500647_0085628
414 Ga0500651_0786034
415 Ga0500556_0415931
416 Ga0500557_000088
417 Ga0500595_048995
418 Ga0500618_140156
419 Ga0500568_0007618
420 Ga0500634_0128681
421 Ga0500625_025808
422 2513627476
423 2821448215
424 2849082219

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03692

CxxCxxCC

Putative zinc- or iron-chelating domain

14

94

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dpd-assembly1.cif.gz_B crystal structure of the replication termination protein in complex with a pseudosymmetric b-site 0.3085 60 96
6p4h-assembly1.cif.gz_W structure of a mammalian small ribosomal subunit in complex with the israeli acute paralysis virus ires (class 2) 0.2714 30 100
5ovd-assembly1.cif.gz_A ras guanine nucleotide exchange factor sos1 (rem-cdc25) in new crystal form 0.2433 58 99
6p4h-assembly1.cif.gz_W structure of a mammalian small ribosomal subunit in complex with the israeli acute paralysis virus ires (class 2) 0.1944 30 100
6oo2-assembly1.cif.gz_E vps4 with cyclic peptide bound in the central pore 0.1832 32 97
ID Description Score Start End Superfamily
1hfeM02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.3898 58 84 3.30.70.20
af_Q19825_582_713_1.10.730.10 Mainly Alpha;Orthogonal Bundle;Isoleucyl-tRNA Synthetase; Domain 1;Isoleucyl-tRNA Synthetase; Domain 1 0.3454 56 99 1.10.730.10
af_P9WHJ3_710_789_3.30.250.10 Alpha Beta;2-Layer Sandwich;Rec A Protein; domain 2;RecA protein, C-terminal domain 0.3354 50 100 3.30.250.10
af_Q67VB3_103_239_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.2924 40 97 1.20.1070.10
1hfeM02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.2916 58 84 3.30.70.20
ID Description Score Start End GO Terms
AF-A0A327KK59-F1-model_v4 Zinc/iron-chelating domain-containing protein 0.9036 2 99
AF-A0A537L657-F1-model_v4 YkgJ family cysteine cluster protein 0.8992 10 99
AF-A0A1X7MZ73-F1-model_v4 Fe-S oxidoreductase 0.8967 6 99
AF-A0A327KLJ6-F1-model_v4 Zinc/iron-chelating domain-containing protein 0.89 10 98
AF-J6LD92-F1-model_v4 Ferredoxin 0.8877 10 98

Map