F322721

General Info

Members Datasets Scaffolds Average Seq Length
212 88 424 267

Family's Representative Sequence

Representative Sequence 3300006914|Ga0075436_100016363|Ga0075436_1000163634
Length 290
Sequence MTQPNDVLSTEVLRHGAYICLTAPPDARRHLAGAAVPALATRLGLRNEFDPGTGHPPDAVAFLRRVGATPGTIADDELLRADAIVHVASSRAPVVAEFCAEATRLLAPAIKPRVLAGVVRPKDYTSAAMNQFAYAHAVPQQPGAAAPNAFLLPMSKTAAWWSKDWMERHTYFLPRYEHGRMVSQGHALASAAGIACLMRRTYKHGTSPAPAGSYDFVTYFECADADVPTFHEVCAALRDVARNPEWEFVREGPCWQGRRVATWTELFDELPGEPDRLGPGMSGVPTVRVR

Samples

Sample ID Description Type Environment
1 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
4 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
5 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
6 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
7 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
13 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
14 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
15 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
16 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
17 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
18 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
19 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
21 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
23 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
24 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
25 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
26 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
27 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
28 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
45 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
46 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
56 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
57 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
58 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
59 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
60 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
61 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
62 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
63 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
64 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
65 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
66 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
67 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
68 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
69 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
70 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
71 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
72 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
73 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
74 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
75 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
76 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
77 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
78 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
79 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
80 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
81 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
82 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
83 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
84 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
85 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
86 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
87 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
88 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.19
Nodule 0
Rhizoplane 0
Rhizosphere 91.98
Stem 0
Stem Tuber 0
Unclassified 9.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075436_100016363 3300006914 Bacteria 5076
2 Ga0065707_10158752 3300005295 Bacteria 1584
3 Ga0070687_100089236 3300005343 Unclassified 1701
4 Ga0070692_10318707 3300005345 Unclassified 955
5 Ga0070711_100010370 3300005439 Bacteria 5765
6 Ga0070705_100006655 3300005440 Bacteria 5681
7 Ga0070705_100088299 3300005440 Bacteria 1924
8 Ga0070694_100190091 3300005444 Unclassified 1524
9 Ga0070708_100051811 3300005445 Bacteria 3637
10 Ga0070708_100108152 3300005445 Bacteria 2553
11 Ga0070708_100332568 3300005445 Unclassified 1431
12 Ga0070706_100108386 3300005467 Unclassified 2584
13 Ga0070706_100360454 3300005467 Bacteria 1355
14 Ga0070707_100009693 3300005468 Bacteria 8949
15 Ga0070707_100010167 3300005468 Bacteria 8759
16 Ga0070707_100027203 3300005468 Bacteria 5440
17 Ga0070707_100039615 3300005468 Bacteria 4504
18 Ga0070707_100056537 3300005468 Bacteria 3763
19 Ga0070707_100286522 3300005468 Unclassified 1600
20 Ga0070698_100030745 3300005471 Bacteria 5567
21 Ga0070698_100718650 3300005471 Bacteria 941
22 Ga0070699_100028880 3300005518 Bacteria 4781
23 Ga0070699_100038602 3300005518 Bacteria 4135
24 Ga0070699_100078155 3300005518 Bacteria 2882
25 Ga0070699_100209460 3300005518 Unclassified 1735
26 Ga0070699_100218502 3300005518 Unclassified 1698
27 Ga0070699_100261203 3300005518 Bacteria 1548
28 Ga0070699_100518183 3300005518 Unclassified 1084
29 Ga0070697_100015588 3300005536 Bacteria 5968
30 Ga0070697_100019857 3300005536 Bacteria 5310
31 Ga0070697_100116796 3300005536 Bacteria 2229
32 Ga0070697_100189304 3300005536 Bacteria 1746
33 Ga0070696_100050410 3300005546 Bacteria 2893
34 Ga0070696_100167093 3300005546 Bacteria 1624
35 Ga0070704_100088744 3300005549 Bacteria 2298
36 Ga0070664_100540276 3300005564 Bacteria 1077
37 Ga0070702_100422970 3300005615 Bacteria 959
38 Ga0070702_100427174 3300005615 Bacteria 955
39 Ga0068861_100628087 3300005719 Bacteria 989
40 Ga0081455_10150476 3300005937 Bacteria 1795
41 Ga0081540_1126453 3300005983 Bacteria 1051
42 Ga0081539_10000005 3300005985 Bacteria 549026
43 Ga0075365_10281568 3300006038 Unclassified 1170
44 Ga0075364_10006951 3300006051 Bacteria 6685
45 Ga0075432_10036473 3300006058 Bacteria 1709
46 Ga0070712_100008475 3300006175 Bacteria 6470
47 Ga0075362_10012533 3300006177 Bacteria 3371
48 Ga0075367_10023624 3300006178 Bacteria 3461
49 Ga0075366_10002235 3300006195 Bacteria 9887
50 Ga0075366_10093136 3300006195 Bacteria 1806
51 Ga0075428_100003422 3300006844 Bacteria 17359
52 Ga0075428_100003944 3300006844 Bacteria 16279
53 Ga0075428_100008853 3300006844 Bacteria 11167
54 Ga0075428_100017240 3300006844 Bacteria 7980
55 Ga0075428_100093357 3300006844 Bacteria 3281
56 Ga0075428_100284408 3300006844 Bacteria 1779
57 Ga0075428_100497129 3300006844 Unclassified 1305
58 Ga0075430_100104596 3300006846 Bacteria 2363
59 Ga0075431_100001083 3300006847 Bacteria 24362
60 Ga0075431_100006035 3300006847 Bacteria 12013
61 Ga0075431_100120781 3300006847 Bacteria 2704
62 Ga0075431_100313318 3300006847 Bacteria 1583
63 Ga0075431_100410581 3300006847 Bacteria 1354
64 Ga0075433_10000071 3300006852 Bacteria 45544
65 Ga0075433_10000291 3300006852 Bacteria 30003
66 Ga0075433_10145485 3300006852 Bacteria 2107
67 Ga0075433_10213029 3300006852 Bacteria 1716
68 Ga0075433_10329725 3300006852 Unclassified 1350
69 Ga0075433_10464739 3300006852 Bacteria 1115
70 Ga0075434_100007950 3300006871 Bacteria 9829
71 Ga0075434_100029690 3300006871 Bacteria 5381
72 Ga0075434_100058465 3300006871 Bacteria 3832
73 Ga0075434_100066496 3300006871 Bacteria 3590
74 Ga0075434_100109086 3300006871 Bacteria 2778
75 Ga0075434_100274968 3300006871 Bacteria 1704
76 Ga0075434_100653514 3300006871 Bacteria 1070
77 Ga0075429_100016895 3300006880 Bacteria 6313
78 Ga0075429_100060019 3300006880 Bacteria 3313
79 Ga0075429_100127680 3300006880 Bacteria 2224
80 Ga0075436_100000667 3300006914 Bacteria 22531
81 Ga0075436_100061309 3300006914 Bacteria 2598
82 Ga0075436_100306900 3300006914 Bacteria 1138
83 Ga0075435_100001724 3300007076 Bacteria 14215
84 Ga0075435_100016469 3300007076 Bacteria 5574
85 Ga0075435_100038022 3300007076 Bacteria 3836
86 Ga0075435_100054437 3300007076 Bacteria 3229
87 Ga0075435_100076292 3300007076 Bacteria 2746
88 Ga0075435_100089725 3300007076 Bacteria 2535
89 Ga0111539_10002082 3300009094 Bacteria 26730
90 Ga0111539_10013949 3300009094 Bacteria 10045
91 Ga0111539_10014058 3300009094 Bacteria 10003
92 Ga0111539_10017919 3300009094 Bacteria 8773
93 Ga0111539_10087989 3300009094 Bacteria 3649
94 Ga0111539_10236794 3300009094 Bacteria 2125
95 Ga0114129_10000298 3300009147 Bacteria 57595
96 Ga0114129_10004608 3300009147 Bacteria 19462
97 Ga0114129_10007559 3300009147 Bacteria 15478
98 Ga0114129_10010125 3300009147 Bacteria 13439
99 Ga0114129_10011045 3300009147 Bacteria 12863
100 Ga0114129_10014170 3300009147 Bacteria 11360
101 Ga0114129_10059337 3300009147 Bacteria 5349
102 Ga0114129_10117478 3300009147 Bacteria 3665
103 Ga0114129_10213651 3300009147 Bacteria 2606
104 Ga0114129_11142542 3300009147 Bacteria 973
105 Ga0105242_10176769 3300009176 Bacteria 1880
106 Ga0105242_10725312 3300009176 Bacteria 975
107 Ga0105248_10621362 3300009177 Bacteria 1219
108 Ga0105249_10384604 3300009553 Bacteria 1430
109 Ga0105249_10402606 3300009553 Bacteria 1399
110 Ga0105249_10492935 3300009553 Bacteria 1269
111 Ga0157369_10048338 3300013105 Bacteria 4616
112 Ga0157378_10155464 3300013297 Bacteria 2135
113 Ga0163163_10459731 3300014325 Bacteria 1333
114 Ga0213876_10003045 3300021384 Bacteria 9694
115 Ga0213875_10159688 3300021388 Bacteria 1057
116 Ga0207684_10004036 3300025910 Bacteria 14030
117 Ga0207684_10044727 3300025910 Bacteria 3755
118 Ga0207684_10311597 3300025910 Bacteria 1357
119 Ga0207684_10574120 3300025910 Bacteria 964
120 Ga0207693_10042183 3300025915 Bacteria 3592
121 Ga0207663_10092526 3300025916 Bacteria 2010
122 Ga0207662_10272348 3300025918 Bacteria 1118
123 Ga0207646_10002877 3300025922 Bacteria 19973
124 Ga0207646_10011866 3300025922 Bacteria 8405
125 Ga0207646_10013564 3300025922 Bacteria 7786
126 Ga0207646_10020671 3300025922 Bacteria 6097
127 Ga0207646_10047133 3300025922 Bacteria 3866
128 Ga0207646_10104129 3300025922 Bacteria 2545
129 Ga0207646_10212279 3300025922 Bacteria 1748
130 Ga0207679_10490646 3300025945 Bacteria 1095
131 Ga0207712_10256490 3300025961 Bacteria 1416
132 Ga0207712_10474699 3300025961 Bacteria 1065
133 Ga0207641_10656636 3300026088 Unclassified 1030
134 Ga0207675_100473902 3300026118 Bacteria 1243
135 Ga0207428_10000991 3300027907 Bacteria 31462
136 Ga0207428_10192009 3300027907 Bacteria 1539
137 Ga0207428_10341587 3300027907 Bacteria 1103
138 Ga0316214_1002720 3300033545 Bacteria 2188
139 Ga0373949_0043045 3300035090 Unclassified 1116
140 Ga0373932_0023159 3300035112 Bacteria 1658
141 Ga0373939_0028667 3300035114 Bacteria 1586
142 Ga0395899_0337259 3300037312 Bacteria 1012
143 Ga0395900_0495905 3300037418 Bacteria 1172
144 Ga0395898_0440097 3300037466 Unclassified 1242
145 Ga0395905_0071063 3300037471 Bacteria 3263
146 Ga0436364_1199985 3300037853 Bacteria 5135
147 Ga0395901_0337296 3300038443 Unclassified 1558
148 Ga0436365_0354804 3300039437 Bacteria 6845
149 Ga0436365_0699725 3300039437 Unclassified 1888
150 Ga0451577_0123348 3300042876 Bacteria 2321
151 Ga0453684_0583908 3300044712 Unclassified 1227
152 Ga0451576_0129331 3300045051 Bacteria 2632
153 Ga0451576_0579463 3300045051 Bacteria 1179
154 Ga0495638_0190330 3300046460 Bacteria 1164
155 Ga0495580_0012927 3300046472 Bacteria 6392
156 Ga0495584_0052537 3300046491 Bacteria 2051
157 Ga0495642_0010221 3300046528 Bacteria 3594
158 Ga0495659_0083787 3300046664 Bacteria 1214
159 Ga0501076_0428701 3300049592 Bacteria 1088
160 nmdc:mga03683_8505_c1 3300050489 Bacteria 3612
161 nmdc:mga00v17_26005_c1 3300050491 Bacteria 3406
162 nmdc:mga0k408_12688_c1 3300050493 Bacteria 4608
163 nmdc:mga0k408_3116_c1 3300050493 Bacteria 8338
164 nmdc:mga06z11_22957_c1 3300050494 Bacteria 2923
165 nmdc:mga05p37_148663_c1 3300050507 Unclassified 2867
166 nmdc:mga05p37_306_c1 3300050507 Bacteria 51566
167 nmdc:mga05p37_32851_c1 3300050507 Bacteria 6351
168 nmdc:mga05p37_355025_c1 3300050507 Bacteria 1725
169 nmdc:mga05p37_411102_c1 3300050507 Bacteria 1577
170 nmdc:mga05p37_47749_c1 3300050507 Bacteria 5265
171 nmdc:mga05p37_63203_c1 3300050507 Bacteria 4556
172 nmdc:mga05p37_7426_c1 3300050507 Bacteria 12931
173 nmdc:mga05p37_77527_c1 3300050507 Bacteria 4092
174 nmdc:mga09592_121287_c1 3300050508 Bacteria 2246
175 nmdc:mga09592_123662_c1 3300050508 Bacteria 2223
176 nmdc:mga09592_220658_c1 3300050508 Bacteria 1643
177 nmdc:mga09592_380356_c1 3300050508 Bacteria 1221
178 nmdc:mga09592_4788_c1 3300050508 Bacteria 10965
179 nmdc:mga09592_50055_c1 3300050508 Bacteria 3524
180 nmdc:mga0qj67_21686_c1 3300050509 Bacteria 4929
181 nmdc:mga06r32_13868_c1 3300050510 Bacteria 7312
182 nmdc:mga06r32_18954_c1 3300050510 Bacteria 6309
183 nmdc:mga06r32_275359_c1 3300050510 Bacteria 1670
184 nmdc:mga06r32_28539_c1 3300050510 Bacteria 5224
185 nmdc:mga06r32_444559_c1 3300050510 Bacteria 1276
186 nmdc:mga06r32_480492_c1 3300050510 Bacteria 1220
187 nmdc:mga08y16_29708_c1 3300050511 Bacteria 5755
188 nmdc:mga08y16_30529_c1 3300050511 Bacteria 5672
189 nmdc:mga08y16_51069_c1 3300050511 Bacteria 4326
190 nmdc:mga08y16_93666_c1 3300050511 Bacteria 3129
191 nmdc:mga08y16_9515_c1 3300050511 Bacteria 10197
192 nmdc:mga0n895_133061_c1 3300050512 Bacteria 2513
193 nmdc:mga0n895_16966_c1 3300050512 Bacteria 6699
194 nmdc:mga0n895_234062_c1 3300050512 Bacteria 1864
195 nmdc:mga0n895_32531_c1 3300050512 Bacteria 5007
196 nmdc:mga0n895_331111_c1 3300050512 Bacteria 1543
197 nmdc:mga0n895_33246_c1 3300050512 Bacteria 4955
198 nmdc:mga0n895_808398_c1 3300050512 Bacteria 928
199 nmdc:mga0rr50_12086_c1 3300050513 Bacteria 5561
200 nmdc:mga0rr50_2092_c1 3300050513 Bacteria 11154
201 nmdc:mga0rr50_29294_c1 3300050513 Bacteria 3881
202 nmdc:mga08x19_25314_c1 3300050514 Bacteria 3695
203 nmdc:mga08x19_277773_c1 3300050514 Bacteria 1160
204 nmdc:mga08x19_41039_c1 3300050514 Bacteria 2947
205 nmdc:mga08x19_843_c1 3300050514 Bacteria 19459
206 nmdc:mga0a205_139878_c1 3300050515 Unclassified 2321
207 nmdc:mga0a205_171790_c1 3300050515 Bacteria 2064
208 nmdc:mga0a205_18222_c1 3300050515 Bacteria 6596
209 nmdc:mga0a205_315774_c1 3300050515 Bacteria 1071
210 nmdc:mga0a205_46208_c1 3300050515 Bacteria 4199
211 nmdc:mga0a205_669_c1 3300050515 Bacteria 27279
212 nmdc:mga0a205_85284_c1 3300050515 Bacteria 3050
213 Ga0075436_100016363
214 Ga0065707_10158752
215 Ga0070687_100089236
216 Ga0070692_10318707
217 Ga0070711_100010370
218 Ga0070705_100006655
219 Ga0070705_100088299
220 Ga0070694_100190091
221 Ga0070708_100051811
222 Ga0070708_100108152
223 Ga0070708_100332568
224 Ga0070706_100108386
225 Ga0070706_100360454
226 Ga0070707_100009693
227 Ga0070707_100010167
228 Ga0070707_100027203
229 Ga0070707_100039615
230 Ga0070707_100056537
231 Ga0070707_100286522
232 Ga0070698_100030745
233 Ga0070698_100718650
234 Ga0070699_100028880
235 Ga0070699_100038602
236 Ga0070699_100078155
237 Ga0070699_100209460
238 Ga0070699_100218502
239 Ga0070699_100261203
240 Ga0070699_100518183
241 Ga0070697_100015588
242 Ga0070697_100019857
243 Ga0070697_100116796
244 Ga0070697_100189304
245 Ga0070696_100050410
246 Ga0070696_100167093
247 Ga0070704_100088744
248 Ga0070664_100540276
249 Ga0070702_100422970
250 Ga0070702_100427174
251 Ga0068861_100628087
252 Ga0081455_10150476
253 Ga0081540_1126453
254 Ga0081539_10000005
255 Ga0075365_10281568
256 Ga0075364_10006951
257 Ga0075432_10036473
258 Ga0070712_100008475
259 Ga0075362_10012533
260 Ga0075367_10023624
261 Ga0075366_10002235
262 Ga0075366_10093136
263 Ga0075428_100003422
264 Ga0075428_100003944
265 Ga0075428_100008853
266 Ga0075428_100017240
267 Ga0075428_100093357
268 Ga0075428_100284408
269 Ga0075428_100497129
270 Ga0075430_100104596
271 Ga0075431_100001083
272 Ga0075431_100006035
273 Ga0075431_100120781
274 Ga0075431_100313318
275 Ga0075431_100410581
276 Ga0075433_10000071
277 Ga0075433_10000291
278 Ga0075433_10145485
279 Ga0075433_10213029
280 Ga0075433_10329725
281 Ga0075433_10464739
282 Ga0075434_100007950
283 Ga0075434_100029690
284 Ga0075434_100058465
285 Ga0075434_100066496
286 Ga0075434_100109086
287 Ga0075434_100274968
288 Ga0075434_100653514
289 Ga0075429_100016895
290 Ga0075429_100060019
291 Ga0075429_100127680
292 Ga0075436_100000667
293 Ga0075436_100061309
294 Ga0075436_100306900
295 Ga0075435_100001724
296 Ga0075435_100016469
297 Ga0075435_100038022
298 Ga0075435_100054437
299 Ga0075435_100076292
300 Ga0075435_100089725
301 Ga0111539_10002082
302 Ga0111539_10013949
303 Ga0111539_10014058
304 Ga0111539_10017919
305 Ga0111539_10087989
306 Ga0111539_10236794
307 Ga0114129_10000298
308 Ga0114129_10004608
309 Ga0114129_10007559
310 Ga0114129_10010125
311 Ga0114129_10011045
312 Ga0114129_10014170
313 Ga0114129_10059337
314 Ga0114129_10117478
315 Ga0114129_10213651
316 Ga0114129_11142542
317 Ga0105242_10176769
318 Ga0105242_10725312
319 Ga0105248_10621362
320 Ga0105249_10384604
321 Ga0105249_10402606
322 Ga0105249_10492935
323 Ga0157369_10048338
324 Ga0157378_10155464
325 Ga0163163_10459731
326 Ga0213876_10003045
327 Ga0213875_10159688
328 Ga0207684_10004036
329 Ga0207684_10044727
330 Ga0207684_10311597
331 Ga0207684_10574120
332 Ga0207693_10042183
333 Ga0207663_10092526
334 Ga0207662_10272348
335 Ga0207646_10002877
336 Ga0207646_10011866
337 Ga0207646_10013564
338 Ga0207646_10020671
339 Ga0207646_10047133
340 Ga0207646_10104129
341 Ga0207646_10212279
342 Ga0207679_10490646
343 Ga0207712_10256490
344 Ga0207712_10474699
345 Ga0207641_10656636
346 Ga0207675_100473902
347 Ga0207428_10000991
348 Ga0207428_10192009
349 Ga0207428_10341587
350 Ga0316214_1002720
351 Ga0373949_0043045
352 Ga0373932_0023159
353 Ga0373939_0028667
354 Ga0395899_0337259
355 Ga0395900_0495905
356 Ga0395898_0440097
357 Ga0395905_0071063
358 Ga0436364_1199985
359 Ga0395901_0337296
360 Ga0436365_0354804
361 Ga0436365_0699725
362 Ga0451577_0123348
363 Ga0453684_0583908
364 Ga0451576_0129331
365 Ga0451576_0579463
366 Ga0495638_0190330
367 Ga0495580_0012927
368 Ga0495584_0052537
369 Ga0495642_0010221
370 Ga0495659_0083787
371 Ga0501076_0428701
372 nmdc:mga03683_8505_c1
373 nmdc:mga00v17_26005_c1
374 nmdc:mga0k408_12688_c1
375 nmdc:mga0k408_3116_c1
376 nmdc:mga06z11_22957_c1
377 nmdc:mga05p37_148663_c1
378 nmdc:mga05p37_306_c1
379 nmdc:mga05p37_32851_c1
380 nmdc:mga05p37_355025_c1
381 nmdc:mga05p37_411102_c1
382 nmdc:mga05p37_47749_c1
383 nmdc:mga05p37_63203_c1
384 nmdc:mga05p37_7426_c1
385 nmdc:mga05p37_77527_c1
386 nmdc:mga09592_121287_c1
387 nmdc:mga09592_123662_c1
388 nmdc:mga09592_220658_c1
389 nmdc:mga09592_380356_c1
390 nmdc:mga09592_4788_c1
391 nmdc:mga09592_50055_c1
392 nmdc:mga0qj67_21686_c1
393 nmdc:mga06r32_13868_c1
394 nmdc:mga06r32_18954_c1
395 nmdc:mga06r32_275359_c1
396 nmdc:mga06r32_28539_c1
397 nmdc:mga06r32_444559_c1
398 nmdc:mga06r32_480492_c1
399 nmdc:mga08y16_29708_c1
400 nmdc:mga08y16_30529_c1
401 nmdc:mga08y16_51069_c1
402 nmdc:mga08y16_93666_c1
403 nmdc:mga08y16_9515_c1
404 nmdc:mga0n895_133061_c1
405 nmdc:mga0n895_16966_c1
406 nmdc:mga0n895_234062_c1
407 nmdc:mga0n895_32531_c1
408 nmdc:mga0n895_331111_c1
409 nmdc:mga0n895_33246_c1
410 nmdc:mga0n895_808398_c1
411 nmdc:mga0rr50_12086_c1
412 nmdc:mga0rr50_2092_c1
413 nmdc:mga0rr50_29294_c1
414 nmdc:mga08x19_25314_c1
415 nmdc:mga08x19_277773_c1
416 nmdc:mga08x19_41039_c1
417 nmdc:mga08x19_843_c1
418 nmdc:mga0a205_139878_c1
419 nmdc:mga0a205_171790_c1
420 nmdc:mga0a205_18222_c1
421 nmdc:mga0a205_315774_c1
422 nmdc:mga0a205_46208_c1
423 nmdc:mga0a205_669_c1
424 nmdc:mga0a205_85284_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2vxh-assembly1.cif.gz_C the crystal structure of chlorite dismutase: a detox enzyme producing molecular oxygen 0.8121 10 267
7owi-assembly2.cif.gz_C crystal structure of dimeric chlorite dismutase variant r127a (ccld r127a) from cyanothece sp. pcc7425 0.8089 14 261
3qpi-assembly2.cif.gz_B crystal structure of dimeric chlorite dismutases from nitrobacter winogradskyi 0.806 60 260
5k91-assembly1.cif.gz_A crystal structure of dimeric chlorite dismutase from cyanothece sp. pcc7425 in complex with fluoride 0.806 60 261
4m08-assembly1.cif.gz_C crystal structure of mutant chlorite dismutase from candidatus nitrospira defluvii w145v 0.8031 10 267
ID Description Score Start End Superfamily
1vdhA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Apc35880; domain 1 0.8311 145 262 3.30.70.1030
af_P9WL45_128_230_3.30.70.1030 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Apc35880; domain 1 0.8283 148 262 3.30.70.1030
af_P9WL45_128_230_3.30.70.1030 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Apc35880; domain 1 0.7571 148 262 3.30.70.1030
5loqB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Apc35880; domain 1 0.7455 147 269 3.30.70.1030
5k8zB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7343 60 259 3.30.70.3420
ID Description Score Start End GO Terms
AF-Q1IQA1-F1-model_v4 Uncharacterized protein 0.9787 69 268
AF-A0A2V7C184-F1-model_v4 Uncharacterized protein 0.9742 96 270
AF-A0A843RYT6-F1-model_v4 Uncharacterized protein 0.9707 113 269
AF-Q1IQA1-F1-model_v4 Uncharacterized protein 0.969 69 268
AF-A0A2V7C184-F1-model_v4 Uncharacterized protein 0.9634 96 270

Map