F322715

General Info

Members Datasets Scaffolds Average Seq Length
212 140 424 631

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_100002076|Ga0075434_1000020769
Length 674
Sequence VNRFFLTTAIDYVNSRPHLGTAYEKVCADVIARYKRLCGLDTRFLMGNDEHSQNVYKQAIEQGLDPLVYCDRMEQEFRKTWARLDVSFDDFIRTTEPRHKVGVTELAKRIYDAGDIYEGVYEGWYCVSCEEFKQEKDLVDGNCPLHPTLKPEWIREKNYFFRLSTYQQPLLDHFAAHPEFLEPEIRRNEILRLIESGLVDISVSRAGQSWGIPLPWDPQSVVYVWFDALINYASAVGLGSDAQMFERWWPADLHIIGKDITRFHAVIWPAMLMSAKLPVPRQVFGHGFMTMNGQRMSKTLGTIVDPIEAADRLGPNGQDPLRLYLVKEIAFGGDGDFSWERYDERYNVDLANNYGNLVSRVTAMAARYRNGSLRPSGAASDQLVRIGEQVAVDYRRAMDRFAIHEGAAAAYRLIDATNEYIAATAPWTLAKDPAASDRLTQVLFDAAEAIRLSAVLLEPVMPRSCRDILRRVGAAPDRLLLERDGRWRADGERALAQEGPLWPRKETTTVTDKPVPPDAPSPGARPLAGGAPSLVPTAAQSSSDLTAQGGVVPAGAAAQSGAQAPQSRISIDDFMKVELRVAKVLAAEKVEKSKKLLKLHVDVGTEHRTLVAGIAEAYDPDTLVGKSVVVVFNLAPAKLMGIESNGMVLAASPDGGKPEVVTFATPPAPGTRVR

Samples

Sample ID Description Type Environment
1 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
50 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
71 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
73 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
74 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
75 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
76 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
77 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
78 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
79 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
80 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
81 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
82 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
83 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
84 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
85 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
86 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
87 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
88 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
89 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
90 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
91 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
92 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
93 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
94 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
95 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
96 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
97 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
98 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
99 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
100 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
101 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
102 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
103 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
104 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
105 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
106 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
118 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
119 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
120 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
121 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
122 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
123 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
124 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
125 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
126 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
129 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
130 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
131 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
132 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
133 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
134 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
135 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
136 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
137 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
138 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
139 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
140 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.94
Nodule 0
Rhizoplane 3.3
Rhizosphere 95.75
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075434_100002076 3300006871 Bacteria 17393
2 Ga0065712_10005167 3300005290 Bacteria 5511
3 Ga0065715_10000664 3300005293 Bacteria 12295
4 Ga0065707_10001253 3300005295 Bacteria 11865
5 Ga0070670_100002501 3300005331 Bacteria 15160
6 Ga0070666_10017158 3300005335 Bacteria 4639
7 Ga0070660_100017609 3300005339 Bacteria 5210
8 Ga0070689_100047070 3300005340 Bacteria 3325
9 Ga0070691_10000430 3300005341 Bacteria 15481
10 Ga0070675_100000124 3300005354 Bacteria 45633
11 Ga0070675_100000290 3300005354 Bacteria 33444
12 Ga0070714_100026137 3300005435 Bacteria 4824
13 Ga0070701_10002099 3300005438 Bacteria 7580
14 Ga0070705_100000276 3300005440 Bacteria 30782
15 Ga0070694_100004247 3300005444 Bacteria 8619
16 Ga0070694_100071970 3300005444 Bacteria 2384
17 Ga0070708_100061800 3300005445 Bacteria 3348
18 Ga0070663_100041191 3300005455 Bacteria 3238
19 Ga0070686_100000823 3300005544 Bacteria 17935
20 Ga0070695_100000101 3300005545 Bacteria 37427
21 Ga0070696_100001806 3300005546 Bacteria 14044
22 Ga0070696_100005285 3300005546 Bacteria 8618
23 Ga0070665_100005220 3300005548 Bacteria 13439
24 Ga0070665_100005573 3300005548 Bacteria 12945
25 Ga0070665_100037254 3300005548 Bacteria 4892
26 Ga0070704_100040411 3300005549 Bacteria 3210
27 Ga0068855_100078970 3300005563 Bacteria 3817
28 Ga0070664_100016272 3300005564 Bacteria 6097
29 Ga0068857_100009819 3300005577 Bacteria 8314
30 Ga0068854_100043723 3300005578 Bacteria 3176
31 Ga0070702_100014650 3300005615 Bacteria 3982
32 Ga0068859_100057617 3300005617 Bacteria 3913
33 Ga0068864_100020051 3300005618 Bacteria 5591
34 Ga0068861_100064050 3300005719 Bacteria 2827
35 Ga0068858_100102147 3300005842 Bacteria 2674
36 Ga0068862_100047542 3300005844 Bacteria 3662
37 Ga0097621_100036371 3300006237 Bacteria 3940
38 Ga0068871_100012641 3300006358 Bacteria 6235
39 Ga0075428_100000010 3300006844 Bacteria 213631
40 Ga0075431_100002351 3300006847 Bacteria 18162
41 Ga0075434_100003792 3300006871 Bacteria 13513
42 Ga0075434_100014667 3300006871 Bacteria 7496
43 Ga0075434_100093149 3300006871 Bacteria 3016
44 Ga0075429_100003094 3300006880 Bacteria 14118
45 Ga0068865_100006421 3300006881 Bacteria 7170
46 Ga0075436_100020371 3300006914 Bacteria 4552
47 Ga0097620_100057617 3300006931 Bacteria 3913
48 Ga0075435_100005198 3300007076 Bacteria 9053
49 Ga0111539_10000001 3300009094 Bacteria 1035431
50 Ga0111539_10001317 3300009094 Bacteria 33152
51 Ga0111539_10046836 3300009094 Bacteria 5171
52 Ga0111539_10060986 3300009094 Bacteria 4469
53 Ga0105245_10014704 3300009098 Bacteria 6814
54 Ga0105247_10010755 3300009101 Bacteria 5527
55 Ga0114129_10000186 3300009147 Bacteria 69381
56 Ga0114129_10014640 3300009147 Bacteria 11175
57 Ga0114129_10017117 3300009147 Bacteria 10322
58 Ga0114129_10041081 3300009147 Bacteria 6519
59 Ga0114129_10058166 3300009147 Bacteria 5408
60 Ga0114129_10069250 3300009147 Bacteria 4918
61 Ga0105242_10017371 3300009176 Bacteria 5605
62 Ga0105242_10054726 3300009176 Bacteria 3262
63 Ga0105242_10060691 3300009176 Bacteria 3108
64 Ga0105248_10035218 3300009177 Bacteria 5600
65 Ga0105248_10042812 3300009177 Bacteria 5077
66 Ga0157374_10062706 3300013296 Bacteria 3485
67 Ga0163163_10011009 3300014325 Bacteria 8178
68 Ga0157380_10004833 3300014326 Bacteria 9387
69 Ga0157377_10020929 3300014745 Bacteria 3433
70 Ga0157379_10045241 3300014968 Bacteria 3930
71 Ga0207680_10028759 3300025903 Bacteria 3114
72 Ga0207643_10036954 3300025908 Bacteria 2739
73 Ga0207705_10026913 3300025909 Bacteria 4099
74 Ga0207660_10037222 3300025917 Bacteria 3389
75 Ga0207657_10027030 3300025919 Bacteria 5261
76 Ga0207650_10063740 3300025925 Bacteria 2757
77 Ga0207659_10000371 3300025926 Bacteria 27010
78 Ga0207659_10000723 3300025926 Bacteria 19547
79 Ga0207659_10012625 3300025926 Bacteria 5384
80 Ga0207664_10022186 3300025929 Bacteria 4737
81 Ga0207706_10139896 3300025933 Bacteria 2129
82 Ga0207686_10006632 3300025934 Bacteria 6242
83 Ga0207711_10020593 3300025941 Bacteria 5504
84 Ga0207711_10059145 3300025941 Bacteria 3300
85 Ga0207689_10042386 3300025942 Bacteria 3765
86 Ga0207668_10056116 3300025972 Bacteria 2742
87 Ga0207678_10044428 3300026067 Bacteria 3843
88 Ga0207708_10002324 3300026075 Bacteria 13962
89 Ga0207708_10078666 3300026075 Bacteria 2532
90 Ga0207641_10002261 3300026088 Bacteria 17946
91 Ga0207674_10006834 3300026116 Bacteria 13378
92 Ga0207675_100009696 3300026118 Bacteria 9009
93 Ga0207675_100098045 3300026118 Bacteria 2760
94 Ga0207428_10000002 3300027907 Bacteria 854851
95 Ga0268266_10013675 3300028379 Bacteria 6988
96 Ga0268266_10032114 3300028379 Bacteria 4460
97 Ga0268266_10039039 3300028379 Bacteria 4044
98 Ga0307408_100002106 3300031548 Bacteria 14316
99 Ga0307408_100026810 3300031548 Bacteria 3964
100 Ga0307405_10040897 3300031731 Bacteria 2811
101 Ga0307406_10002574 3300031901 Bacteria 9878
102 Ga0307407_10005985 3300031903 Bacteria 5349
103 Ga0307412_10006224 3300031911 Bacteria 6733
104 Ga0307409_100002172 3300031995 Bacteria 10120
105 Ga0307416_100017124 3300032002 Bacteria 5058
106 Ga0307416_100018923 3300032002 Bacteria 4868
107 Ga0307416_100051709 3300032002 Bacteria 3284
108 Ga0307411_10001601 3300032005 Bacteria 9405
109 Ga0307415_100025343 3300032126 Bacteria 3719
110 Ga0373959_0002927 3300034820 Bacteria 2707
111 Ga0373938_0001303 3300034957 Bacteria 4007
112 Ga0373929_0001430 3300035085 Bacteria 4568
113 Ga0373940_0003215 3300035088 Bacteria 3304
114 Ga0373952_0000720 3300035092 Bacteria 5902
115 Ga0373932_0000921 3300035112 Bacteria 8598
116 Ga0373941_0007448 3300035115 Bacteria 2677
117 Ga0373953_0016809 3300035117 Bacteria 2677
118 Ga0373955_0002176 3300035172 Bacteria 8486
119 Ga0373942_0000066 3300035207 Bacteria 21966
120 Ga0373962_0002917 3300035242 Bacteria 4100
121 Ga0373937_0000143 3300036401 Bacteria 68812
122 Ga0373937_0070877 3300036401 Bacteria 3215
123 Ga0373937_0147948 3300036401 Bacteria 2199
124 Ga0451576_0029580 3300045051 Bacteria 5861
125 Ga0451576_0061366 3300045051 Bacteria 3920
126 Ga0495638_0006140 3300046460 Bacteria 8785
127 Ga0495664_0019861 3300046477 Bacteria 3869
128 Ga0495645_0005036 3300046543 Bacteria 9056
129 Ga0495635_0050939 3300046663 Bacteria 2854
130 Ga0495658_0004406 3300046683 Bacteria 6930
131 Ga0495636_0020002 3300047318 Bacteria 2695
132 Ga0496104_0117475 3300048907 Bacteria 2553
133 Ga0496107_0037469 3300048910 Bacteria 3480
134 Ga0496108_0024702 3300048911 Bacteria 4949
135 Ga0496108_0052575 3300048911 Bacteria 3414
136 Ga0496109_0008752 3300048912 Bacteria 8619
137 Ga0496112_0000175 3300048915 Bacteria 40859
138 Ga0496113_0063929 3300048916 Bacteria 2782
139 Ga0501031_0005155 3300049568 Bacteria 8516
140 Ga0501032_0012560 3300049569 Bacteria 6047
141 Ga0501032_0017207 3300049569 Bacteria 5077
142 Ga0501033_0002679 3300049570 Bacteria 14955
143 Ga0501033_0005935 3300049570 Bacteria 9586
144 Ga0501034_0131321 3300049571 Bacteria 2487
145 Ga0501036_0002624 3300049572 Bacteria 14176
146 Ga0501036_0003937 3300049572 Bacteria 11929
147 Ga0501036_0037369 3300049572 Bacteria 4108
148 Ga0501036_0067904 3300049572 Bacteria 3016
149 Ga0501038_0006635 3300049574 Bacteria 10705
150 Ga0501038_0007358 3300049574 Bacteria 10157
151 Ga0501039_0007462 3300049575 Bacteria 8348
152 Ga0501039_0022812 3300049575 Bacteria 4801
153 Ga0501043_0003170 3300049579 Bacteria 13603
154 Ga0501043_0005223 3300049579 Bacteria 10511
155 Ga0501043_0007806 3300049579 Bacteria 8458
156 Ga0501043_0055489 3300049579 Bacteria 3112
157 Ga0501043_0079110 3300049579 Bacteria 2583
158 Ga0501046_0005506 3300049580 Bacteria 11310
159 Ga0501046_0009144 3300049580 Bacteria 8583
160 Ga0501046_0023150 3300049580 Bacteria 5113
161 Ga0501047_0000522 3300049581 Bacteria 41607
162 Ga0501047_0005585 3300049581 Bacteria 11841
163 Ga0501047_0007940 3300049581 Bacteria 10008
164 Ga0501047_0071739 3300049581 Bacteria 3333
165 Ga0501048_0003448 3300049582 Bacteria 12019
166 Ga0501048_0010073 3300049582 Bacteria 7069
167 Ga0501069_0000376 3300049585 Bacteria 20152
168 Ga0501070_0044528 3300049586 Bacteria 3692
169 Ga0501071_0000913 3300049587 Bacteria 15972
170 Ga0501071_0011027 3300049587 Bacteria 6071
171 Ga0501073_0005319 3300049589 Bacteria 9652
172 Ga0501073_0015241 3300049589 Bacteria 5576
173 Ga0501074_0028954 3300049590 Bacteria 4012
174 Ga0501076_0097436 3300049592 Bacteria 2369
175 Ga0501079_0016885 3300049741 Bacteria 5574
176 Ga0501080_0019473 3300049742 Bacteria 6285
177 Ga0501080_0021183 3300049742 Bacteria 6016
178 Ga0501080_0045649 3300049742 Bacteria 4078
179 Ga0501080_0048226 3300049742 Bacteria 3964
180 Ga0501083_0006222 3300049744 Bacteria 8467
181 Ga0501035_0007578 3300049822 Bacteria 10142
182 Ga0501035_0027354 3300049822 Bacteria 5213
183 Ga0501044_0007969 3300049823 Bacteria 11637
184 Ga0501044_0030539 3300049823 Bacteria 5678
185 Ga0501044_0112807 3300049823 Bacteria 2725
186 Ga0501045_0095276 3300049824 Bacteria 2202
187 nmdc:mga05p37_22299_c1 3300050507 Bacteria 7679
188 nmdc:mga05p37_30967_c1 3300050507 Bacteria 6532
189 nmdc:mga05p37_56180_c1 3300050507 Bacteria 4846
190 nmdc:mga05p37_6762_c1 3300050507 Bacteria 13519
191 nmdc:mga05p37_731_c2 3300050507 Bacteria 8958
192 nmdc:mga09592_22800_c1 3300050508 Bacteria 5165
193 nmdc:mga08y16_17508_c1 3300050511 Bacteria 7547
194 nmdc:mga08y16_3987_c1 3300050511 Bacteria 15394
195 nmdc:mga08y16_3_c1 3300050511 Bacteria 936907
196 nmdc:mga0n895_118641_c1 3300050512 Bacteria 2666
197 nmdc:mga0n895_120105_c1 3300050512 Bacteria 2649
198 nmdc:mga0n895_335_c1 3300050512 Bacteria 31397
199 nmdc:mga0n895_5675_c1 3300050512 Bacteria 10459
200 nmdc:mga0rr50_16687_c1 3300050513 Bacteria 4884
201 nmdc:mga0rr50_52095_c1 3300050513 Bacteria 3040
202 nmdc:mga0rr50_60578_c1 3300050513 Bacteria 2848
203 nmdc:mga0rr50_961_c1 3300050513 Bacteria 15633
204 nmdc:mga08x19_27959_c1 3300050514 Bacteria 3530
205 nmdc:mga08x19_47985_c1 3300050514 Bacteria 2735
206 Ga0500616_0000321 3300053153 Bacteria 68888
207 Ga0500645_000067 3300053730 Bacteria 81846
208 Ga0501084_0011445 3300054114 Bacteria 7346
209 Ga0590071_000671 3300059421 Bacteria 9700
210 Ga0590074_001247 3300059423 Bacteria 4036
211 Ga0501082_0009486 3300060353 Bacteria 8379
212 Ga0501082_0117449 3300060353 Bacteria 2304
213 Ga0075434_100002076
214 Ga0065712_10005167
215 Ga0065715_10000664
216 Ga0065707_10001253
217 Ga0070670_100002501
218 Ga0070666_10017158
219 Ga0070660_100017609
220 Ga0070689_100047070
221 Ga0070691_10000430
222 Ga0070675_100000124
223 Ga0070675_100000290
224 Ga0070714_100026137
225 Ga0070701_10002099
226 Ga0070705_100000276
227 Ga0070694_100004247
228 Ga0070694_100071970
229 Ga0070708_100061800
230 Ga0070663_100041191
231 Ga0070686_100000823
232 Ga0070695_100000101
233 Ga0070696_100001806
234 Ga0070696_100005285
235 Ga0070665_100005220
236 Ga0070665_100005573
237 Ga0070665_100037254
238 Ga0070704_100040411
239 Ga0068855_100078970
240 Ga0070664_100016272
241 Ga0068857_100009819
242 Ga0068854_100043723
243 Ga0070702_100014650
244 Ga0068859_100057617
245 Ga0068864_100020051
246 Ga0068861_100064050
247 Ga0068858_100102147
248 Ga0068862_100047542
249 Ga0097621_100036371
250 Ga0068871_100012641
251 Ga0075428_100000010
252 Ga0075431_100002351
253 Ga0075434_100003792
254 Ga0075434_100014667
255 Ga0075434_100093149
256 Ga0075429_100003094
257 Ga0068865_100006421
258 Ga0075436_100020371
259 Ga0097620_100057617
260 Ga0075435_100005198
261 Ga0111539_10000001
262 Ga0111539_10001317
263 Ga0111539_10046836
264 Ga0111539_10060986
265 Ga0105245_10014704
266 Ga0105247_10010755
267 Ga0114129_10000186
268 Ga0114129_10014640
269 Ga0114129_10017117
270 Ga0114129_10041081
271 Ga0114129_10058166
272 Ga0114129_10069250
273 Ga0105242_10017371
274 Ga0105242_10054726
275 Ga0105242_10060691
276 Ga0105248_10035218
277 Ga0105248_10042812
278 Ga0157374_10062706
279 Ga0163163_10011009
280 Ga0157380_10004833
281 Ga0157377_10020929
282 Ga0157379_10045241
283 Ga0207680_10028759
284 Ga0207643_10036954
285 Ga0207705_10026913
286 Ga0207660_10037222
287 Ga0207657_10027030
288 Ga0207650_10063740
289 Ga0207659_10000371
290 Ga0207659_10000723
291 Ga0207659_10012625
292 Ga0207664_10022186
293 Ga0207706_10139896
294 Ga0207686_10006632
295 Ga0207711_10020593
296 Ga0207711_10059145
297 Ga0207689_10042386
298 Ga0207668_10056116
299 Ga0207678_10044428
300 Ga0207708_10002324
301 Ga0207708_10078666
302 Ga0207641_10002261
303 Ga0207674_10006834
304 Ga0207675_100009696
305 Ga0207675_100098045
306 Ga0207428_10000002
307 Ga0268266_10013675
308 Ga0268266_10032114
309 Ga0268266_10039039
310 Ga0307408_100002106
311 Ga0307408_100026810
312 Ga0307405_10040897
313 Ga0307406_10002574
314 Ga0307407_10005985
315 Ga0307412_10006224
316 Ga0307409_100002172
317 Ga0307416_100017124
318 Ga0307416_100018923
319 Ga0307416_100051709
320 Ga0307411_10001601
321 Ga0307415_100025343
322 Ga0373959_0002927
323 Ga0373938_0001303
324 Ga0373929_0001430
325 Ga0373940_0003215
326 Ga0373952_0000720
327 Ga0373932_0000921
328 Ga0373941_0007448
329 Ga0373953_0016809
330 Ga0373955_0002176
331 Ga0373942_0000066
332 Ga0373962_0002917
333 Ga0373937_0000143
334 Ga0373937_0070877
335 Ga0373937_0147948
336 Ga0451576_0029580
337 Ga0451576_0061366
338 Ga0495638_0006140
339 Ga0495664_0019861
340 Ga0495645_0005036
341 Ga0495635_0050939
342 Ga0495658_0004406
343 Ga0495636_0020002
344 Ga0496104_0117475
345 Ga0496107_0037469
346 Ga0496108_0024702
347 Ga0496108_0052575
348 Ga0496109_0008752
349 Ga0496112_0000175
350 Ga0496113_0063929
351 Ga0501031_0005155
352 Ga0501032_0012560
353 Ga0501032_0017207
354 Ga0501033_0002679
355 Ga0501033_0005935
356 Ga0501034_0131321
357 Ga0501036_0002624
358 Ga0501036_0003937
359 Ga0501036_0037369
360 Ga0501036_0067904
361 Ga0501038_0006635
362 Ga0501038_0007358
363 Ga0501039_0007462
364 Ga0501039_0022812
365 Ga0501043_0003170
366 Ga0501043_0005223
367 Ga0501043_0007806
368 Ga0501043_0055489
369 Ga0501043_0079110
370 Ga0501046_0005506
371 Ga0501046_0009144
372 Ga0501046_0023150
373 Ga0501047_0000522
374 Ga0501047_0005585
375 Ga0501047_0007940
376 Ga0501047_0071739
377 Ga0501048_0003448
378 Ga0501048_0010073
379 Ga0501069_0000376
380 Ga0501070_0044528
381 Ga0501071_0000913
382 Ga0501071_0011027
383 Ga0501073_0005319
384 Ga0501073_0015241
385 Ga0501074_0028954
386 Ga0501076_0097436
387 Ga0501079_0016885
388 Ga0501080_0019473
389 Ga0501080_0021183
390 Ga0501080_0045649
391 Ga0501080_0048226
392 Ga0501083_0006222
393 Ga0501035_0007578
394 Ga0501035_0027354
395 Ga0501044_0007969
396 Ga0501044_0030539
397 Ga0501044_0112807
398 Ga0501045_0095276
399 nmdc:mga05p37_22299_c1
400 nmdc:mga05p37_30967_c1
401 nmdc:mga05p37_56180_c1
402 nmdc:mga05p37_6762_c1
403 nmdc:mga05p37_731_c2
404 nmdc:mga09592_22800_c1
405 nmdc:mga08y16_17508_c1
406 nmdc:mga08y16_3987_c1
407 nmdc:mga08y16_3_c1
408 nmdc:mga0n895_118641_c1
409 nmdc:mga0n895_120105_c1
410 nmdc:mga0n895_335_c1
411 nmdc:mga0n895_5675_c1
412 nmdc:mga0rr50_16687_c1
413 nmdc:mga0rr50_52095_c1
414 nmdc:mga0rr50_60578_c1
415 nmdc:mga0rr50_961_c1
416 nmdc:mga08x19_27959_c1
417 nmdc:mga08x19_47985_c1
418 Ga0500616_0000321
419 Ga0500645_000067
420 Ga0501084_0011445
421 Ga0590071_000671
422 Ga0590074_001247
423 Ga0501082_0009486
424 Ga0501082_0117449

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09334

tRNA-synt_1g

tRNA synthetases class I (M)

4

148

0.98

PF01588

tRNA_bind

Putative tRNA binding domain

579

672

0.95

PF09334

tRNA-synt_1g

tRNA synthetases class I (M)

146

362

0.92

PF00133

tRNA-synt_1

tRNA synthetases class I (I, L, M and V)

217

338

0.85

PF00133

tRNA-synt_1

tRNA synthetases class I (I, L, M and V)

1

220

0.8

PF19303

Anticodon_3

Anticodon binding domain of methionyl tRNA ligase

374

497

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
4qrd-assembly1.cif.gz_A structure of methionyl-trna synthetase in complex with n-(1h-benzimidazol-2-ylmethyl)-n'-(2,4-dichlorophenyl)-6-(morpholin-4-yl)-1,3,5-triazine-2,4-diamine 0.9593 2 499
7wpi-assembly1.cif.gz_A methionyl-trna synthetase from staphylococcus aureus complexed with a phenylbenzimidazole inhibitor 0.9513 2 499
7d8r-assembly2.cif.gz_C mitf hlhlz structure 0.9496 530 633
7wpm-assembly1.cif.gz_A methionyl-trna synthetase from staphylococcus aureus complexed with a fragment and atp 0.9486 2 499
5k0t-assembly2.cif.gz_B crystal structure of methionyl-trna synthetase metrs from brucella melitensis in complex with inhibitor chem 1415 0.9444 2 500
ID Description Score Start End Superfamily
2x1lB02 Mainly Beta;Beta Complex;Methionyl-trna Synthetase; domain 2; 0.9642 154 221 2.170.220.10
4ppwA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9602 2 332 3.40.50.620
2ct8B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9582 2 332 3.40.50.620
2ct8B02 Mainly Beta;Beta Complex;Methionyl-trna Synthetase; domain 2; 0.9558 154 221 2.170.220.10
2csxB02 Mainly Beta;Beta Complex;Methionyl-trna Synthetase; domain 2; 0.9504 154 221 2.170.220.10
ID Description Score Start End GO Terms
AF-A0A7C2NBF9-F1-model_v4 Methionine--tRNA ligase 0.983 2 147 GO:0004825
GO:0005524
GO:0006431
AF-K2FUC3-F1-model_v4 Methionyl-tRNA synthetase alpha subunit (EC 6.1.1.10) 0.9801 2 233 GO:0004825
GO:0005524
GO:0006431
AF-A0A7V2T6P9-F1-model_v4 Methionine--tRNA ligase 0.9778 2 209 GO:0004825
GO:0005524
GO:0006431
AF-A0A418GTX4-F1-model_v4 deleted 0.9768 2 113
AF-A0A101EDW3-F1-model_v4 Methionine--tRNA ligase 0.975 2 281 GO:0004825
GO:0005524
GO:0006431

Map