F322637

General Info

Members Datasets Scaffolds Average Seq Length
212 153 200 189

Family's Representative Sequence

Representative Sequence 3300005843|Ga0068860_100803005|Ga0068860_1008030051
Length 216
Sequence MSGRRPAAAAPSPTARPVGRRPRRGAGALLLAPGAGSGRDHPALVAMEAAVAPLPVSRMDFPYRKAGRRAPDRAPVLLAAVRDEAAALVARAGIDADRLALGGRSMGGRMCSMAVAEGLPAAGLVFVSYPLHPPGRADRLRTDHFPALTVPCLFVQGDRDPFGTPDELRAALEAIPGPVTCEWIEGGRHDLKGADDRVAATVAAWLDDLGSPRRRR

Samples

Sample ID Description Type Environment
1 2643221613 Oerskovia sp. Root22 Isolate Unclassified
2 2643221721 Oerskovia sp. Root918 Isolate Unclassified
3 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
4 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
5 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
6 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
7 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
8 2808606394 Promicromonospora sp. C35 Isolate Unclassified
9 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
10 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
11 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
33 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
34 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
35 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
36 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
37 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
38 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
39 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
40 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
41 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
47 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
48 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
49 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
50 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
51 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
52 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
53 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
54 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
55 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
56 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
57 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
58 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
59 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
60 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
61 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
62 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
63 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
64 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
65 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
66 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
67 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
68 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
69 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
70 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
71 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
72 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
73 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
74 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
75 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
76 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
77 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
78 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
79 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
80 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
81 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
82 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
83 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
84 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
85 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
86 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
87 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
88 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
89 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
90 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
91 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
92 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
93 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
94 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
95 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
96 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
97 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
98 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
99 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
100 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
101 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
102 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
103 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
104 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
105 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
106 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
107 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
108 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
109 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
110 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
111 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
112 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
126 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
127 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
128 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
129 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
130 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
131 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
132 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
133 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
134 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
135 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
136 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
137 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
138 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
139 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
141 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
142 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
143 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
144 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
145 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
146 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
147 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
148 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
149 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
150 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
151 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
152 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
153 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.34
Metatranscriptomes 0
Isolates 5.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.42
Nodule 0
Rhizoplane 11.79
Rhizosphere 78.77
Stem 0
Stem Tuber 0
Unclassified 8.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070690_100701744 3300005330 Unclassified 777
2 Ga0070682_100249407 3300005337 Bacteria 1279
3 Ga0070682_100365151 3300005337 Bacteria 1081
4 Ga0068868_100303619 3300005338 Unclassified 1356
5 Ga0070673_100488957 3300005364 Bacteria 1112
6 Ga0070714_100009683 3300005435 Bacteria 7589
7 Ga0070713_100524660 3300005436 Bacteria 1119
8 Ga0070708_100053905 3300005445 Bacteria 3570
9 Ga0070678_100334961 3300005456 Unclassified 1296
10 Ga0070685_10134675 3300005466 Bacteria 1548
11 Ga0068853_100588381 3300005539 Bacteria 1056
12 Ga0068855_100959393 3300005563 Bacteria 900
13 Ga0068860_100803005 3300005843 Bacteria 954
14 Ga0081455_10003165 3300005937 Bacteria 19113
15 Ga0081538_10005454 3300005981 Bacteria 11422
16 Ga0081538_10014257 3300005981 Bacteria 6232
17 Ga0075428_100000002 3300006844 Bacteria 546374
18 Ga0075428_100857787 3300006844 Bacteria 964
19 Ga0075429_100071650 3300006880 Bacteria 3018
20 Ga0111539_10016220 3300009094 Bacteria 9240
21 Ga0111539_11058177 3300009094 Bacteria 943
22 Ga0105245_10058978 3300009098 Bacteria 3455
23 Ga0105245_10079244 3300009098 Bacteria 2999
24 Ga0105245_10102894 3300009098 Bacteria 2645
25 Ga0105245_10168437 3300009098 Bacteria 2084
26 Ga0114129_10050165 3300009147 Bacteria 5862
27 Ga0105239_10089060 3300010375 Bacteria 3403
28 Ga0105239_10312551 3300010375 Unclassified 1771
29 Ga0157369_10955109 3300013105 Unclassified 878
30 Ga0157374_10140958 3300013296 Bacteria 2340
31 Ga0157374_11263023 3300013296 Bacteria 760
32 Ga0157372_11189092 3300013307 Bacteria 881
33 Ga0157375_10629842 3300013308 Bacteria 1230
34 Ga0157375_10855993 3300013308 Bacteria 1055
35 Ga0157380_10627687 3300014326 Bacteria 1068
36 Ga0157379_10793650 3300014968 Bacteria 893
37 Ga0157376_10223002 3300014969 Bacteria 1747
38 Ga0213873_10010874 3300021358 Bacteria 1931
39 Ga0213876_10000905 3300021384 Bacteria 19751
40 Ga0207687_10027883 3300025927 Bacteria 3791
41 Ga0207686_10552860 3300025934 Bacteria 900
42 Ga0207667_10970461 3300025949 Bacteria 838
43 Ga0207676_10644425 3300026095 Bacteria 1022
44 Ga0207683_10732818 3300026121 Bacteria 917
45 Ga0316179_1036191 3300030734 Bacteria 1097
46 Ga0307405_10079019 3300031731 Bacteria 2143
47 Ga0307413_10026536 3300031824 Bacteria 3194
48 Ga0307410_10074276 3300031852 Bacteria 2367
49 Ga0307410_10134305 3300031852 Bacteria 1822
50 Ga0307407_10043471 3300031903 Bacteria 2526
51 Ga0307409_100674242 3300031995 Bacteria 1030
52 Ga0307416_100555674 3300032002 Bacteria 1222
53 Ga0307414_10024641 3300032004 Bacteria 3841
54 Ga0316580_10136359 3300032139 Bacteria 753
55 Ga0373961_0091958 3300035241 Bacteria 970
56 Ga0316574_0340874 3300035398 Bacteria 949
57 Ga0316574_0403622 3300035398 Bacteria 860
58 Ga0316584_0132733 3300036712 Bacteria 1859
59 Ga0436365_0025930 3300039437 Bacteria 22565
60 Ga0436360_0884963 3300039438 Bacteria 8902
61 Ga0436361_0582715 3300039447 Bacteria 4740
62 Ga0436362_0401549 3300039453 Bacteria 2759
63 Ga0436362_1070999 3300039453 Bacteria 4142
64 Ga0451787_657344 3300041441 Bacteria 1177
65 Ga0451791_0192741 3300041451 Bacteria 3167
66 Ga0451793_0467651 3300041452 Bacteria 4152
67 Ga0451797_1048305 3300041453 Bacteria 1877
68 Ga0451802_1994534 3300041460 Bacteria 1719
69 Ga0451807_2207893 3300041486 Bacteria 727
70 Ga0451837_1460135 3300041494 Bacteria 1668
71 Ga0451839_1279899 3300041496 Bacteria 988
72 Ga0451849_0560255 3300041505 Bacteria 1141
73 Ga0451855_1708312 3300041511 Bacteria 858
74 Ga0451853_0359350 3300041512 Bacteria 2592
75 Ga0439431_0033048 3300041997 Bacteria 1292
76 Ga0439448_0009802 3300042005 Bacteria 2829
77 Ga0439451_013316 3300042009 Bacteria 1663
78 Ga0439444_0001887 3300042437 Bacteria 2791
79 Ga0439464_0003968 3300042439 Bacteria 3764
80 Ga0439460_0007044 3300042461 Bacteria 2804
81 Ga0466966_0072309 3300044684 Unclassified 2160
82 Ga0466960_0003820 3300044901 Bacteria 5838
83 Ga0495627_003684 3300046453 Bacteria 6643
84 Ga0495603_0255152 3300046455 Bacteria 1010
85 Ga0495603_0537425 3300046455 Bacteria 669
86 Ga0495629_0083195 3300046459 Bacteria 2234
87 Ga0495629_0129878 3300046459 Bacteria 1755
88 Ga0495608_0306435 3300046511 Bacteria 983
89 Ga0495618_0058268 3300046514 Bacteria 2446
90 Ga0495628_0395822 3300046516 Bacteria 1010
91 Ga0495628_0626556 3300046516 Unclassified 766
92 Ga0495665_0176151 3300046531 Bacteria 1112
93 Ga0495640_0082021 3300046533 Bacteria 2143
94 Ga0495640_0281441 3300046533 Bacteria 1036
95 Ga0495586_0013791 3300046535 Bacteria 4288
96 Ga0495621_0066789 3300046539 Bacteria 1316
97 Ga0495645_0152213 3300046543 Bacteria 1606
98 Ga0495667_0229797 3300046559 Bacteria 1183
99 Ga0495634_0021920 3300046642 Bacteria 4506
100 Ga0495635_0219303 3300046663 Bacteria 1287
101 Ga0495635_0945286 3300046663 Bacteria 550
102 Ga0495658_0140214 3300046683 Bacteria 1478
103 Ga0495658_0432762 3300046683 Bacteria 840
104 Ga0495613_0134610 3300046689 Bacteria 1768
105 Ga0495589_0275573 3300046794 Bacteria 783
106 Ga0495674_0382904 3300047319 Bacteria 1138
107 Ga0495674_0540772 3300047319 Bacteria 928
108 Ga0495676_0335482 3300047321 Bacteria 1013
109 Ga0495602_0508537 3300048088 Bacteria 841
110 Ga0496101_0600540 3300048904 Unclassified 870
111 Ga0496102_0043133 3300048905 Bacteria 4089
112 Ga0496102_0227741 3300048905 Bacteria 1758
113 Ga0496102_0772716 3300048905 Bacteria 883
114 Ga0496102_0855069 3300048905 Bacteria 832
115 Ga0496104_0009842 3300048907 Bacteria 8529
116 Ga0496105_0079974 3300048908 Bacteria 2699
117 Ga0496108_0002153 3300048911 Bacteria 15773
118 Ga0496109_0334448 3300048912 Bacteria 1430
119 Ga0496110_0000942 3300048913 Bacteria 20410
120 Ga0496110_0232011 3300048913 Bacteria 1679
121 Ga0496111_0000475 3300048914 Bacteria 20496
122 Ga0496113_0054998 3300048916 Bacteria 2982
123 Ga0496114_0006739 3300048917 Bacteria 9047
124 Ga0496114_0136824 3300048917 Bacteria 2119
125 Ga0496114_0172961 3300048917 Bacteria 1883
126 Ga0496114_0402427 3300048917 Bacteria 1212
127 Ga0496114_0658004 3300048917 Bacteria 921
128 Ga0496114_1041747 3300048917 Bacteria 702
129 Ga0496126_0026937 3300048929 Bacteria 5502
130 Ga0501032_0296689 3300049569 Bacteria 1045
131 Ga0501033_0038645 3300049570 Bacteria 3566
132 Ga0501034_0000445 3300049571 Bacteria 68416
133 Ga0501036_0001516 3300049572 Bacteria 17918
134 Ga0501037_0174108 3300049573 Bacteria 1529
135 Ga0501038_0419893 3300049574 Bacteria 1032
136 Ga0501039_0032678 3300049575 Bacteria 4012
137 Ga0501039_0638541 3300049575 Bacteria 834
138 Ga0501039_0723287 3300049575 Bacteria 778
139 Ga0501040_0044997 3300049576 Bacteria 3010
140 Ga0501040_0116396 3300049576 Bacteria 1872
141 Ga0501040_0335025 3300049576 Bacteria 1083
142 Ga0501041_0006051 3300049577 Bacteria 7080
143 Ga0501042_0040512 3300049578 Bacteria 3312
144 Ga0501042_0184494 3300049578 Bacteria 1505
145 Ga0501046_0010980 3300049580 Bacteria 7764
146 Ga0501046_0183831 3300049580 Bacteria 1562
147 Ga0501047_0411283 3300049581 Bacteria 1185
148 Ga0501048_0378098 3300049582 Bacteria 1011
149 Ga0501067_0063373 3300049583 Bacteria 2047
150 Ga0501068_0029634 3300049584 Bacteria 3242
151 Ga0501068_0093269 3300049584 Bacteria 1860
152 Ga0501069_0000009 3300049585 Bacteria 175166
153 Ga0501070_0000006 3300049586 Bacteria 226569
154 Ga0501071_0033829 3300049587 Bacteria 3633
155 Ga0501072_0015594 3300049588 Bacteria 5824
156 Ga0501072_0030197 3300049588 Bacteria 4237
157 Ga0501072_0046932 3300049588 Bacteria 3401
158 Ga0501074_0016108 3300049590 Bacteria 5433
159 Ga0501074_0228144 3300049590 Bacteria 1326
160 Ga0501075_0007829 3300049591 Bacteria 7420
161 Ga0501075_0088199 3300049591 Bacteria 2352
162 Ga0501075_0144492 3300049591 Bacteria 1813
163 Ga0501076_0002025 3300049592 Bacteria 13874
164 Ga0501076_0043339 3300049592 Bacteria 3545
165 Ga0501076_0313380 3300049592 Bacteria 1287
166 Ga0501076_0499197 3300049592 Bacteria 1003
167 Ga0501077_0002324 3300049593 Bacteria 11446
168 Ga0501077_0356043 3300049593 Bacteria 934
169 Ga0501079_0109878 3300049741 Bacteria 2142
170 Ga0501079_0162139 3300049741 Bacteria 1744
171 Ga0501079_0350019 3300049741 Bacteria 1157
172 Ga0501079_0641466 3300049741 Bacteria 836
173 Ga0501080_0008573 3300049742 Bacteria 9273
174 Ga0501080_0055666 3300049742 Bacteria 3684
175 Ga0501080_0213532 3300049742 Bacteria 1768
176 Ga0501080_0471603 3300049742 Bacteria 1124
177 Ga0501080_0498850 3300049742 Bacteria 1088
178 Ga0501081_0008870 3300049743 Bacteria 6536
179 Ga0501081_0127135 3300049743 Bacteria 1819
180 Ga0501083_0365467 3300049744 Bacteria 938
181 Ga0501044_0393359 3300049823 Bacteria 1300
182 Ga0501044_0783581 3300049823 Bacteria 834
183 Ga0501045_0020109 3300049824 Bacteria 4766
184 Ga0501045_0334759 3300049824 Bacteria 1126
185 nmdc:mga0yw44_184674_c1 3300050492 Bacteria 1373
186 nmdc:mga05p37_925_c1 3300050507 Bacteria 33139
187 nmdc:mga09592_850_c1 3300050508 Bacteria 23768
188 nmdc:mga0qj67_464_c1 3300050509 Bacteria 27776
189 nmdc:mga06r32_149745_c1 3300050510 Bacteria 2312
190 nmdc:mga06r32_3831_c1 3300050510 Bacteria 13463
191 nmdc:mga0n895_1422018_c1 3300050512 Unclassified 661
192 Ga0495619_0443757 3300053085 Unclassified 895
193 Ga0500566_0118174 3300053094 Bacteria 1433
194 Ga0500616_0022339 3300053153 Bacteria 3533
195 Ga0501084_0005700 3300054114 Bacteria 10233
196 Ga0501084_0383273 3300054114 Bacteria 1188
197 Ga0501082_0004669 3300060353 Bacteria 11955
198 Ga0501082_0039992 3300060353 Bacteria 4046
199 Ga0530510_0002179 3300061734 Bacteria 13431
200 Ga0530510_0016001 3300061734 Bacteria 5302

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300010375 Ga0105239_10089060 Ga0105239_100890605 132
2 3300013307 Ga0157372_11189092 Ga0157372_111890921 132
3 3300048905 Ga0496102_0772716 Ga0496102_0772716_295_774 132
4 3300050512 nmdc:mga0n895_1422018_c1 nmdc:mga0n895_1422018_c1_81_560 132
5 3300048904 Ga0496101_0600540 Ga0496101_0600540_334_825 140
6 3300046663 Ga0495635_0945286 Ga0495635_0945286_97_540 147
7 3300046516 Ga0495628_0626556 Ga0495628_0626556_141_752 149
8 3300046794 Ga0495589_0275573 Ga0495589_0275573_116_631 157
9 3300005937 Ga0081455_10003165 Ga0081455_1000316510 158
10 3300048917 Ga0496114_0136824 Ga0496114_0136824_653_1216 163
11 3300005364 Ga0070673_100488957 Ga0070673_1004889571 168
12 3300009094 Ga0111539_11058177 Ga0111539_110581772 168
13 3300009098 Ga0105245_10168437 Ga0105245_101684372 168
14 3300005435 Ga0070714_100009683 Ga0070714_1000096835 170
15 3300005563 Ga0068855_100959393 Ga0068855_1009593932 170
16 3300013105 Ga0157369_10955109 Ga0157369_109551091 170
17 3300025949 Ga0207667_10970461 Ga0207667_109704612 170
18 3300044684 Ga0466966_0072309 Ga0466966_0072309_443_1063 171
19 3300046511 Ga0495608_0306435 Ga0495608_0306435_279_824 171
20 3300047321 Ga0495676_0335482 Ga0495676_0335482_351_896 171
21 3300048088 Ga0495602_0508537 Ga0495602_0508537_61_606 171
22 3300049569 Ga0501032_0296689 Ga0501032_0296689_124_705 171
23 3300049570 Ga0501033_0038645 Ga0501033_0038645_124_705 171
24 3300049572 Ga0501036_0001516 Ga0501036_0001516_9109_9690 171
25 3300049573 Ga0501037_0174108 Ga0501037_0174108_589_1170 171
26 3300049575 Ga0501039_0032678 Ga0501039_0032678_1687_2268 171
27 3300049576 Ga0501040_0116396 Ga0501040_0116396_1072_1653 171
28 3300049577 Ga0501041_0006051 Ga0501041_0006051_4496_5077 171
29 3300049580 Ga0501046_0010980 Ga0501046_0010980_814_1395 171
30 3300049584 Ga0501068_0029634 Ga0501068_0029634_1283_1864 171
31 3300049588 Ga0501072_0015594 Ga0501072_0015594_265_846 171
32 3300049590 Ga0501074_0016108 Ga0501074_0016108_2863_3444 171
33 3300049591 Ga0501075_0007829 Ga0501075_0007829_2830_3411 171
34 3300049592 Ga0501076_0002025 Ga0501076_0002025_5045_5626 171
35 3300049593 Ga0501077_0002324 Ga0501077_0002324_7974_8555 171
36 3300049741 Ga0501079_0350019 Ga0501079_0350019_323_904 171
37 3300049742 Ga0501080_0213532 Ga0501080_0213532_224_805 171
38 3300049743 Ga0501081_0008870 Ga0501081_0008870_5596_6177 171
39 3300049744 Ga0501083_0365467 Ga0501083_0365467_124_705 171
40 3300049824 Ga0501045_0020109 Ga0501045_0020109_111_692 171
41 3300054114 Ga0501084_0005700 Ga0501084_0005700_25_606 171
42 3300060353 Ga0501082_0004669 Ga0501082_0004669_10700_11281 171
43 3300061734 Ga0530510_0002179 Ga0530510_0002179_9533_10114 171
44 3300005445 Ga0070708_100053905 Ga0070708_1000539054 172
45 3300049592 Ga0501076_0499197 Ga0501076_0499197_127_675 172
46 iso_pu_bacteria 2758568522 2760304996 172
47 iso_pu_bacteria 8056579771 8056579937 172
48 3300050507 nmdc:mga05p37_925_c1 nmdc:mga05p37_925_c1_9694_10263 173
49 3300050508 nmdc:mga09592_850_c1 nmdc:mga09592_850_c1_20118_20687 173
50 3300050509 nmdc:mga0qj67_464_c1 nmdc:mga0qj67_464_c1_18126_18695 173
51 3300050510 nmdc:mga06r32_3831_c1 nmdc:mga06r32_3831_c1_3813_4382 173
52 iso_pu_bacteria 2738541272 2738697092 173
53 iso_pu_bacteria 2738543027 2739324264 173
54 iso_pu_bacteria 2739367654 2739607102 173
55 iso_pu_bacteria 2808606394 2809025975 173
56 3300026121 Ga0207683_10732818 Ga0207683_107328182 174
57 3300031852 Ga0307410_10134305 Ga0307410_101343053 174
58 3300032002 Ga0307416_100555674 Ga0307416_1005556743 174
59 3300032004 Ga0307414_10024641 Ga0307414_100246414 174
60 3300048905 Ga0496102_0855069 Ga0496102_0855069_240_803 174
61 3300049585 Ga0501069_0000009 Ga0501069_0000009_9603_10169 174
62 3300049586 Ga0501070_0000006 Ga0501070_0000006_198155_198721 174
63 3300049587 Ga0501071_0033829 Ga0501071_0033829_2396_2962 174
64 3300049590 Ga0501074_0228144 Ga0501074_0228144_643_1209 174
65 3300049742 Ga0501080_0008573 Ga0501080_0008573_7492_8058 174
66 3300005337 Ga0070682_100249407 Ga0070682_1002494072 175
67 3300005456 Ga0070678_100334961 Ga0070678_1003349612 175
68 3300009098 Ga0105245_10079244 Ga0105245_100792443 175
69 3300009098 Ga0105245_10102894 Ga0105245_101028942 175
70 3300014326 Ga0157380_10627687 Ga0157380_106276871 175
71 3300014969 Ga0157376_10223002 Ga0157376_102230023 175
72 3300026095 Ga0207676_10644425 Ga0207676_106444251 175
73 3300030734 Ga0316179_1036191 Ga0316179_10361912 175
74 3300032139 Ga0316580_10136359 Ga0316580_101363592 175
75 3300035398 Ga0316574_0403622 Ga0316574_0403622_199_756 175
76 3300036712 Ga0316584_0132733 Ga0316584_0132733_1271_1828 175
77 3300039438 Ga0436360_0884963 Ga0436360_0884963_1667_2239 175
78 3300039447 Ga0436361_0582715 Ga0436361_0582715_3746_4318 175
79 3300039453 Ga0436362_0401549 Ga0436362_0401549_2091_2663 175
80 3300041441 Ga0451787_657344 Ga0451787_657344_495_1070 175
81 3300041451 Ga0451791_0192741 Ga0451791_0192741_2078_2653 175
82 3300041452 Ga0451793_0467651 Ga0451793_0467651_2541_3116 175
83 3300041453 Ga0451797_1048305 Ga0451797_1048305_650_1225 175
84 3300041460 Ga0451802_1994534 Ga0451802_1994534_824_1399 175
85 3300041486 Ga0451807_2207893 Ga0451807_2207893_127_702 175
86 3300041494 Ga0451837_1460135 Ga0451837_1460135_470_1045 175
87 3300041496 Ga0451839_1279899 Ga0451839_1279899_125_700 175
88 3300041505 Ga0451849_0560255 Ga0451849_0560255_277_852 175
89 3300041511 Ga0451855_1708312 Ga0451855_1708312_133_708 175
90 3300041512 Ga0451853_0359350 Ga0451853_0359350_1342_1917 175
91 3300044901 Ga0466960_0003820 Ga0466960_0003820_266_826 175
92 3300046453 Ga0495627_003684 Ga0495627_003684_854_1432 175
93 3300046455 Ga0495603_0255152 Ga0495603_0255152_150_704 175
94 3300046459 Ga0495629_0083195 Ga0495629_0083195_471_1025 175
95 3300046533 Ga0495640_0281441 Ga0495640_0281441_345_911 175
96 3300047319 Ga0495674_0382904 Ga0495674_0382904_509_1075 175
97 3300048905 Ga0496102_0227741 Ga0496102_0227741_769_1371 175
98 3300048917 Ga0496114_0658004 Ga0496114_0658004_255_830 175
99 iso_pu_bacteria 2643221613 2644082590 175
100 iso_pu_bacteria 2643221721 2644665449 175
101 iso_pu_bacteria 2758568621 2760621174 175
102 iso_pu_bacteria 2932431166 2932431182 175
103 iso_pu_bacteria 2935890801 2935892964 175
104 3300005337 Ga0070682_100365151 Ga0070682_1003651512 176
105 3300005466 Ga0070685_10134675 Ga0070685_101346752 176
106 3300005981 Ga0081538_10005454 Ga0081538_100054544 176
107 3300005981 Ga0081538_10014257 Ga0081538_100142576 176
108 3300006880 Ga0075429_100071650 Ga0075429_1000716504 176
109 3300009094 Ga0111539_10016220 Ga0111539_100162202 176
110 3300009147 Ga0114129_10050165 Ga0114129_100501656 176
111 3300013296 Ga0157374_11263023 Ga0157374_112630232 176
112 3300013308 Ga0157375_10629842 Ga0157375_106298422 176
113 3300021358 Ga0213873_10010874 Ga0213873_100108742 176
114 3300035398 Ga0316574_0340874 Ga0316574_0340874_278_841 176
115 3300039453 Ga0436362_1070999 Ga0436362_1070999_2519_3088 176
116 3300041997 Ga0439431_0033048 Ga0439431_0033048_162_767 176
117 3300042005 Ga0439448_0009802 Ga0439448_0009802_1825_2397 176
118 3300042009 Ga0439451_013316 Ga0439451_013316_627_1199 176
119 3300042437 Ga0439444_0001887 Ga0439444_0001887_1856_2428 176
120 3300042439 Ga0439464_0003968 Ga0439464_0003968_1193_1765 176
121 3300042461 Ga0439460_0007044 Ga0439460_0007044_2147_2719 176
122 3300046455 Ga0495603_0537425 Ga0495603_0537425_68_631 176
123 3300046531 Ga0495665_0176151 Ga0495665_0176151_182_805 176
124 3300046543 Ga0495645_0152213 Ga0495645_0152213_455_1078 176
125 3300046559 Ga0495667_0229797 Ga0495667_0229797_145_738 176
126 3300046663 Ga0495635_0219303 Ga0495635_0219303_443_1066 176
127 3300046683 Ga0495658_0432762 Ga0495658_0432762_186_809 176
128 3300047319 Ga0495674_0540772 Ga0495674_0540772_161_784 176
129 3300048905 Ga0496102_0043133 Ga0496102_0043133_3393_4016 176
130 3300048907 Ga0496104_0009842 Ga0496104_0009842_6609_7232 176
131 3300048908 Ga0496105_0079974 Ga0496105_0079974_1646_2269 176
132 3300048911 Ga0496108_0002153 Ga0496108_0002153_13231_13854 176
133 3300048912 Ga0496109_0334448 Ga0496109_0334448_482_1063 176
134 3300048913 Ga0496110_0000942 Ga0496110_0000942_11374_11997 176
135 3300048914 Ga0496111_0000475 Ga0496111_0000475_17653_18276 176
136 3300048916 Ga0496113_0054998 Ga0496113_0054998_1118_1741 176
137 3300048917 Ga0496114_0006739 Ga0496114_0006739_7122_7703 176
138 3300048917 Ga0496114_0172961 Ga0496114_0172961_502_1125 176
139 3300048917 Ga0496114_0402427 Ga0496114_0402427_40_621 176
140 3300048929 Ga0496126_0026937 Ga0496126_0026937_4816_5415 176
141 3300049571 Ga0501034_0000445 Ga0501034_0000445_60853_61425 176
142 3300049574 Ga0501038_0419893 Ga0501038_0419893_212_805 176
143 3300049575 Ga0501039_0723287 Ga0501039_0723287_137_709 176
144 3300049576 Ga0501040_0044997 Ga0501040_0044997_1994_2587 176
145 3300049576 Ga0501040_0335025 Ga0501040_0335025_108_680 176
146 3300049578 Ga0501042_0184494 Ga0501042_0184494_694_1287 176
147 3300049581 Ga0501047_0411283 Ga0501047_0411283_517_1080 176
148 3300049582 Ga0501048_0378098 Ga0501048_0378098_251_844 176
149 3300049584 Ga0501068_0093269 Ga0501068_0093269_1197_1790 176
150 3300049588 Ga0501072_0030197 Ga0501072_0030197_1688_2260 176
151 3300049591 Ga0501075_0088199 Ga0501075_0088199_1541_2113 176
152 3300049591 Ga0501075_0144492 Ga0501075_0144492_445_1038 176
153 3300049592 Ga0501076_0043339 Ga0501076_0043339_1756_2349 176
154 3300049592 Ga0501076_0313380 Ga0501076_0313380_652_1224 176
155 3300049593 Ga0501077_0356043 Ga0501077_0356043_116_709 176
156 3300049741 Ga0501079_0109878 Ga0501079_0109878_1094_1687 176
157 3300049741 Ga0501079_0162139 Ga0501079_0162139_219_791 176
158 3300049743 Ga0501081_0127135 Ga0501081_0127135_218_790 176
159 3300049823 Ga0501044_0393359 Ga0501044_0393359_340_933 176
160 3300049823 Ga0501044_0783581 Ga0501044_0783581_16_588 176
161 3300049824 Ga0501045_0334759 Ga0501045_0334759_127_720 176
162 3300050492 nmdc:mga0yw44_184674_c1 nmdc:mga0yw44_184674_c1_71_634 176
163 3300050510 nmdc:mga06r32_149745_c1 nmdc:mga06r32_149745_c1_27_599 176
164 3300053085 Ga0495619_0443757 Ga0495619_0443757_187_789 176
165 3300054114 Ga0501084_0383273 Ga0501084_0383273_146_739 176
166 3300060353 Ga0501082_0039992 Ga0501082_0039992_1596_2189 176
167 3300061734 Ga0530510_0016001 Ga0530510_0016001_1637_2209 176
168 iso_pu_bacteria 2839986021 2839987500 176
169 3300005330 Ga0070690_100701744 Ga0070690_1007017441 177
170 3300005338 Ga0068868_100303619 Ga0068868_1003036192 177
171 3300005436 Ga0070713_100524660 Ga0070713_1005246601 177
172 3300005539 Ga0068853_100588381 Ga0068853_1005883812 177
173 3300005843 Ga0068860_100803005 Ga0068860_1008030051 177
174 3300006844 Ga0075428_100000002 Ga0075428_10000000259 177
175 3300006844 Ga0075428_100857787 Ga0075428_1008577872 177
176 3300009098 Ga0105245_10058978 Ga0105245_100589784 177
177 3300010375 Ga0105239_10312551 Ga0105239_103125511 177
178 3300013296 Ga0157374_10140958 Ga0157374_101409583 177
179 3300013308 Ga0157375_10855993 Ga0157375_108559932 177
180 3300014968 Ga0157379_10793650 Ga0157379_107936501 177
181 3300021384 Ga0213876_10000905 Ga0213876_1000090515 177
182 3300025927 Ga0207687_10027883 Ga0207687_100278832 177
183 3300025934 Ga0207686_10552860 Ga0207686_105528602 177
184 3300031731 Ga0307405_10079019 Ga0307405_100790192 177
185 3300031824 Ga0307413_10026536 Ga0307413_100265363 177
186 3300031852 Ga0307410_10074276 Ga0307410_100742763 177
187 3300031903 Ga0307407_10043471 Ga0307407_100434713 177
188 3300031995 Ga0307409_100674242 Ga0307409_1006742421 177
189 3300035241 Ga0373961_0091958 Ga0373961_0091958_148_684 177
190 3300039437 Ga0436365_0025930 Ga0436365_0025930_19749_20330 177
191 3300046459 Ga0495629_0129878 Ga0495629_0129878_897_1430 177
192 3300046514 Ga0495618_0058268 Ga0495618_0058268_1462_1995 177
193 3300046516 Ga0495628_0395822 Ga0495628_0395822_381_914 177
194 3300046533 Ga0495640_0082021 Ga0495640_0082021_1181_1714 177
195 3300046535 Ga0495586_0013791 Ga0495586_0013791_3542_4075 177
196 3300046539 Ga0495621_0066789 Ga0495621_0066789_754_1290 177
197 3300046642 Ga0495634_0021920 Ga0495634_0021920_2893_3426 177
198 3300046683 Ga0495658_0140214 Ga0495658_0140214_247_780 177
199 3300046689 Ga0495613_0134610 Ga0495613_0134610_1175_1708 177
200 3300048913 Ga0496110_0232011 Ga0496110_0232011_44_607 177
201 3300048917 Ga0496114_1041747 Ga0496114_1041747_119_682 177
202 3300049575 Ga0501039_0638541 Ga0501039_0638541_182_778 177
203 3300049578 Ga0501042_0040512 Ga0501042_0040512_728_1321 177
204 3300049580 Ga0501046_0183831 Ga0501046_0183831_307_903 177
205 3300049583 Ga0501067_0063373 Ga0501067_0063373_58_639 177
206 3300049588 Ga0501072_0046932 Ga0501072_0046932_1131_1712 177
207 3300049741 Ga0501079_0641466 Ga0501079_0641466_104_718 177
208 3300049742 Ga0501080_0055666 Ga0501080_0055666_2988_3569 177
209 3300049742 Ga0501080_0471603 Ga0501080_0471603_58_639 177
210 3300049742 Ga0501080_0498850 Ga0501080_0498850_450_1031 177
211 3300053094 Ga0500566_0118174 Ga0500566_0118174_468_1001 177
212 3300053153 Ga0500616_0022339 Ga0500616_0022339_699_1265 177

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20408

Abhydrolase_11

Alpha/beta hydrolase domain

25

208

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7q4j-assembly1.cif.gz_B a thermostable lipase from thermoanaerobacter thermohydrosulfuricus in complex a monoacylglycerol intermediate 0.8238 2 176
5lcn-assembly2.cif.gz_D structure of the pyrococcus furiosus esterase pf2001 with space group p212121 0.8214 3 176
5lcn-assembly1.cif.gz_C structure of the pyrococcus furiosus esterase pf2001 with space group p212121 0.8206 3 176
8b4u-assembly1.cif.gz_A the crystal structure of pet46, a petase enzyme from candidatus bathyarchaeota 0.8197 2 177
4ke8-assembly3.cif.gz_C crystal structure of monoglyceride lipase from bacillus sp. h257 in complex with monopalmitoyl glycerol analogue 0.8194 3 176
ID Description Score Start End Superfamily
af_Q5JUR7_11_206_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8885 2 166 3.40.50.1820
af_I1K6A2_1_89_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8871 86 160 3.40.50.1820
af_A0A2R8RQ35_2_224_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8867 2 177 3.40.50.1820
af_A0A2R8RQ35_2_224_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8772 2 177 3.40.50.1820
af_P96267_2_202_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8736 1 173 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A520Y5B1-F1-model_v4 Dienelactone hydrolase 0.9785 2 173 GO:0016787
AF-A0A6J7NAF8-F1-model_v4 Unannotated protein 0.9773 7 174
AF-A0A388NWG1-F1-model_v4 KANL3/Tex30 alpha/beta hydrolase-like domain-containing protein 0.9772 3 177
AF-A0A7Y2Q306-F1-model_v4 deleted 0.977 3 173
AF-A0A0Q5IS39-F1-model_v4 Dienelactone hydrolase 0.9758 3 177 GO:0016787

Feature Viewer

pLDDT pTM Quality
97.56 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map