F322604

General Info

Members Datasets Scaffolds Average Seq Length
212 151 424 183

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100432132|Ga0068855_1004321322
Length 161
Sequence MRKVIVAVQVSIDGIMGGENADFWKQLFAFHSADVEKYLLDLLFEPDALLIGRKTYEGFAKVWPSRQGKMAEKINSMPKYVASRTPKTPLQWNLQYGVGELTHTMLKDGLVDEFRVLVYPFVFGEGLRVFERMGVQTLKLLDTKRFSSDVVALHYQPQKPA

Samples

Sample ID Description Type Environment
1 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
120 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
121 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
122 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
123 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
124 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
125 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
126 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
127 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
128 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
129 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
130 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
131 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
132 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
136 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
137 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
138 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
139 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
140 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
141 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
142 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
143 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
144 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
145 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
146 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
147 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
148 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
149 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
150 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
151 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.06
Metatranscriptomes 0.94
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.77
Nodule 0
Rhizoplane 1.42
Rhizosphere 92.92
Stem 0
Stem Tuber 0
Unclassified 34.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068855_100432132 3300005563 Bacteria 1439
2 rootH1_10310152 3300003323 Bacteria 1262
3 Ga0058859_11340626 3300004798 Unclassified 1072
4 Ga0065704_10001292 3300005289 Bacteria 11076
5 Ga0065712_10230290 3300005290 Bacteria 1013
6 Ga0065712_10557665 3300005290 Unclassified 600
7 Ga0065715_10562042 3300005293 Unclassified 722
8 Ga0065715_10573654 3300005293 Unclassified 725
9 Ga0065707_10001137 3300005295 Bacteria 15827
10 Ga0065707_10084515 3300005295 Bacteria 7114
11 Ga0065707_10219813 3300005295 Bacteria 1229
12 Ga0070690_100438938 3300005330 Bacteria 966
13 Ga0068869_100061281 3300005334 Unclassified 2759
14 Ga0070666_10354588 3300005335 Unclassified 1050
15 Ga0070689_100026319 3300005340 Unclassified 4379
16 Ga0070691_10380201 3300005341 Unclassified 791
17 Ga0070687_100072915 3300005343 Bacteria 1849
18 Ga0070668_100409850 3300005347 Unclassified 1159
19 Ga0070668_100496721 3300005347 Bacteria 1056
20 Ga0070669_100098421 3300005353 Bacteria 2203
21 Ga0070675_100582932 3300005354 Bacteria 1013
22 Ga0070675_100687347 3300005354 Bacteria 931
23 Ga0070673_100087182 3300005364 Bacteria 2544
24 Ga0070688_100018278 3300005365 Bacteria 4043
25 Ga0070688_100148981 3300005365 Bacteria 1598
26 Ga0070667_100322706 3300005367 Bacteria 1394
27 Ga0070667_100533422 3300005367 Bacteria 1078
28 Ga0070667_100576373 3300005367 Bacteria 1036
29 Ga0070709_10305532 3300005434 Bacteria 1163
30 Ga0070714_100399571 3300005435 Bacteria 1299
31 Ga0070705_100344788 3300005440 Bacteria 1084
32 Ga0070700_100084362 3300005441 Bacteria 2059
33 Ga0070694_100152384 3300005444 Bacteria 1689
34 Ga0070694_100247746 3300005444 Unclassified 1346
35 Ga0070678_100082489 3300005456 Unclassified 2441
36 Ga0068867_100142936 3300005459 Unclassified 1872
37 Ga0070685_10040823 3300005466 Bacteria 2642
38 Ga0070685_10157262 3300005466 Bacteria 1445
39 Ga0070706_101604789 3300005467 Unclassified 593
40 Ga0070707_100163392 3300005468 Bacteria 2170
41 Ga0070698_100021439 3300005471 Bacteria 6767
42 Ga0070698_100392403 3300005471 Bacteria 1321
43 Ga0070698_100408255 3300005471 Unclassified 1292
44 Ga0070699_100003573 3300005518 Bacteria 13745
45 Ga0070699_100228860 3300005518 Bacteria 1658
46 Ga0070697_100106732 3300005536 Bacteria 2330
47 Ga0070697_100224655 3300005536 Unclassified 1601
48 Ga0070672_100040660 3300005543 Unclassified 3569
49 Ga0070672_100678510 3300005543 Bacteria 901
50 Ga0070686_100494862 3300005544 Bacteria 948
51 Ga0070695_100108197 3300005545 Unclassified 1882
52 Ga0070695_100398093 3300005545 Bacteria 1043
53 Ga0070696_100284825 3300005546 Bacteria 1261
54 Ga0070665_101139172 3300005548 Unclassified 791
55 Ga0070704_100092070 3300005549 Bacteria 2262
56 Ga0068857_101027233 3300005577 Unclassified 794
57 Ga0070702_100262886 3300005615 Bacteria 1176
58 Ga0070702_100580484 3300005615 Unclassified 837
59 Ga0068859_100022108 3300005617 Bacteria 6376
60 Ga0068859_100403528 3300005617 Unclassified 1463
61 Ga0068861_100004280 3300005719 Bacteria 9570
62 Ga0068870_10068355 3300005840 Bacteria 1930
63 Ga0068863_100596911 3300005841 Bacteria 1093
64 Ga0068862_100139896 3300005844 Bacteria 2148
65 Ga0068862_100386383 3300005844 Unclassified 1307
66 Ga0081540_1009861 3300005983 Bacteria 6529
67 Ga0081539_10245889 3300005985 Bacteria 798
68 Ga0081539_10296318 3300005985 Unclassified 697
69 Ga0075365_10000008 3300006038 Bacteria 114620
70 Ga0075367_10028873 3300006178 Unclassified 3168
71 Ga0075427_10022789 3300006194 Bacteria 1001
72 Ga0097621_100474176 3300006237 Bacteria 1130
73 Ga0097621_100624617 3300006237 Unclassified 987
74 Ga0068871_100598241 3300006358 Bacteria 1003
75 Ga0075428_100036578 3300006844 Bacteria 5406
76 Ga0075431_100253557 3300006847 Unclassified 1787
77 Ga0075433_10337341 3300006852 Unclassified 1332
78 Ga0075433_10458801 3300006852 Unclassified 1123
79 Ga0075434_100606674 3300006871 Bacteria 1113
80 Ga0075429_100485490 3300006880 Bacteria 1082
81 Ga0075429_100991165 3300006880 Bacteria 735
82 Ga0068865_100094638 3300006881 Unclassified 2175
83 Ga0068865_100443316 3300006881 Unclassified 1072
84 Ga0097620_100022110 3300006931 Bacteria 6376
85 Ga0097620_100403540 3300006931 Unclassified 1463
86 Ga0105240_11022895 3300009093 Unclassified 883
87 Ga0111539_10912364 3300009094 Bacteria 1022
88 Ga0105245_10208950 3300009098 Bacteria 1878
89 Ga0105245_10458379 3300009098 Bacteria 1285
90 Ga0105247_10765227 3300009101 Bacteria 733
91 Ga0114129_10052276 3300009147 Bacteria 5734
92 Ga0114129_10130361 3300009147 Bacteria 3454
93 Ga0114129_10824826 3300009147 Bacteria 1181
94 Ga0114129_11030318 3300009147 Bacteria 1035
95 Ga0105243_10566695 3300009148 Bacteria 1088
96 Ga0105243_10906984 3300009148 Bacteria 877
97 Ga0105241_11577563 3300009174 Unclassified 634
98 Ga0105242_10253479 3300009176 Unclassified 1587
99 Ga0105242_10315358 3300009176 Unclassified 1432
100 Ga0105242_10690206 3300009176 Unclassified 997
101 Ga0105248_10046491 3300009177 Bacteria 4865
102 Ga0105248_10307775 3300009177 Bacteria 1784
103 Ga0105249_10296947 3300009553 Unclassified 1619
104 Ga0105249_10340654 3300009553 Bacteria 1516
105 Ga0105249_10423961 3300009553 Bacteria 1365
106 Ga0105249_10463443 3300009553 Bacteria 1308
107 Ga0105249_10518049 3300009553 Bacteria 1239
108 Ga0105249_10922431 3300009553 Unclassified 941
109 Ga0105249_11172011 3300009553 Bacteria 839
110 Ga0105239_10790739 3300010375 Bacteria 1087
111 Ga0105246_10243721 3300011119 Bacteria 1422
112 Ga0105246_10299152 3300011119 Unclassified 1298
113 Ga0105246_10341564 3300011119 Bacteria 1224
114 Ga0157374_10548396 3300013296 Bacteria 1164
115 Ga0157374_11268423 3300013296 Bacteria 759
116 Ga0163162_10318626 3300013306 Bacteria 1687
117 Ga0157375_10083166 3300013308 Unclassified 3245
118 Ga0157375_10643762 3300013308 Bacteria 1217
119 Ga0157376_11797315 3300014969 Unclassified 649
120 Ga0163161_10283284 3300017792 Bacteria 1301
121 Ga0206350_10105047 3300020080 Bacteria 784
122 Ga0207697_10041601 3300025315 Bacteria 1887
123 Ga0207688_10123308 3300025901 Bacteria 1513
124 Ga0207680_10177339 3300025903 Bacteria 1439
125 Ga0207699_10332919 3300025906 Unclassified 1068
126 Ga0207699_10512264 3300025906 Unclassified 867
127 Ga0207645_10058828 3300025907 Unclassified 2454
128 Ga0207684_10406464 3300025910 Unclassified 1170
129 Ga0207684_10612897 3300025910 Unclassified 929
130 Ga0207671_10461737 3300025914 Bacteria 1012
131 Ga0207662_10049142 3300025918 Bacteria 2501
132 Ga0207681_10377897 3300025923 Bacteria 1140
133 Ga0207650_10211896 3300025925 Bacteria 1556
134 Ga0207659_10056802 3300025926 Unclassified 2804
135 Ga0207659_10259451 3300025926 Bacteria 1413
136 Ga0207659_11286615 3300025926 Bacteria 628
137 Ga0207700_10275162 3300025928 Bacteria 1446
138 Ga0207644_10666274 3300025931 Unclassified 867
139 Ga0207706_10687645 3300025933 Bacteria 874
140 Ga0207686_10092065 3300025934 Bacteria 2004
141 Ga0207686_10389549 3300025934 Unclassified 1059
142 Ga0207709_10430538 3300025935 Unclassified 1015
143 Ga0207670_10159788 3300025936 Unclassified 1681
144 Ga0207704_10043791 3300025938 Unclassified 2646
145 Ga0207691_10051100 3300025940 Unclassified 3781
146 Ga0207691_10253070 3300025940 Bacteria 1520
147 Ga0207711_10687087 3300025941 Bacteria 954
148 Ga0207689_10074582 3300025942 Unclassified 2787
149 Ga0207689_10360339 3300025942 Unclassified 1209
150 Ga0207661_10690575 3300025944 Bacteria 939
151 Ga0207679_10483530 3300025945 Bacteria 1103
152 Ga0207651_10153463 3300025960 Unclassified 1796
153 Ga0207651_10187965 3300025960 Bacteria 1645
154 Ga0207712_10335426 3300025961 Bacteria 1252
155 Ga0207668_10339687 3300025972 Unclassified 1252
156 Ga0207640_10973756 3300025981 Unclassified 745
157 Ga0207658_10525933 3300025986 Unclassified 1056
158 Ga0207658_10836565 3300025986 Bacteria 837
159 Ga0207703_10083244 3300026035 Unclassified 2673
160 Ga0207703_10277821 3300026035 Bacteria 1520
161 Ga0207639_11076326 3300026041 Unclassified 754
162 Ga0207678_10708710 3300026067 Bacteria 886
163 Ga0207708_10100163 3300026075 Bacteria 2242
164 Ga0207708_11193676 3300026075 Bacteria 665
165 Ga0207641_10308633 3300026088 Unclassified 1497
166 Ga0207676_10260804 3300026095 Bacteria 1565
167 Ga0207674_10261108 3300026116 Bacteria 1679
168 Ga0207675_100007508 3300026118 Bacteria 10300
169 Ga0207675_100331848 3300026118 Unclassified 1487
170 Ga0207675_100548204 3300026118 Bacteria 1155
171 Ga0207683_10087929 3300026121 Unclassified 2764
172 Ga0207698_10453036 3300026142 Unclassified 1239
173 Ga0268265_10182819 3300028380 Bacteria 1803
174 Ga0268265_10732233 3300028380 Bacteria 958
175 Ga0268264_10448523 3300028381 Unclassified 1249
176 Ga0307416_100717886 3300032002 Unclassified 1090
177 Ga0373941_0179577 3300035115 Bacteria 794
178 Ga0242420_114348 3300038996 Bacteria 584
179 Ga0436363_0650651 3300039450 Bacteria 671
180 Ga0436362_0445097 3300039453 Unclassified 741
181 Ga0439465_0199594 3300041413 Bacteria 729
182 Ga0451789_0313781 3300041443 Bacteria 625
183 Ga0451797_0838081 3300041453 Bacteria 1360
184 Ga0451802_0083248 3300041460 Archaea 962
185 Ga0451853_0133893 3300041512 Bacteria 779
186 Ga0451577_0849105 3300042876 Bacteria 824
187 Ga0453683_0367739 3300044673 Unclassified 925
188 Ga0466959_0342632 3300045049 Bacteria 1020
189 Ga0495660_0006143 3300046810 Bacteria 7131
190 Ga0501037_0009624 3300049573 Bacteria 7091
191 Ga0501042_0465936 3300049578 Bacteria 917
192 Ga0501047_0167113 3300049581 Bacteria 2070
193 Ga0501067_0009976 3300049583 Bacteria 5258
194 Ga0501073_0006314 3300049589 Bacteria 8828
195 Ga0501077_0657537 3300049593 Bacteria 673
196 Ga0501080_0188465 3300049742 Bacteria 1896
197 Ga0501044_0009380 3300049823 Bacteria 10666
198 nmdc:mga0k408_37506_c1 3300050493 Bacteria 1658
199 nmdc:mga06z11_705386_c1 3300050494 Unclassified 615
200 nmdc:mga05p37_49410_c1 3300050507 Bacteria 5173
201 nmdc:mga05p37_555387_c1 3300050507 Bacteria 1306
202 nmdc:mga09592_845014_c1 3300050508 Bacteria 772
203 nmdc:mga0qj67_667696_c1 3300050509 Bacteria 828
204 nmdc:mga08y16_255237_c1 3300050511 Bacteria 1811
205 nmdc:mga0n895_250245_c1 3300050512 Unclassified 1798
206 nmdc:mga0a205_28668_c1 3300050515 Bacteria 5324
207 nmdc:mga0a205_392247_c1 3300050515 Unclassified 1252
208 nmdc:mga0a205_713587_c1 3300050515 Unclassified 852
209 Ga0500641_0005100 3300053096 Bacteria 4655
210 Ga0500562_000001 3300053108 Bacteria 1178987
211 Ga0500655_001584 3300053133 Bacteria 4300
212 Ga0500622_0035497 3300053156 Bacteria 2610
213 Ga0068855_100432132
214 rootH1_10310152
215 Ga0058859_11340626
216 Ga0065704_10001292
217 Ga0065712_10230290
218 Ga0065712_10557665
219 Ga0065715_10562042
220 Ga0065715_10573654
221 Ga0065707_10001137
222 Ga0065707_10084515
223 Ga0065707_10219813
224 Ga0070690_100438938
225 Ga0068869_100061281
226 Ga0070666_10354588
227 Ga0070689_100026319
228 Ga0070691_10380201
229 Ga0070687_100072915
230 Ga0070668_100409850
231 Ga0070668_100496721
232 Ga0070669_100098421
233 Ga0070675_100582932
234 Ga0070675_100687347
235 Ga0070673_100087182
236 Ga0070688_100018278
237 Ga0070688_100148981
238 Ga0070667_100322706
239 Ga0070667_100533422
240 Ga0070667_100576373
241 Ga0070709_10305532
242 Ga0070714_100399571
243 Ga0070705_100344788
244 Ga0070700_100084362
245 Ga0070694_100152384
246 Ga0070694_100247746
247 Ga0070678_100082489
248 Ga0068867_100142936
249 Ga0070685_10040823
250 Ga0070685_10157262
251 Ga0070706_101604789
252 Ga0070707_100163392
253 Ga0070698_100021439
254 Ga0070698_100392403
255 Ga0070698_100408255
256 Ga0070699_100003573
257 Ga0070699_100228860
258 Ga0070697_100106732
259 Ga0070697_100224655
260 Ga0070672_100040660
261 Ga0070672_100678510
262 Ga0070686_100494862
263 Ga0070695_100108197
264 Ga0070695_100398093
265 Ga0070696_100284825
266 Ga0070665_101139172
267 Ga0070704_100092070
268 Ga0068857_101027233
269 Ga0070702_100262886
270 Ga0070702_100580484
271 Ga0068859_100022108
272 Ga0068859_100403528
273 Ga0068861_100004280
274 Ga0068870_10068355
275 Ga0068863_100596911
276 Ga0068862_100139896
277 Ga0068862_100386383
278 Ga0081540_1009861
279 Ga0081539_10245889
280 Ga0081539_10296318
281 Ga0075365_10000008
282 Ga0075367_10028873
283 Ga0075427_10022789
284 Ga0097621_100474176
285 Ga0097621_100624617
286 Ga0068871_100598241
287 Ga0075428_100036578
288 Ga0075431_100253557
289 Ga0075433_10337341
290 Ga0075433_10458801
291 Ga0075434_100606674
292 Ga0075429_100485490
293 Ga0075429_100991165
294 Ga0068865_100094638
295 Ga0068865_100443316
296 Ga0097620_100022110
297 Ga0097620_100403540
298 Ga0105240_11022895
299 Ga0111539_10912364
300 Ga0105245_10208950
301 Ga0105245_10458379
302 Ga0105247_10765227
303 Ga0114129_10052276
304 Ga0114129_10130361
305 Ga0114129_10824826
306 Ga0114129_11030318
307 Ga0105243_10566695
308 Ga0105243_10906984
309 Ga0105241_11577563
310 Ga0105242_10253479
311 Ga0105242_10315358
312 Ga0105242_10690206
313 Ga0105248_10046491
314 Ga0105248_10307775
315 Ga0105249_10296947
316 Ga0105249_10340654
317 Ga0105249_10423961
318 Ga0105249_10463443
319 Ga0105249_10518049
320 Ga0105249_10922431
321 Ga0105249_11172011
322 Ga0105239_10790739
323 Ga0105246_10243721
324 Ga0105246_10299152
325 Ga0105246_10341564
326 Ga0157374_10548396
327 Ga0157374_11268423
328 Ga0163162_10318626
329 Ga0157375_10083166
330 Ga0157375_10643762
331 Ga0157376_11797315
332 Ga0163161_10283284
333 Ga0206350_10105047
334 Ga0207697_10041601
335 Ga0207688_10123308
336 Ga0207680_10177339
337 Ga0207699_10332919
338 Ga0207699_10512264
339 Ga0207645_10058828
340 Ga0207684_10406464
341 Ga0207684_10612897
342 Ga0207671_10461737
343 Ga0207662_10049142
344 Ga0207681_10377897
345 Ga0207650_10211896
346 Ga0207659_10056802
347 Ga0207659_10259451
348 Ga0207659_11286615
349 Ga0207700_10275162
350 Ga0207644_10666274
351 Ga0207706_10687645
352 Ga0207686_10092065
353 Ga0207686_10389549
354 Ga0207709_10430538
355 Ga0207670_10159788
356 Ga0207704_10043791
357 Ga0207691_10051100
358 Ga0207691_10253070
359 Ga0207711_10687087
360 Ga0207689_10074582
361 Ga0207689_10360339
362 Ga0207661_10690575
363 Ga0207679_10483530
364 Ga0207651_10153463
365 Ga0207651_10187965
366 Ga0207712_10335426
367 Ga0207668_10339687
368 Ga0207640_10973756
369 Ga0207658_10525933
370 Ga0207658_10836565
371 Ga0207703_10083244
372 Ga0207703_10277821
373 Ga0207639_11076326
374 Ga0207678_10708710
375 Ga0207708_10100163
376 Ga0207708_11193676
377 Ga0207641_10308633
378 Ga0207676_10260804
379 Ga0207674_10261108
380 Ga0207675_100007508
381 Ga0207675_100331848
382 Ga0207675_100548204
383 Ga0207683_10087929
384 Ga0207698_10453036
385 Ga0268265_10182819
386 Ga0268265_10732233
387 Ga0268264_10448523
388 Ga0307416_100717886
389 Ga0373941_0179577
390 Ga0242420_114348
391 Ga0436363_0650651
392 Ga0436362_0445097
393 Ga0439465_0199594
394 Ga0451789_0313781
395 Ga0451797_0838081
396 Ga0451802_0083248
397 Ga0451853_0133893
398 Ga0451577_0849105
399 Ga0453683_0367739
400 Ga0466959_0342632
401 Ga0495660_0006143
402 Ga0501037_0009624
403 Ga0501042_0465936
404 Ga0501047_0167113
405 Ga0501067_0009976
406 Ga0501073_0006314
407 Ga0501077_0657537
408 Ga0501080_0188465
409 Ga0501044_0009380
410 nmdc:mga0k408_37506_c1
411 nmdc:mga06z11_705386_c1
412 nmdc:mga05p37_49410_c1
413 nmdc:mga05p37_555387_c1
414 nmdc:mga09592_845014_c1
415 nmdc:mga0qj67_667696_c1
416 nmdc:mga08y16_255237_c1
417 nmdc:mga0n895_250245_c1
418 nmdc:mga0a205_28668_c1
419 nmdc:mga0a205_392247_c1
420 nmdc:mga0a205_713587_c1
421 Ga0500641_0005100
422 Ga0500562_000001
423 Ga0500655_001584
424 Ga0500622_0035497

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

94

152

0.94

PF01872

RibD_C

RibD C-terminal domain

2

97

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.8297 1 181
7xh2-assembly1.cif.gz_A dihydrofolate reductase-like protein sach in safracin biosynthesis 0.8293 1 179
3jtw-assembly1.cif.gz_A-2 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.8291 1 179
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.8254 1 181
7xh2-assembly1.cif.gz_A dihydrofolate reductase-like protein sach in safracin biosynthesis 0.8209 1 179
ID Description Score Start End Superfamily
af_P76540_1_103_3.30.70.1710 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;BMC (bacterial microcompartment) domain 0.8769 161 179 3.30.70.1710
af_P90866_3_106_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.8009 160 179 3.30.200.20
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7919 2 178 3.40.430.10
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7914 1 181 3.40.430.10
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7878 2 178 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A7S8IEA7-F1-model_v4 Dihydrofolate reductase family protein 0.9897 1 184 GO:0008703
GO:0009231
AF-A0A7C4VX83-F1-model_v4 Dihydrofolate reductase 0.957 1 181 GO:0008703
GO:0009231
AF-A0A7C4VX83-F1-model_v4 Dihydrofolate reductase 0.9517 1 181 GO:0008703
GO:0009231
AF-A0A529ZGL2-F1-model_v4 deleted 0.9474 1 154
AF-A0A7X5ZXU1-F1-model_v4 Dihydrofolate reductase 0.9465 51 182 GO:0008703
GO:0009231

Map