F322602

General Info

Members Datasets Scaffolds Average Seq Length
212 141 212 376

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100037647|Ga0068855_1000376475
Length 412
Sequence MRRAAPGANGRHATPWPTSEGSHLGTAQVRGRMHATTGVPLRQSSAPRDARQPDPHALELGVVIPTFKEAPNIAPLLAKLEAALVGVSWQAIFVDDDSPDGTAAVVKAIAATDPRVICLHRIGRRGLAGAVIEGAMASAAPFVAVIDGDLQHDESLLPQMLRLLQDDRADVVVGSRYLAGAGSDASALGARREAGSRLANWLGKRVLRADVTDPMSGFFMIRRELVEAVAPTLATAGFKVLFDILASQKSPPRYVELPYEFRARVAGDSKLDNGVVIQYLGLLLAKLSQDLISPRFIMFALVGSSGVVVHLLILRSLLHYGFSAAQLTAALGAMTWNYLINNAVTYRDKRKRGLGLLVGYFKFVLLCSVPLAANVAVATMVYERGPSWWVAGVAGAIVAAVWNYVTTSRAVW

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
54 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
85 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
86 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
87 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
88 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
89 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
90 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
91 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
92 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
93 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
94 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
95 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
96 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
97 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
98 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
99 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
100 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
101 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
102 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
103 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
104 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
105 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
106 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
107 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
108 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
109 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
110 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
111 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
112 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
113 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
114 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
115 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
116 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
117 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
118 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
120 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
121 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
122 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
123 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
124 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
125 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
126 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
127 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
128 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
129 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
130 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
131 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
132 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
133 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
134 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
135 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
136 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
137 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
138 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
139 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
140 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
141 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.26
Nodule 0
Rhizoplane 1.89
Rhizosphere 79.25
Stem 0
Stem Tuber 0
Unclassified 6.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10094406 3300005327 Bacteria 2468
2 Ga0070658_10197186 3300005327 Bacteria 1698
3 Ga0068869_100154634 3300005334 Bacteria 1781
4 Ga0070666_10000276 3300005335 Bacteria 33925
5 Ga0070680_100043044 3300005336 Bacteria 3667
6 Ga0070660_100007760 3300005339 Bacteria 7483
7 Ga0070660_100239991 3300005339 Bacteria 1476
8 Ga0070691_10003772 3300005341 Bacteria 6847
9 Ga0070668_100001196 3300005347 Bacteria 18403
10 Ga0070668_100010425 3300005347 Bacteria 6907
11 Ga0070669_100042616 3300005353 Bacteria 3303
12 Ga0070671_100113592 3300005355 Bacteria 2276
13 Ga0070671_100246130 3300005355 Bacteria 1518
14 Ga0070659_100000364 3300005366 Bacteria 34480
15 Ga0070659_100055186 3300005366 Bacteria 3130
16 Ga0070667_100007345 3300005367 Bacteria 9158
17 Ga0070667_100009364 3300005367 Bacteria 8119
18 Ga0070667_100098009 3300005367 Bacteria 2529
19 Ga0070713_100170522 3300005436 Bacteria 1949
20 Ga0070681_10004120 3300005458 Bacteria 13747
21 Ga0068867_100134991 3300005459 Bacteria 1922
22 Ga0070679_100013910 3300005530 Bacteria 7711
23 Ga0068853_100049607 3300005539 Bacteria 3608
24 Ga0068853_100087264 3300005539 Bacteria 2737
25 Ga0070696_100177602 3300005546 Bacteria 1578
26 Ga0070665_100000455 3300005548 Bacteria 59653
27 Ga0070665_100000763 3300005548 Bacteria 42605
28 Ga0070665_100011863 3300005548 Bacteria 8802
29 Ga0070665_100098866 3300005548 Bacteria 2922
30 Ga0068855_100010386 3300005563 Bacteria 11231
31 Ga0068855_100037647 3300005563 Bacteria 5751
32 Ga0068855_100266818 3300005563 Bacteria 1905
33 Ga0068852_100105430 3300005616 Bacteria 2554
34 Ga0068859_100001706 3300005617 Bacteria 22386
35 Ga0068864_100000843 3300005618 Bacteria 25869
36 Ga0068861_100153047 3300005719 Unclassified 1894
37 Ga0068863_100000279 3300005841 Bacteria 53016
38 Ga0068863_100009107 3300005841 Bacteria 9694
39 Ga0068858_100006191 3300005842 Bacteria 11668
40 Ga0068860_100146062 3300005843 Bacteria 2276
41 Ga0068860_100233838 3300005843 Bacteria 1786
42 Ga0068862_100160274 3300005844 Bacteria 2008
43 Ga0070717_10076868 3300006028 Bacteria 2795
44 Ga0075368_10002503 3300006042 Bacteria 6013
45 Ga0075368_10003706 3300006042 Bacteria 5131
46 Ga0075364_10006430 3300006051 Bacteria 6900
47 Ga0075367_10011132 3300006178 Bacteria 4747
48 Ga0097621_100012137 3300006237 Bacteria 6375
49 Ga0075370_10058013 3300006353 Bacteria 2201
50 Ga0068871_100004919 3300006358 Bacteria 9335
51 Ga0075433_10052796 3300006852 Bacteria 3542
52 Ga0075434_100067527 3300006871 Bacteria 3561
53 Ga0075429_100010739 3300006880 Bacteria 7919
54 Ga0068865_100000097 3300006881 Bacteria 45492
55 Ga0097620_100001706 3300006931 Bacteria 22386
56 Ga0075435_100072063 3300007076 Bacteria 2822
57 Ga0105250_10021801 3300009092 Bacteria 2584
58 Ga0105240_10000528 3300009093 Bacteria 70421
59 Ga0105240_10002017 3300009093 Bacteria 33485
60 Ga0105240_10006289 3300009093 Bacteria 17471
61 Ga0105240_10012645 3300009093 Bacteria 11637
62 Ga0105240_10062295 3300009093 Bacteria 4644
63 Ga0105240_10196432 3300009093 Bacteria 2368
64 Ga0111539_10019762 3300009094 Bacteria 8307
65 Ga0114129_10045108 3300009147 Bacteria 6198
66 Ga0114129_10055400 3300009147 Bacteria 5557
67 Ga0105242_10022813 3300009176 Bacteria 4928
68 Ga0105248_10000648 3300009177 Bacteria 39487
69 Ga0105248_10007503 3300009177 Bacteria 11964
70 Ga0105248_10010713 3300009177 Bacteria 10120
71 Ga0105248_10044488 3300009177 Bacteria 4979
72 Ga0105248_10184134 3300009177 Bacteria 2354
73 Ga0105248_10386450 3300009177 Bacteria 1576
74 Ga0105238_10060683 3300009551 Bacteria 3786
75 Ga0105239_10007612 3300010375 Bacteria 12411
76 Ga0105239_10048906 3300010375 Bacteria 4636
77 Ga0105246_10033195 3300011119 Bacteria 3429
78 Ga0157369_10204927 3300013105 Bacteria 2069
79 Ga0163163_10004658 3300014325 Bacteria 11725
80 Ga0163163_10020407 3300014325 Bacteria 6239
81 Ga0157379_10002189 3300014968 Bacteria 16259
82 Ga0209233_1002426 3300025261 Bacteria 6882
83 Ga0207696_1015683 3300025711 Bacteria 2560
84 Ga0207680_10001634 3300025903 Bacteria 10595
85 Ga0207705_10002818 3300025909 Bacteria 13290
86 Ga0207705_10036713 3300025909 Bacteria 3506
87 Ga0207705_10201962 3300025909 Bacteria 1506
88 Ga0207695_10000269 3300025913 Bacteria 130183
89 Ga0207695_10000886 3300025913 Bacteria 54376
90 Ga0207695_10001649 3300025913 Bacteria 35962
91 Ga0207695_10024082 3300025913 Bacteria 6859
92 Ga0207695_10044459 3300025913 Bacteria 4724
93 Ga0207695_10049337 3300025913 Bacteria 4439
94 Ga0207693_10039571 3300025915 Bacteria 3713
95 Ga0207660_10249656 3300025917 Bacteria 1400
96 Ga0207657_10020981 3300025919 Bacteria 6161
97 Ga0207657_10074336 3300025919 Bacteria 2870
98 Ga0207657_10077387 3300025919 Bacteria 2803
99 Ga0207652_10003731 3300025921 Bacteria 12503
100 Ga0207681_10006941 3300025923 Bacteria 6945
101 Ga0207650_10172303 3300025925 Bacteria 1721
102 Ga0207700_10100226 3300025928 Bacteria 2308
103 Ga0207644_10082056 3300025931 Bacteria 2384
104 Ga0207690_10000031 3300025932 Bacteria 154724
105 Ga0207686_10074908 3300025934 Bacteria 2189
106 Ga0207686_10193724 3300025934 Bacteria 1451
107 Ga0207704_10004976 3300025938 Bacteria 6110
108 Ga0207711_10000669 3300025941 Bacteria 34078
109 Ga0207711_10001545 3300025941 Bacteria 21298
110 Ga0207711_10015520 3300025941 Bacteria 6322
111 Ga0207711_10045363 3300025941 Bacteria 3756
112 Ga0207711_10143208 3300025941 Bacteria 2152
113 Ga0207667_10103327 3300025949 Bacteria 2939
114 Ga0207667_10186205 3300025949 Bacteria 2131
115 Ga0207667_10201906 3300025949 Bacteria 2039
116 Ga0207668_10000016 3300025972 Bacteria 159703
117 Ga0207668_10010690 3300025972 Bacteria 5553
118 Ga0207658_10006271 3300025986 Bacteria 8126
119 Ga0207658_10116984 3300025986 Bacteria 2118
120 Ga0207658_10240145 3300025986 Bacteria 1534
121 Ga0207703_10002046 3300026035 Bacteria 17809
122 Ga0207678_10315775 3300026067 Bacteria 1344
123 Ga0207641_10000070 3300026088 Bacteria 152598
124 Ga0207641_10025400 3300026088 Bacteria 4884
125 Ga0207648_10078991 3300026089 Bacteria 2870
126 Ga0207676_10000728 3300026095 Bacteria 25838
127 Ga0207674_10113067 3300026116 Bacteria 2688
128 Ga0207698_10360337 3300026142 Bacteria 1377
129 Ga0209981_1000502 3300027378 Bacteria 4981
130 Ga0209983_1002277 3300027665 Unclassified 4214
131 Ga0268266_10000003 3300028379 Bacteria 1701703
132 Ga0268266_10002314 3300028379 Bacteria 20664
133 Ga0268266_10077341 3300028379 Bacteria 2893
134 Ga0268265_10020132 3300028380 Bacteria 4653
135 Ga0268265_10078588 3300028380 Bacteria 2595
136 Ga0307517_10058769 3300028786 Bacteria 3697
137 Ga0307517_10173254 3300028786 Bacteria 1413
138 Ga0265338_10008184 3300028800 Bacteria 12744
139 Ga0265338_10064421 3300028800 Bacteria 3187
140 Ga0265338_10113576 3300028800 Bacteria 2176
141 Ga0265327_10001039 3300031251 Bacteria 39147
142 Ga0307414_10041837 3300032004 Bacteria 3108
143 Ga0373936_0002519 3300035113 Bacteria 6869
144 Ga0373927_0000579 3300035695 Bacteria 27881
145 Ga0373925_0000032 3300037068 Bacteria 145357
146 Ga0395899_0002431 3300037312 Bacteria 15147
147 Ga0395899_0016306 3300037312 Bacteria 5663
148 Ga0395900_0000002 3300037418 Bacteria 671103
149 Ga0395900_0143979 3300037418 Bacteria 2438
150 Ga0395900_0239177 3300037418 Bacteria 1822
151 Ga0395898_0038065 3300037466 Bacteria 4769
152 Ga0395905_0042655 3300037471 Bacteria 4256
153 Ga0395901_0000013 3300038443 Bacteria 375733
154 Ga0395901_0073342 3300038443 Bacteria 3570
155 Ga0436365_1554717 3300039437 Bacteria 3827
156 Ga0436363_0536065 3300039450 Bacteria 1787
157 Ga0436362_0361022 3300039453 Bacteria 4254
158 Ga0495628_0050499 3300046516 Bacteria 3290
159 Ga0495643_0029494 3300046522 Bacteria 3069
160 Ga0495621_0025919 3300046539 Bacteria 1973
161 Ga0495597_0003044 3300046542 Bacteria 10099
162 Ga0495622_0002352 3300046557 Bacteria 9198
163 Ga0495622_0005814 3300046557 Bacteria 5722
164 Ga0495613_0000379 3300046689 Bacteria 38262
165 Ga0495613_0000451 3300046689 Bacteria 35059
166 Ga0495674_0165261 3300047319 Bacteria 1850
167 Ga0495687_042879 3300047443 Bacteria 1974
168 Ga0495602_0248970 3300048088 Bacteria 1325
169 Ga0496102_0370345 3300048905 Bacteria 1348
170 Ga0496112_0045462 3300048915 Bacteria 4304
171 Ga0496115_0000434 3300048918 Bacteria 33932
172 Ga0496115_0015915 3300048918 Bacteria 5716
173 Ga0496116_0059242 3300048919 Bacteria 2492
174 Ga0496117_0007821 3300048920 Bacteria 10292
175 Ga0496117_0019070 3300048920 Bacteria 5651
176 Ga0496118_0001107 3300048921 Bacteria 41821
177 Ga0496118_0001939 3300048921 Bacteria 29313
178 Ga0496118_0165591 3300048921 Bacteria 1359
179 Ga0496119_0025557 3300048922 Bacteria 4120
180 Ga0496121_0000088 3300048924 Bacteria 219728
181 Ga0496124_0062393 3300048927 Bacteria 3119
182 Ga0496126_0000010 3300048929 Bacteria 744888
183 Ga0501047_0011319 3300049581 Bacteria 8446
184 Ga0501047_0071295 3300049581 Bacteria 3345
185 Ga0501047_0264463 3300049581 Bacteria 1567
186 Ga0501044_0079901 3300049823 Bacteria 3313
187 Ga0501044_0085763 3300049823 Bacteria 3182
188 nmdc:mga00v17_208_c2 3300050491 Bacteria 16880
189 nmdc:mga04h51_42642_c1 3300050495 Bacteria 1489
190 nmdc:mga07m45_2149_c1 3300050496 Bacteria 7127
191 nmdc:mga05p37_23419_c1 3300050507 Bacteria 7493
192 nmdc:mga05p37_558988_c1 3300050507 Bacteria 1301
193 nmdc:mga0n895_408787_c1 3300050512 Bacteria 1373
194 nmdc:mga0rr50_211594_c1 3300050513 Bacteria 1598
195 nmdc:mga0a205_21264_c1 3300050515 Bacteria 6137
196 Ga0500635_0000130 3300053080 Bacteria 43451
197 Ga0500643_002745 3300053087 Bacteria 8817
198 Ga0500646_0015702 3300053090 Bacteria 1974
199 Ga0500651_0023788 3300053093 Bacteria 3837
200 Ga0500555_007195 3300053103 Bacteria 3162
201 Ga0500569_000236 3300053109 Bacteria 8747
202 Ga0500595_001423 3300053119 Bacteria 12843
203 Ga0500595_020157 3300053119 Bacteria 2406
204 Ga0500597_073652 3300053120 Bacteria 1478
205 Ga0500608_000779 3300053122 Bacteria 11645
206 Ga0500614_011755 3300053123 Bacteria 1901
207 Ga0500559_0000002 3300053136 Bacteria 262002
208 Ga0500590_050935 3300053148 Bacteria 2104
209 Ga0500636_0005353 3300053177 Bacteria 7318
210 Ga0500636_0029171 3300053177 Bacteria 3258
211 Ga0500625_045537 3300053729 Bacteria 2048
212 Ga0500596_000708 3300053735 Bacteria 6522

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048905 Ga0496102_0370345 Ga0496102_0370345_402_1334 308
2 3300005546 Ga0070696_100177602 Ga0070696_1001776022 323
3 3300025934 Ga0207686_10193724 Ga0207686_101937242 336
4 3300048921 Ga0496118_0165591 Ga0496118_0165591_41_1174 341
5 3300006852 Ga0075433_10052796 Ga0075433_100527962 344
6 3300009094 Ga0111539_10019762 Ga0111539_100197627 344
7 3300009147 Ga0114129_10055400 Ga0114129_100554001 344
8 3300050507 nmdc:mga05p37_558988_c1 nmdc:mga05p37_558988_c1_114_1250 344
9 3300050515 nmdc:mga0a205_21264_c1 nmdc:mga0a205_21264_c1_2717_3853 344
10 3300006880 Ga0075429_100010739 Ga0075429_1000107395 345
11 3300009093 Ga0105240_10006289 Ga0105240_1000628922 346
12 3300005334 Ga0068869_100154634 Ga0068869_1001546342 347
13 3300006237 Ga0097621_100012137 Ga0097621_1000121376 347
14 3300006358 Ga0068871_100004919 Ga0068871_10000491912 347
15 3300028786 Ga0307517_10173254 Ga0307517_101732542 347
16 3300048929 Ga0496126_0000010 Ga0496126_0000010_332576_333709 348
17 3300025913 Ga0207695_10049337 Ga0207695_100493372 351
18 3300025261 Ga0209233_1002426 Ga0209233_10024264 352
19 3300005459 Ga0068867_100134991 Ga0068867_1001349912 354
20 3300005719 Ga0068861_100153047 Ga0068861_1001530471 354
21 3300009093 Ga0105240_10000528 Ga0105240_1000052834 354
22 3300009093 Ga0105240_10196432 Ga0105240_101964322 354
23 3300009176 Ga0105242_10022813 Ga0105242_100228134 354
24 3300010375 Ga0105239_10007612 Ga0105239_1000761211 354
25 3300011119 Ga0105246_10033195 Ga0105246_100331952 354
26 3300025913 Ga0207695_10001649 Ga0207695_1000164931 354
27 3300025934 Ga0207686_10074908 Ga0207686_100749081 354
28 3300026089 Ga0207648_10078991 Ga0207648_100789911 354
29 3300025915 Ga0207693_10039571 Ga0207693_100395715 355
30 3300039437 Ga0436365_1554717 Ga0436365_1554717_798_1895 356
31 3300005339 Ga0070660_100007760 Ga0070660_10000776010 357
32 3300005539 Ga0068853_100087264 Ga0068853_1000872642 357
33 3300005548 Ga0070665_100011863 Ga0070665_1000118631 357
34 3300025919 Ga0207657_10074336 Ga0207657_100743363 357
35 3300026067 Ga0207678_10315775 Ga0207678_103157751 357
36 3300053120 Ga0500597_073652 Ga0500597_073652_230_1339 357
37 3300006871 Ga0075434_100067527 Ga0075434_1000675272 358
38 3300007076 Ga0075435_100072063 Ga0075435_1000720632 358
39 3300009147 Ga0114129_10045108 Ga0114129_100451087 358
40 3300039453 Ga0436362_0361022 Ga0436362_0361022_2640_3761 358
41 3300050507 nmdc:mga05p37_23419_c1 nmdc:mga05p37_23419_c1_5421_6566 358
42 3300050512 nmdc:mga0n895_408787_c1 nmdc:mga0n895_408787_c1_12_1157 358
43 3300050513 nmdc:mga0rr50_211594_c1 nmdc:mga0rr50_211594_c1_307_1452 358
44 3300028800 Ga0265338_10008184 Ga0265338_100081843 359
45 3300005335 Ga0070666_10000276 Ga0070666_1000027629 360
46 3300005548 Ga0070665_100098866 Ga0070665_1000988663 360
47 3300005563 Ga0068855_100010386 Ga0068855_1000103868 360
48 3300014325 Ga0163163_10020407 Ga0163163_100204072 360
49 3300025903 Ga0207680_10001634 Ga0207680_100016349 360
50 3300025986 Ga0207658_10240145 Ga0207658_102401451 360
51 3300028379 Ga0268266_10077341 Ga0268266_100773413 360
52 3300035695 Ga0373927_0000579 Ga0373927_0000579_9591_10694 360
53 3300037068 Ga0373925_0000032 Ga0373925_0000032_82330_83433 360
54 3300047319 Ga0495674_0165261 Ga0495674_0165261_33_1148 360
55 3300048915 Ga0496112_0045462 Ga0496112_0045462_984_2078 360
56 3300050495 nmdc:mga04h51_42642_c1 nmdc:mga04h51_42642_c1_23_1123 362
57 3300053136 Ga0500559_0000002 Ga0500559_0000002_45319_46443 362
58 3300053177 Ga0500636_0005353 Ga0500636_0005353_606_1730 362
59 3300048918 Ga0496115_0015915 Ga0496115_0015915_496_1602 363
60 3300049581 Ga0501047_0011319 Ga0501047_0011319_2469_3590 363
61 3300053087 Ga0500643_002745 Ga0500643_002745_3329_4435 363
62 3300025909 Ga0207705_10201962 Ga0207705_102019621 364
63 3300032004 Ga0307414_10041837 Ga0307414_100418372 364
64 3300027378 Ga0209981_1000502 Ga0209981_10005026 366
65 3300027665 Ga0209983_1002277 Ga0209983_10022772 366
66 3300005327 Ga0070658_10197186 Ga0070658_101971862 367
67 3300005436 Ga0070713_100170522 Ga0070713_1001705222 367
68 3300010375 Ga0105239_10048906 Ga0105239_100489064 367
69 3300013105 Ga0157369_10204927 Ga0157369_102049271 367
70 3300025928 Ga0207700_10100226 Ga0207700_101002262 367
71 3300028800 Ga0265338_10064421 Ga0265338_100644212 367
72 3300031251 Ga0265327_10001039 Ga0265327_1000103910 367
73 3300037312 Ga0395899_0016306 Ga0395899_0016306_893_2035 367
74 3300037418 Ga0395900_0239177 Ga0395900_0239177_360_1502 367
75 3300046689 Ga0495613_0000379 Ga0495613_0000379_24080_25222 367
76 3300049581 Ga0501047_0264463 Ga0501047_0264463_112_1251 367
77 3300049823 Ga0501044_0079901 Ga0501044_0079901_436_1575 367
78 3300005339 Ga0070660_100239991 Ga0070660_1002399912 368
79 3300005353 Ga0070669_100042616 Ga0070669_1000426162 368
80 3300005355 Ga0070671_100246130 Ga0070671_1002461302 368
81 3300005367 Ga0070667_100098009 Ga0070667_1000980092 368
82 3300005563 Ga0068855_100266818 Ga0068855_1002668182 368
83 3300005616 Ga0068852_100105430 Ga0068852_1001054302 368
84 3300005843 Ga0068860_100146062 Ga0068860_1001460622 368
85 3300009177 Ga0105248_10386450 Ga0105248_103864502 368
86 3300025949 Ga0207667_10201906 Ga0207667_102019062 368
87 3300025972 Ga0207668_10010690 Ga0207668_100106902 368
88 3300025986 Ga0207658_10116984 Ga0207658_101169842 368
89 3300028380 Ga0268265_10078588 Ga0268265_100785882 368
90 3300028800 Ga0265338_10113576 Ga0265338_101135761 368
91 3300037418 Ga0395900_0143979 Ga0395900_0143979_211_1455 368
92 3300038443 Ga0395901_0073342 Ga0395901_0073342_354_1484 368
93 3300046539 Ga0495621_0025919 Ga0495621_0025919_738_1904 368
94 3300048920 Ga0496117_0007821 Ga0496117_0007821_5552_6676 368
95 3300048921 Ga0496118_0001107 Ga0496118_0001107_3632_4756 368
96 3300048927 Ga0496124_0062393 Ga0496124_0062393_465_1589 368
97 3300005347 Ga0070668_100001196 Ga0070668_10000119612 369
98 3300005347 Ga0070668_100010425 Ga0070668_1000104252 369
99 3300005355 Ga0070671_100113592 Ga0070671_1001135922 369
100 3300005367 Ga0070667_100007345 Ga0070667_1000073457 369
101 3300005367 Ga0070667_100009364 Ga0070667_1000093643 369
102 3300005548 Ga0070665_100000763 Ga0070665_10000076330 369
103 3300005617 Ga0068859_100001706 Ga0068859_1000017069 369
104 3300005841 Ga0068863_100009107 Ga0068863_1000091079 369
105 3300005843 Ga0068860_100233838 Ga0068860_1002338382 369
106 3300005844 Ga0068862_100160274 Ga0068862_1001602742 369
107 3300006042 Ga0075368_10002503 Ga0075368_100025033 369
108 3300006042 Ga0075368_10003706 Ga0075368_100037066 369
109 3300006051 Ga0075364_10006430 Ga0075364_100064303 369
110 3300006178 Ga0075367_10011132 Ga0075367_100111323 369
111 3300006353 Ga0075370_10058013 Ga0075370_100580132 369
112 3300006931 Ga0097620_100001706 Ga0097620_1000017069 369
113 3300009093 Ga0105240_10002017 Ga0105240_1000201712 369
114 3300009177 Ga0105248_10000648 Ga0105248_1000064811 369
115 3300009177 Ga0105248_10184134 Ga0105248_101841342 369
116 3300014325 Ga0163163_10004658 Ga0163163_100046582 369
117 3300014968 Ga0157379_10002189 Ga0157379_100021895 369
118 3300025923 Ga0207681_10006941 Ga0207681_100069415 369
119 3300025931 Ga0207644_10082056 Ga0207644_100820562 369
120 3300025941 Ga0207711_10015520 Ga0207711_100155202 369
121 3300025941 Ga0207711_10143208 Ga0207711_101432082 369
122 3300025972 Ga0207668_10000016 Ga0207668_1000001622 369
123 3300025986 Ga0207658_10006271 Ga0207658_100062718 369
124 3300026088 Ga0207641_10025400 Ga0207641_100254004 369
125 3300028379 Ga0268266_10002314 Ga0268266_100023144 369
126 3300028380 Ga0268265_10020132 Ga0268265_100201323 369
127 3300037312 Ga0395899_0002431 Ga0395899_0002431_1033_2148 369
128 3300037418 Ga0395900_0000002 Ga0395900_0000002_367210_368325 369
129 3300037466 Ga0395898_0038065 Ga0395898_0038065_3080_4195 369
130 3300037471 Ga0395905_0042655 Ga0395905_0042655_644_1759 369
131 3300038443 Ga0395901_0000013 Ga0395901_0000013_335460_336575 369
132 3300039450 Ga0436363_0536065 Ga0436363_0536065_495_1676 369
133 3300046689 Ga0495613_0000451 Ga0495613_0000451_1913_3064 369
134 3300050491 nmdc:mga00v17_208_c2 nmdc:mga00v17_208_c2_12737_13873 369
135 3300050496 nmdc:mga07m45_2149_c1 nmdc:mga07m45_2149_c1_3048_4184 369
136 3300005618 Ga0068864_100000843 Ga0068864_10000084319 370
137 3300005841 Ga0068863_100000279 Ga0068863_10000027948 370
138 3300005842 Ga0068858_100006191 Ga0068858_1000061915 370
139 3300009092 Ga0105250_10021801 Ga0105250_100218012 370
140 3300009177 Ga0105248_10044488 Ga0105248_100444883 370
141 3300025711 Ga0207696_1015683 Ga0207696_10156832 370
142 3300025925 Ga0207650_10172303 Ga0207650_101723031 370
143 3300025941 Ga0207711_10045363 Ga0207711_100453633 370
144 3300026035 Ga0207703_10002046 Ga0207703_100020468 370
145 3300026088 Ga0207641_10000070 Ga0207641_1000007048 370
146 3300026095 Ga0207676_10000728 Ga0207676_1000072812 370
147 3300048918 Ga0496115_0000434 Ga0496115_0000434_25941_27053 370
148 3300049581 Ga0501047_0071295 Ga0501047_0071295_254_1396 370
149 3300049823 Ga0501044_0085763 Ga0501044_0085763_853_1995 370
150 3300053090 Ga0500646_0015702 Ga0500646_0015702_208_1362 370
151 3300053103 Ga0500555_007195 Ga0500555_007195_1451_2605 370
152 3300006028 Ga0070717_10076868 Ga0070717_100768682 371
153 3300009177 Ga0105248_10007503 Ga0105248_100075033 371
154 3300025941 Ga0207711_10001545 Ga0207711_1000154510 371
155 3300046557 Ga0495622_0005814 Ga0495622_0005814_3416_4582 371
156 3300005366 Ga0070659_100000364 Ga0070659_10000036430 372
157 3300005548 Ga0070665_100000455 Ga0070665_10000045533 372
158 3300009177 Ga0105248_10010713 Ga0105248_1001071312 372
159 3300025913 Ga0207695_10044459 Ga0207695_100444592 372
160 3300025932 Ga0207690_10000031 Ga0207690_1000003154 372
161 3300025941 Ga0207711_10000669 Ga0207711_1000066924 372
162 3300028379 Ga0268266_10000003 Ga0268266_100000031494 372
163 3300028786 Ga0307517_10058769 Ga0307517_100587692 372
164 3300048919 Ga0496116_0059242 Ga0496116_0059242_1117_2262 372
165 3300048920 Ga0496117_0019070 Ga0496117_0019070_2694_3839 372
166 3300048921 Ga0496118_0001939 Ga0496118_0001939_17750_18895 372
167 3300048922 Ga0496119_0025557 Ga0496119_0025557_1294_2439 372
168 3300048924 Ga0496121_0000088 Ga0496121_0000088_131200_132345 372
169 3300053080 Ga0500635_0000130 Ga0500635_0000130_37410_38555 372
170 3300026142 Ga0207698_10360337 Ga0207698_103603372 373
171 3300025913 Ga0207695_10024082 Ga0207695_100240829 374
172 3300046522 Ga0495643_0029494 Ga0495643_0029494_597_1748 374
173 3300046542 Ga0495597_0003044 Ga0495597_0003044_4601_5752 374
174 3300046557 Ga0495622_0002352 Ga0495622_0002352_7761_8912 374
175 3300047443 Ga0495687_042879 Ga0495687_042879_253_1404 374
176 3300048088 Ga0495602_0248970 Ga0495602_0248970_97_1248 374
177 3300053093 Ga0500651_0023788 Ga0500651_0023788_265_1416 374
178 3300053109 Ga0500569_000236 Ga0500569_000236_3177_4328 374
179 3300053119 Ga0500595_001423 Ga0500595_001423_6113_7264 374
180 3300053122 Ga0500608_000779 Ga0500608_000779_3132_4283 374
181 3300053123 Ga0500614_011755 Ga0500614_011755_260_1411 374
182 3300053148 Ga0500590_050935 Ga0500590_050935_582_1733 374
183 3300053177 Ga0500636_0029171 Ga0500636_0029171_372_1523 374
184 3300053729 Ga0500625_045537 Ga0500625_045537_283_1434 374
185 3300053735 Ga0500596_000708 Ga0500596_000708_1222_2373 374
186 3300053119 Ga0500595_020157 Ga0500595_020157_1136_2302 375
187 3300006881 Ga0068865_100000097 Ga0068865_10000009722 376
188 3300025909 Ga0207705_10036713 Ga0207705_100367132 376
189 3300025938 Ga0207704_10004976 Ga0207704_100049763 376
190 3300035113 Ga0373936_0002519 Ga0373936_0002519_599_1735 376
191 3300025913 Ga0207695_10000886 Ga0207695_1000088644 377
192 3300046516 Ga0495628_0050499 Ga0495628_0050499_642_1799 377
193 3300005341 Ga0070691_10003772 Ga0070691_100037722 378
194 3300005530 Ga0070679_100013910 Ga0070679_1000139105 378
195 3300009093 Ga0105240_10062295 Ga0105240_100622954 378
196 3300009551 Ga0105238_10060683 Ga0105238_100606832 378
197 3300025913 Ga0207695_10000269 Ga0207695_1000026944 378
198 3300025949 Ga0207667_10186205 Ga0207667_101862052 378
199 3300005327 Ga0070658_10094406 Ga0070658_100944061 380
200 3300005336 Ga0070680_100043044 Ga0070680_1000430443 380
201 3300005366 Ga0070659_100055186 Ga0070659_1000551861 380
202 3300005458 Ga0070681_10004120 Ga0070681_100041207 380
203 3300005539 Ga0068853_100049607 Ga0068853_1000496072 380
204 3300005563 Ga0068855_100037647 Ga0068855_1000376475 380
205 3300009093 Ga0105240_10012645 Ga0105240_100126452 380
206 3300025909 Ga0207705_10002818 Ga0207705_100028183 380
207 3300025917 Ga0207660_10249656 Ga0207660_102496561 380
208 3300025919 Ga0207657_10020981 Ga0207657_100209811 380
209 3300025919 Ga0207657_10077387 Ga0207657_100773872 380
210 3300025921 Ga0207652_10003731 Ga0207652_100037315 380
211 3300025949 Ga0207667_10103327 Ga0207667_101033272 380
212 3300026116 Ga0207674_10113067 Ga0207674_101130672 380

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

61

230

0.98

PF04138

GtrA

GtrA-like protein

298

412

0.95

PF13641

Glyco_tranf_2_3

Glycosyltransferase like family 2

56

246

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dec-assembly1.cif.gz_A-2 crystal structure of glucosyl-3-phosphoglycerate synthase from mycobacterium tuberculosis in complex with mn2+, uridine-diphosphate (udp) and phosphoglyceric acid (pga) 0.7653 26 254
4de7-assembly1.cif.gz_A-2 crystal structure of glucosyl-3-phosphoglycerate synthase from mycobacterium tuberculosis in complex with mg2+ and uridine-diphosphate (udp) 0.7458 26 256
5jt0-assembly1.cif.gz_A crystal structure of glucosyl-3-phosphoglycerate synthase from mycobacterium tuberculosis in complex with mn2+, uridine-diphosphate (udp) and glucosyl-3-phosphoglycerate (gpg) - gpgs*gpg*udp*mn2+ 0.7339 26 256
5jud-assembly1.cif.gz_A-2 crystal structure of glucosyl-3-phosphoglycerate synthase from mycobacterium tuberculosis in complex with uridine-diphosphate (udp) - gpgs*udp 0.7312 26 256
2z86-assembly1.cif.gz_A crystal structure of chondroitin polymerase from escherichia coli strain k4 (k4cp) complexed with udp-glcua and udp 0.7302 25 261
ID Description Score Start End Superfamily
af_A4ICW5_2_228_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8509 27 251 3.90.550.10
af_A4ICW5_2_228_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8404 27 251 3.90.550.10
af_P77757_4_230_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8404 24 251 3.90.550.10
af_Q9VLQ1_42_326_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8188 26 257 3.90.550.10
af_P77757_4_230_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8097 24 251 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A7C4KIH1-F1-model_v4 Glycosyltransferase 0.9607 28 135 GO:0005886
GO:0016757
AF-A0A7C5FNM4-F1-model_v4 Glycosyltransferase 0.9412 25 132 GO:0005886
GO:0016757
AF-A0A840AX79-F1-model_v4 Glycosyltransferase involved in cell wall biosynthesis 0.9096 12 134 GO:0004582
GO:0009247
GO:0016020
AF-A0A1X7MIX0-F1-model_v4 deleted 0.8987 22 125
AF-A0A7C5FNM4-F1-model_v4 Glycosyltransferase 0.8938 25 132 GO:0005886
GO:0016757

Feature Viewer

pLDDT pTM Quality
81.66 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map