F322273

General Info

Members Datasets Scaffolds Average Seq Length
212 182 424 171

Family's Representative Sequence

Representative Sequence 3300001989|JGI24739J22299_10003145|JGI24739J22299_100031453
Length 186
Sequence MPFIGEIRIFAGNFAPVGWEFCKGQLLNISEYDTLFNLIGTTYGGDGFETFALPDLQGRTPLHPGTGPSGDTYQLAETGGTEMVTLTVNNLPAHQHPVTGSLYIPALGENPGTQTTANYPAITSGQQVYSTTKGTDTLATLLVESKAAGQMMQVLPAGGSQPHDNMQPYLVVNFIISLFGEFPSQT

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
12 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
16 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
28 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
29 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
30 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
36 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
37 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
38 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
39 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
40 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
41 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
45 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
48 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
49 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
50 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
51 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
52 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
54 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
56 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
65 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
66 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
67 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
68 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
69 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
70 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
71 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
72 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
73 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
74 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
75 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
76 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
77 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
78 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
79 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
80 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
81 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
82 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
83 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
84 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
85 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
86 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
87 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
88 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
89 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
90 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
91 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
92 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
93 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
94 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
95 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
96 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
97 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
98 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
99 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
100 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
101 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
102 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
103 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
104 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
105 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
106 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
107 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
108 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
109 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
110 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
111 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
112 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
113 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
114 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
115 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
116 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
117 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
118 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
119 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
133 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
134 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
135 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
136 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
137 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
138 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
139 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
140 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
141 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
142 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
143 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
144 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
145 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
146 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300059629 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 186R_SW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
178 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
179 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
180 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
181 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
182 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 78.77
Metatranscriptomes 19.34
Isolates 1.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.81
Nodule 0.47
Rhizoplane 1.89
Rhizosphere 72.17
Stem 0
Stem Tuber 0
Unclassified 2.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10003145 3300001989 Bacteria 6302
2 JGI25152J39213_1001706 3300002773 Bacteria 9025
3 JGI25150J39212_1000027 3300002774 Bacteria 106080
4 JGI25151J46595_10000120 3300003187 Bacteria 106401
5 JGI25153J46596_10000090 3300003215 Bacteria 106197
6 JGI25153J46596_10006923 3300003215 Bacteria 5653
7 rootH2_10212917 3300003320 Bacteria 1782
8 rootH1_10137910 3300003323 Bacteria 5716
9 JGI25160J50197_1001229 3300003354 Bacteria 13008
10 Ga0055532_1002623 3300003758 Bacteria 3569
11 Ga0055526_1000971 3300003771 Bacteria 21175
12 Ga0055526_1002515 3300003771 Bacteria 12333
13 Ga0055526_1006715 3300003771 Bacteria 6168
14 Ga0055537_1002636 3300003773 Bacteria 5869
15 Ga0055528_1000451 3300003790 Bacteria 32870
16 Ga0055530_10009010 3300003791 Bacteria 3898
17 Ga0055530_10039801 3300003791 Bacteria 1159
18 Ga0065165_1000056 3300005262 Bacteria 186730
19 Ga0065703_1022603 3300005272 Bacteria 863
20 Ga0065712_10092407 3300005290 Bacteria 2332
21 Ga0070658_10110772 3300005327 Bacteria 2274
22 Ga0070690_100154229 3300005330 Bacteria 1569
23 Ga0070680_100010205 3300005336 Bacteria 7241
24 Ga0070661_100955860 3300005344 Bacteria 709
25 Ga0070674_100065873 3300005356 Bacteria 2544
26 Ga0070674_100079681 3300005356 Bacteria 2337
27 Ga0070700_100000179 3300005441 Bacteria 35841
28 Ga0070708_100626227 3300005445 Bacteria 1014
29 Ga0070699_100064574 3300005518 Bacteria 3175
30 Ga0070699_100081961 3300005518 Bacteria 2812
31 Ga0070697_100146669 3300005536 Bacteria 1987
32 Ga0070696_100486566 3300005546 Unclassified 979
33 Ga0075364_10076970 3300006051 Bacteria 2202
34 Ga0075367_10873427 3300006178 Bacteria 573
35 Ga0075366_10222508 3300006195 Bacteria 1150
36 Ga0075435_100299447 3300007076 Bacteria 1375
37 Ga0105245_10076383 3300009098 Bacteria 3051
38 Ga0105245_10214007 3300009098 Bacteria 1856
39 Ga0105248_10714873 3300009177 Bacteria 1130
40 Ga0105249_10029395 3300009553 Viruses 4963
41 Ga0105239_10070661 3300010375 Unclassified 3835
42 Ga0157323_1000829 3300012495 Bacteria 1422
43 Ga0157374_10000057 3300013296 Bacteria 117036
44 Ga0157378_11063471 3300013297 Bacteria 845
45 Ga0163162_10436249 3300013306 Bacteria 1442
46 Ga0157376_10000581 3300014969 Bacteria 23586
47 Ga0183373_1003 3300015682 Bacteria 558813
48 Ga0206356_11014522 3300020070 Bacteria 1514
49 Ga0206351_10349948 3300020077 Bacteria 1010
50 Ga0206350_11139133 3300020080 Bacteria 5864
51 Ga0213874_10329872 3300021377 Unclassified 580
52 Ga0224712_10056173 3300022467 Bacteria 1551
53 Ga0209147_100029 3300025229 Bacteria 376498
54 Ga0207425_1000004 3300025245 Bacteria 1092421
55 Ga0207425_1053304 3300025245 Bacteria 732
56 Ga0209129_1000048 3300025258 Bacteria 270192
57 Ga0209565_1000211 3300025263 Bacteria 67436
58 Ga0209673_1001094 3300025273 Bacteria 30458
59 Ga0209673_1008598 3300025273 Bacteria 4527
60 Ga0209673_1020357 3300025273 Bacteria 2352
61 Ga0209025_1000009 3300025294 Bacteria 1092561
62 Ga0209564_1000656 3300025295 Bacteria 51573
63 Ga0209564_1001425 3300025295 Bacteria 24632
64 Ga0209564_1008338 3300025295 Bacteria 5129
65 Ga0209758_1000010 3300025297 Bacteria 1092782
66 Ga0209758_1005059 3300025297 Bacteria 10461
67 Ga0209050_1000427 3300025298 Bacteria 77517
68 Ga0209050_1008420 3300025298 Bacteria 5519
69 Ga0207426_1002550 3300025302 Bacteria 11413
70 Ga0207426_1003723 3300025302 Bacteria 7967
71 Ga0209257_1006415 3300025304 Bacteria 7592
72 Ga0207684_10026555 3300025910 Bacteria 4937
73 Ga0207649_10777238 3300025920 Bacteria 746
74 Ga0207700_10875254 3300025928 Bacteria 804
75 Ga0207669_10064046 3300025937 Bacteria 2273
76 Ga0207711_10519415 3300025941 Bacteria 1110
77 Ga0207712_10189501 3300025961 Viruses 1622
78 Ga0207708_10000036 3300026075 Bacteria 138158
79 Ga0265318_10149178 3300028577 Bacteria 858
80 Ga0265336_10079932 3300028666 Bacteria 976
81 Ga0307516_10227005 3300031730 Bacteria 1573
82 Ga0307415_100628173 3300032126 Bacteria 960
83 Ga0373929_0076680 3300035085 Bacteria 808
84 Ga0373923_0019132 3300035111 Bacteria 2647
85 Ga0373936_0118028 3300035113 Bacteria 1131
86 Ga0373945_0164797 3300035116 Viruses 905
87 Ga0373955_0031560 3300035172 Bacteria 2776
88 Ga0373935_0103130 3300035692 Bacteria 1883
89 Ga0373933_0015219 3300035724 Bacteria 4288
90 Ga0373937_0010746 3300036401 Bacteria 8009
91 Ga0436360_0837118 3300039438 Bacteria 1367
92 Ga0436363_0703847 3300039450 Bacteria 814
93 Ga0436363_1503356 3300039450 Bacteria 4339
94 Ga0466969_0025893 3300044656 Bacteria 3012
95 Ga0453683_0230753 3300044673 Bacteria 1178
96 Ga0466966_0022361 3300044684 Bacteria 4150
97 Ga0466961_0031472 3300044693 Bacteria 3410
98 Ga0466961_0038055 3300044693 Bacteria 3086
99 Ga0466963_0059126 3300044694 Bacteria 2558
100 Ga0466963_0140965 3300044694 Bacteria 1670
101 Ga0466964_0054831 3300044706 Bacteria 1644
102 Ga0453684_0007237 3300044712 Bacteria 20568
103 Ga0453684_0030512 3300044712 Bacteria 7614
104 Ga0466971_0003681 3300044719 Bacteria 6556
105 Ga0466968_0247785 3300044735 Bacteria 845
106 Ga0466970_0158004 3300044765 Bacteria 1253
107 Ga0466957_0045040 3300044842 Bacteria 2674
108 Ga0466959_0001024 3300045049 Bacteria 16672
109 Ga0466959_0014859 3300045049 Bacteria 5668
110 Ga0466958_0032013 3300045836 Bacteria 3126
111 Ga0466967_1180107 3300045976 Unclassified 763
112 Ga0495651_0003356 3300046462 Bacteria 12293
113 Ga0495651_0013742 3300046462 Bacteria 6260
114 Ga0495653_0184465 3300046463 Bacteria 1429
115 Ga0495664_0005580 3300046477 Bacteria 6919
116 Ga0495584_0013456 3300046491 Bacteria 4177
117 Ga0495585_0232756 3300046492 Viruses 925
118 Ga0495596_0015947 3300046500 Bacteria 3129
119 Ga0495628_0126393 3300046516 Bacteria 1959
120 Ga0495628_0241767 3300046516 Bacteria 1350
121 Ga0495630_0380206 3300046517 Bacteria 1082
122 Ga0495652_0825611 3300046529 Bacteria 616
123 Ga0495586_0842368 3300046535 Bacteria 529
124 Ga0495645_0005782 3300046543 Bacteria 8527
125 Ga0495668_0031939 3300046616 Bacteria 2965
126 Ga0495599_0159180 3300046678 Bacteria 1396
127 Ga0495623_0341325 3300046679 Bacteria 818
128 Ga0495646_0334390 3300046680 Bacteria 796
129 Ga0495600_0302482 3300046809 Bacteria 1009
130 Ga0495672_0024487 3300047320 Bacteria 3886
131 Ga0495676_0017287 3300047321 Bacteria 6381
132 Ga0495679_006685 3300047446 Bacteria 4925
133 Ga0495602_0504630 3300048088 Bacteria 845
134 Ga0496110_0008013 3300048913 Bacteria 8468
135 Ga0496111_0179714 3300048914 Bacteria 1573
136 Ga0496115_0011740 3300048918 Bacteria 6578
137 Ga0496115_0015747 3300048918 Bacteria 5743
138 Ga0496118_0143028 3300048921 Bacteria 1512
139 Ga0496121_0427615 3300048924 Bacteria 860
140 Ga0496122_0310314 3300048925 Unclassified 845
141 Ga0496126_0253115 3300048929 Bacteria 1467
142 Ga0501031_0002423 3300049568 Bacteria 11867
143 Ga0501032_0016442 3300049569 Bacteria 5203
144 Ga0501033_0034755 3300049570 Bacteria 3779
145 Ga0501034_0035644 3300049571 Bacteria 5043
146 Ga0501036_0005950 3300049572 Bacteria 9886
147 Ga0501037_0012429 3300049573 Bacteria 6271
148 Ga0501038_0009794 3300049574 Bacteria 8776
149 Ga0501039_0006746 3300049575 Bacteria 8737
150 Ga0501042_0033106 3300049578 Bacteria 3663
151 Ga0501043_0009854 3300049579 Bacteria 7491
152 Ga0501046_0005684 3300049580 Bacteria 11130
153 Ga0501047_0083474 3300049581 Bacteria 3070
154 Ga0501048_0005313 3300049582 Bacteria 9804
155 Ga0501068_0393289 3300049584 Bacteria 893
156 Ga0501070_0300606 3300049586 Bacteria 1307
157 Ga0501073_0922923 3300049589 Bacteria 601
158 Ga0501074_0188168 3300049590 Bacteria 1472
159 Ga0501076_0726205 3300049592 Bacteria 820
160 Ga0501080_0040294 3300049742 Bacteria 4357
161 nmdc:mga0k408_388421_c1 3300050493 Unclassified 831
162 nmdc:mga0k408_74503_c1 3300050493 Bacteria 1983
163 nmdc:mga05p37_428899_c1 3300050507 Bacteria 1536
164 nmdc:mga0n895_762332_c1 3300050512 Bacteria 960
165 nmdc:mga0rr50_379362_c1 3300050513 Bacteria 1192
166 Ga0495655_0045356 3300053083 Viruses 1141
167 Ga0500608_154225 3300053122 Bacteria 1003
168 Ga0500559_0000215 3300053136 Bacteria 46339
169 Ga0500633_0154173 3300053160 Bacteria 861
170 Ga0587084_003424 3300059477 Bacteria 1744
171 Ga0587084_006179 3300059477 Bacteria 1443
172 Ga0587093_002065 3300059478 Bacteria 1812
173 Ga0587066_005194 3300059490 Bacteria 1653
174 Ga0587070_003060 3300059491 Bacteria 1968
175 Ga0587073_0031819 3300059492 Bacteria 1095
176 Ga0587077_005026 3300059493 Bacteria 1781
177 Ga0587077_138340 3300059493 Bacteria 625
178 Ga0587080_020906 3300059503 Bacteria 1073
179 Ga0587083_0028655 3300059505 Bacteria 1091
180 Ga0587085_002957 3300059506 Bacteria 1795
181 Ga0587086_002564 3300059507 Bacteria 1734
182 Ga0587090_005350 3300059510 Bacteria 1605
183 Ga0587091_005158 3300059511 Bacteria 1761
184 Ga0587092_003474 3300059512 Bacteria 1794
185 Ga0587094_003090 3300059513 Bacteria 1782
186 Ga0587095_001178 3300059514 Bacteria 1556
187 Ga0587106_009245 3300059605 Bacteria 1249
188 Ga0587125_025563 3300059607 Bacteria 725
189 Ga0587117_042222 3300059627 Bacteria 730
190 Ga0587127_001133 3300059629 Bacteria 1434
191 Ga0587062_001339 3300059639 Bacteria 2094
192 Ga0587062_006279 3300059639 Bacteria 1345
193 Ga0587062_043573 3300059639 Bacteria 737
194 Ga0587067_009554 3300059640 Bacteria 1449
195 Ga0587068_007341 3300059641 Bacteria 1568
196 Ga0587068_068557 3300059641 Bacteria 696
197 Ga0587069_003044 3300059642 Bacteria 1773
198 Ga0587072_009520 3300059643 Bacteria 1554
199 Ga0587076_003537 3300059645 Bacteria 1871
200 Ga0587076_107671 3300059645 Bacteria 630
201 Ga0587079_007048 3300059647 Bacteria 1666
202 Ga0587100_005584 3300059648 Bacteria 941
203 Ga0587102_006306 3300059649 Bacteria 1074
204 Ga0587110_002049 3300059654 Bacteria 1553
205 Ga0587071_006117 3300060344 Bacteria 1869
206 Ga0587111_0008251 3300060346 Bacteria 1721
207 Ga0501082_0974042 3300060353 Bacteria 742
208 Ga0466962_0001751 3300061719 Bacteria 10210
209 2844003218 2844002411 Bacteria 7168230
210 2889048875 2889042446 Bacteria 7618936
211 2907202226 2907202186 Bacteria 6632024
212 2929208197 2929206907 Bacteria 5918291
213 JGI24739J22299_10003145
214 JGI25152J39213_1001706
215 JGI25150J39212_1000027
216 JGI25151J46595_10000120
217 JGI25153J46596_10000090
218 JGI25153J46596_10006923
219 rootH2_10212917
220 rootH1_10137910
221 JGI25160J50197_1001229
222 Ga0055532_1002623
223 Ga0055526_1000971
224 Ga0055526_1002515
225 Ga0055526_1006715
226 Ga0055537_1002636
227 Ga0055528_1000451
228 Ga0055530_10009010
229 Ga0055530_10039801
230 Ga0065165_1000056
231 Ga0065703_1022603
232 Ga0065712_10092407
233 Ga0070658_10110772
234 Ga0070690_100154229
235 Ga0070680_100010205
236 Ga0070661_100955860
237 Ga0070674_100065873
238 Ga0070674_100079681
239 Ga0070700_100000179
240 Ga0070708_100626227
241 Ga0070699_100064574
242 Ga0070699_100081961
243 Ga0070697_100146669
244 Ga0070696_100486566
245 Ga0075364_10076970
246 Ga0075367_10873427
247 Ga0075366_10222508
248 Ga0075435_100299447
249 Ga0105245_10076383
250 Ga0105245_10214007
251 Ga0105248_10714873
252 Ga0105249_10029395
253 Ga0105239_10070661
254 Ga0157323_1000829
255 Ga0157374_10000057
256 Ga0157378_11063471
257 Ga0163162_10436249
258 Ga0157376_10000581
259 Ga0183373_1003
260 Ga0206356_11014522
261 Ga0206351_10349948
262 Ga0206350_11139133
263 Ga0213874_10329872
264 Ga0224712_10056173
265 Ga0209147_100029
266 Ga0207425_1000004
267 Ga0207425_1053304
268 Ga0209129_1000048
269 Ga0209565_1000211
270 Ga0209673_1001094
271 Ga0209673_1008598
272 Ga0209673_1020357
273 Ga0209025_1000009
274 Ga0209564_1000656
275 Ga0209564_1001425
276 Ga0209564_1008338
277 Ga0209758_1000010
278 Ga0209758_1005059
279 Ga0209050_1000427
280 Ga0209050_1008420
281 Ga0207426_1002550
282 Ga0207426_1003723
283 Ga0209257_1006415
284 Ga0207684_10026555
285 Ga0207649_10777238
286 Ga0207700_10875254
287 Ga0207669_10064046
288 Ga0207711_10519415
289 Ga0207712_10189501
290 Ga0207708_10000036
291 Ga0265318_10149178
292 Ga0265336_10079932
293 Ga0307516_10227005
294 Ga0307415_100628173
295 Ga0373929_0076680
296 Ga0373923_0019132
297 Ga0373936_0118028
298 Ga0373945_0164797
299 Ga0373955_0031560
300 Ga0373935_0103130
301 Ga0373933_0015219
302 Ga0373937_0010746
303 Ga0436360_0837118
304 Ga0436363_0703847
305 Ga0436363_1503356
306 Ga0466969_0025893
307 Ga0453683_0230753
308 Ga0466966_0022361
309 Ga0466961_0031472
310 Ga0466961_0038055
311 Ga0466963_0059126
312 Ga0466963_0140965
313 Ga0466964_0054831
314 Ga0453684_0007237
315 Ga0453684_0030512
316 Ga0466971_0003681
317 Ga0466968_0247785
318 Ga0466970_0158004
319 Ga0466957_0045040
320 Ga0466959_0001024
321 Ga0466959_0014859
322 Ga0466958_0032013
323 Ga0466967_1180107
324 Ga0495651_0003356
325 Ga0495651_0013742
326 Ga0495653_0184465
327 Ga0495664_0005580
328 Ga0495584_0013456
329 Ga0495585_0232756
330 Ga0495596_0015947
331 Ga0495628_0126393
332 Ga0495628_0241767
333 Ga0495630_0380206
334 Ga0495652_0825611
335 Ga0495586_0842368
336 Ga0495645_0005782
337 Ga0495668_0031939
338 Ga0495599_0159180
339 Ga0495623_0341325
340 Ga0495646_0334390
341 Ga0495600_0302482
342 Ga0495672_0024487
343 Ga0495676_0017287
344 Ga0495679_006685
345 Ga0495602_0504630
346 Ga0496110_0008013
347 Ga0496111_0179714
348 Ga0496115_0011740
349 Ga0496115_0015747
350 Ga0496118_0143028
351 Ga0496121_0427615
352 Ga0496122_0310314
353 Ga0496126_0253115
354 Ga0501031_0002423
355 Ga0501032_0016442
356 Ga0501033_0034755
357 Ga0501034_0035644
358 Ga0501036_0005950
359 Ga0501037_0012429
360 Ga0501038_0009794
361 Ga0501039_0006746
362 Ga0501042_0033106
363 Ga0501043_0009854
364 Ga0501046_0005684
365 Ga0501047_0083474
366 Ga0501048_0005313
367 Ga0501068_0393289
368 Ga0501070_0300606
369 Ga0501073_0922923
370 Ga0501074_0188168
371 Ga0501076_0726205
372 Ga0501080_0040294
373 nmdc:mga0k408_388421_c1
374 nmdc:mga0k408_74503_c1
375 nmdc:mga05p37_428899_c1
376 nmdc:mga0n895_762332_c1
377 nmdc:mga0rr50_379362_c1
378 Ga0495655_0045356
379 Ga0500608_154225
380 Ga0500559_0000215
381 Ga0500633_0154173
382 Ga0587084_003424
383 Ga0587084_006179
384 Ga0587093_002065
385 Ga0587066_005194
386 Ga0587070_003060
387 Ga0587073_0031819
388 Ga0587077_005026
389 Ga0587077_138340
390 Ga0587080_020906
391 Ga0587083_0028655
392 Ga0587085_002957
393 Ga0587086_002564
394 Ga0587090_005350
395 Ga0587091_005158
396 Ga0587092_003474
397 Ga0587094_003090
398 Ga0587095_001178
399 Ga0587106_009245
400 Ga0587125_025563
401 Ga0587117_042222
402 Ga0587127_001133
403 Ga0587062_001339
404 Ga0587062_006279
405 Ga0587062_043573
406 Ga0587067_009554
407 Ga0587068_007341
408 Ga0587068_068557
409 Ga0587069_003044
410 Ga0587072_009520
411 Ga0587076_003537
412 Ga0587076_107671
413 Ga0587079_007048
414 Ga0587100_005584
415 Ga0587102_006306
416 Ga0587110_002049
417 Ga0587071_006117
418 Ga0587111_0008251
419 Ga0501082_0974042
420 Ga0466962_0001751
421 2844003218
422 2889048875
423 2907202226
424 2929208197

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07484

Collar

Phage Tail Collar Domain

5

61

0.99

Map