F322247

General Info

Members Datasets Scaffolds Average Seq Length
211 157 194 252

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8055412473|8055414585
Length 251
Sequence LTDRVYVLTGASRGLGYATARCLVADGARVVLSARDADAVAAAAQRLGGPDRVLGLGADLADPETPERLVTAARTHFGRLDGALVSVGGPPPGSAASVTDEQWRHAFETVFLGTVRAVRTVAATLAAGGGGAIGLVLSTSARGPLPGLGISNGLRPGLVGMAKDVADEYGPRGVRVVGLLPGRIMTDRNVELFAATGDPERARAEAEAGIPLRRIGEPAEFGRVAAFVLSPAASYLTGITVPVDGGALRGL

Samples

Sample ID Description Type Environment
1 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
2 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
3 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
4 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
5 2643221576 Nocardioides sp. Root614 Isolate Unclassified
6 2643221590 Nocardioides sp. Root682 Isolate Unclassified
7 2643221641 Nocardioides sp. Root122 Isolate Unclassified
8 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
9 2739367898 Nocardioides sp. CF479 Isolate Unclassified
10 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
11 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
12 2858868258 Micromonospora sp. MH33 Isolate Unclassified
13 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
14 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
15 2902582711 Micromonospora sp. AP08 Isolate Unclassified
16 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
83 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
84 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
85 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
86 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
87 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
88 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
89 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
90 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
91 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
92 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
93 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
94 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
95 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
96 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
97 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
98 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
99 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
100 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
101 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
102 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
103 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
104 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
105 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
106 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
107 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
108 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
109 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
110 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
111 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
112 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
113 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
114 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
115 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
116 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
126 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
127 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
128 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
129 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
130 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
131 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
132 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
133 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
134 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
135 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
136 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
137 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
138 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
139 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
141 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
142 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
143 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
144 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
145 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
146 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
147 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
148 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
149 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
150 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
151 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
152 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
153 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
154 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
155 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
156 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
157 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.47
Metatranscriptomes 0.47
Isolates 8.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.32
Nodule 0.47
Rhizoplane 1.9
Rhizosphere 80.57
Stem 0
Stem Tuber 0
Unclassified 4.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100187824 3300005329 Bacteria 1962
2 Ga0070691_10013052 3300005341 Bacteria 3805
3 Ga0070692_10033270 3300005345 Bacteria 2597
4 Ga0070668_100199575 3300005347 Bacteria 1642
5 Ga0070668_100446516 3300005347 Bacteria 1111
6 Ga0070688_100302926 3300005365 Bacteria 1156
7 Ga0070714_100867087 3300005435 Bacteria 876
8 Ga0070713_100336948 3300005436 Bacteria 1397
9 Ga0070708_100000926 3300005445 Bacteria 22202
10 Ga0070663_100222398 3300005455 Bacteria 1483
11 Ga0068867_100002627 3300005459 Bacteria 12676
12 Ga0070706_100037954 3300005467 Bacteria 4448
13 Ga0070707_100016144 3300005468 Bacteria 7007
14 Ga0070698_100000013 3300005471 Bacteria 114652
15 Ga0070698_100013490 3300005471 Bacteria 8650
16 Ga0070684_100186538 3300005535 Bacteria 1886
17 Ga0068853_100038265 3300005539 Bacteria 4085
18 Ga0070686_100180915 3300005544 Bacteria 1498
19 Ga0068854_100107833 3300005578 Bacteria 2097
20 Ga0070702_100003997 3300005615 Bacteria 6686
21 Ga0068852_100204414 3300005616 Bacteria 1870
22 Ga0068866_10060690 3300005718 Bacteria 1961
23 Ga0081455_10000155 3300005937 Bacteria 82490
24 Ga0081455_10003021 3300005937 Bacteria 19617
25 Ga0081538_10032429 3300005981 Bacteria 3500
26 Ga0081539_10145019 3300005985 Bacteria 1149
27 Ga0070717_10003217 3300006028 Bacteria 11659
28 Ga0075365_10047441 3300006038 Bacteria 2824
29 Ga0075365_10148267 3300006038 Bacteria 1631
30 Ga0075368_10000188 3300006042 Bacteria 16897
31 Ga0075363_100002506 3300006048 Bacteria 7522
32 Ga0075363_100030983 3300006048 Bacteria 2771
33 Ga0075363_100161163 3300006048 Bacteria 1270
34 Ga0075364_10003508 3300006051 Bacteria 8929
35 Ga0075364_10011958 3300006051 Bacteria 5290
36 Ga0070712_100086316 3300006175 Bacteria 2287
37 Ga0075362_10019949 3300006177 Bacteria 2795
38 Ga0075367_10088069 3300006178 Bacteria 1886
39 Ga0075370_10010177 3300006353 Bacteria 4904
40 Ga0075428_100000550 3300006844 Bacteria 38346
41 Ga0075428_100021440 3300006844 Bacteria 7152
42 Ga0075428_100120439 3300006844 Bacteria 2857
43 Ga0075430_100002231 3300006846 Bacteria 16055
44 Ga0075431_100012933 3300006847 Bacteria 8424
45 Ga0075431_100030869 3300006847 Bacteria 5520
46 Ga0075431_100213656 3300006847 Bacteria 1970
47 Ga0075429_100075860 3300006880 Bacteria 2928
48 Ga0075429_100195187 3300006880 Bacteria 1773
49 Ga0068865_100025150 3300006881 Bacteria 3913
50 Ga0111539_10119386 3300009094 Bacteria 3090
51 Ga0105245_10007411 3300009098 Bacteria 9609
52 Ga0114129_10000517 3300009147 Bacteria 47115
53 Ga0114129_10029189 3300009147 Bacteria 7813
54 Ga0114129_10062897 3300009147 Bacteria 5184
55 Ga0105243_10003418 3300009148 Bacteria 12864
56 Ga0105248_10054246 3300009177 Bacteria 4495
57 Ga0105249_10727987 3300009553 Bacteria 1053
58 Ga0157371_10016377 3300013102 Bacteria 5534
59 Ga0157375_10206749 3300013308 Bacteria 2120
60 Ga0163163_10079546 3300014325 Bacteria 3276
61 Ga0157380_10007373 3300014326 Bacteria 7809
62 Ga0182008_10039145 3300014497 Bacteria 2370
63 Ga0157377_10001644 3300014745 Bacteria 9751
64 Ga0206353_10767591 3300020082 Bacteria 865
65 Ga0207697_10122015 3300025315 Bacteria 1122
66 Ga0207688_10023758 3300025901 Bacteria 3360
67 Ga0207684_10011744 3300025910 Bacteria 7641
68 Ga0207693_10168743 3300025915 Bacteria 1723
69 Ga0207646_10008556 3300025922 Bacteria 10235
70 Ga0207687_10020239 3300025927 Bacteria 4414
71 Ga0207690_10013510 3300025932 Bacteria 4908
72 Ga0207704_10034877 3300025938 Bacteria 2876
73 Ga0207691_10000938 3300025940 Bacteria 28954
74 Ga0207661_10601502 3300025944 Bacteria 1009
75 Ga0207661_10826567 3300025944 Bacteria 853
76 Ga0207639_10052207 3300026041 Bacteria 3114
77 Ga0207678_10066540 3300026067 Bacteria 3094
78 Ga0207708_10000379 3300026075 Bacteria 34728
79 Ga0207648_10003882 3300026089 Bacteria 15595
80 Ga0207675_100001224 3300026118 Bacteria 25629
81 Ga0207428_10011810 3300027907 Bacteria 7698
82 Ga0307408_100224886 3300031548 Bacteria 1533
83 Ga0307408_100629048 3300031548 Bacteria 957
84 Ga0307410_10373585 3300031852 Bacteria 1145
85 Ga0307406_10279328 3300031901 Bacteria 1273
86 Ga0307407_10497537 3300031903 Bacteria 893
87 Ga0307409_100010585 3300031995 Bacteria 5748
88 Ga0307409_100388191 3300031995 Bacteria 1330
89 Ga0307409_100473218 3300031995 Bacteria 1214
90 Ga0307416_100394891 3300032002 Bacteria 1418
91 Ga0307416_100467422 3300032002 Bacteria 1318
92 Ga0307416_100897097 3300032002 Bacteria 986
93 Ga0307414_10541610 3300032004 Bacteria 1036
94 Ga0307414_10665548 3300032004 Bacteria 940
95 Ga0307411_10558176 3300032005 Bacteria 978
96 Ga0307411_10815897 3300032005 Bacteria 823
97 Ga0373926_0000514 3300035083 Bacteria 10285
98 Ga0373946_0093180 3300035171 Bacteria 1338
99 Ga0373955_0185189 3300035172 Bacteria 1236
100 Ga0373935_0013389 3300035692 Bacteria 4948
101 Ga0373947_0000001 3300035725 Bacteria 510932
102 Ga0395900_0346876 3300037418 Unclassified 1459
103 Ga0395898_0014295 3300037466 Bacteria 8158
104 Ga0395905_0248227 3300037471 Bacteria 1663
105 Ga0395901_0474327 3300038443 Bacteria 1277
106 Ga0451837_0915454 3300041494 Bacteria 1420
107 Ga0466972_0117806 3300044658 Bacteria 1253
108 Ga0466972_0134687 3300044658 Bacteria 1163
109 Ga0466965_0139405 3300044683 Bacteria 1262
110 Ga0466966_0133818 3300044684 Bacteria 1517
111 Ga0466963_0012219 3300044694 Bacteria 5250
112 Ga0466963_0189879 3300044694 Bacteria 1435
113 Ga0466970_0174406 3300044765 Bacteria 1192
114 Ga0466957_0015231 3300044842 Bacteria 4491
115 Ga0466957_0051105 3300044842 Bacteria 2516
116 Ga0466960_0056796 3300044901 Bacteria 1907
117 Ga0466960_0138329 3300044901 Bacteria 1291
118 Ga0466960_0190719 3300044901 Bacteria 1115
119 Ga0466958_0133586 3300045836 Bacteria 1559
120 Ga0495651_0291755 3300046462 Bacteria 1097
121 Ga0495646_0171856 3300046680 Bacteria 1194
122 Ga0495658_0053367 3300046683 Unclassified 2296
123 Ga0495602_0063472 3300048088 Bacteria 3200
124 Ga0496101_0455972 3300048904 Bacteria 1009
125 Ga0496108_0006366 3300048911 Bacteria 9570
126 Ga0496114_0176684 3300048917 Bacteria 1863
127 Ga0496114_0369390 3300048917 Bacteria 1269
128 Ga0501031_0476139 3300049568 Bacteria 806
129 Ga0501032_0172037 3300049569 Bacteria 1420
130 Ga0501033_0305779 3300049570 Bacteria 1119
131 Ga0501034_0040403 3300049571 Bacteria 4722
132 Ga0501036_0135576 3300049572 Bacteria 2078
133 Ga0501036_0139437 3300049572 Bacteria 2047
134 Ga0501036_0393794 3300049572 Bacteria 1156
135 Ga0501038_0141135 3300049574 Bacteria 1971
136 Ga0501039_0028234 3300049575 Bacteria 4318
137 Ga0501039_0324438 3300049575 Bacteria 1210
138 Ga0501040_0510175 3300049576 Bacteria 867
139 Ga0501046_0136224 3300049580 Bacteria 1860
140 Ga0501067_0009760 3300049583 Bacteria 5312
141 Ga0501067_0017107 3300049583 Bacteria 4006
142 Ga0501068_0005940 3300049584 Bacteria 6702
143 Ga0501068_0322206 3300049584 Bacteria 991
144 Ga0501069_0102558 3300049585 Bacteria 1625
145 Ga0501069_0152105 3300049585 Bacteria 1330
146 Ga0501070_0036139 3300049586 Bacteria 4125
147 Ga0501070_0342965 3300049586 Bacteria 1213
148 Ga0501071_0028920 3300049587 Bacteria 3908
149 Ga0501072_0031485 3300049588 Bacteria 4153
150 Ga0501072_0084198 3300049588 Bacteria 2521
151 Ga0501073_0024892 3300049589 Bacteria 4295
152 Ga0501074_0010032 3300049590 Bacteria 6874
153 Ga0501074_0393448 3300049590 Bacteria 983
154 Ga0501075_0155629 3300049591 Bacteria 1743
155 Ga0501076_0113352 3300049592 Bacteria 2193
156 Ga0501077_0155884 3300049593 Bacteria 1449
157 Ga0501079_0019015 3300049741 Bacteria 5248
158 Ga0501080_0018824 3300049742 Bacteria 6394
159 Ga0501083_0036996 3300049744 Bacteria 3326
160 Ga0501044_0189707 3300049823 Bacteria 2019
161 Ga0501045_0056581 3300049824 Bacteria 2869
162 Ga0501045_0208795 3300049824 Bacteria 1455
163 Ga0501045_0484008 3300049824 Bacteria 919
164 nmdc:mga03n38_22547_c1 3300050490 Bacteria 2551
165 nmdc:mga03n38_95443_c1 3300050490 Bacteria 1424
166 nmdc:mga00v17_217173_c1 3300050491 Bacteria 1238
167 nmdc:mga00v17_3010_c1 3300050491 Bacteria 8660
168 nmdc:mga00v17_48140_c1 3300050491 Bacteria 2583
169 nmdc:mga00v17_92564_c1 3300050491 Bacteria 1900
170 nmdc:mga0yw44_11040_c1 3300050492 Bacteria 4640
171 nmdc:mga0yw44_212595_c1 3300050492 Bacteria 1280
172 nmdc:mga0yw44_3410_c1 3300050492 Bacteria 7055
173 nmdc:mga0yw44_93641_c1 3300050492 Bacteria 1903
174 nmdc:mga06z11_15081_c1 3300050494 Bacteria 3440
175 nmdc:mga04h51_42123_c1 3300050495 Bacteria 1496
176 nmdc:mga07m45_12115_c1 3300050496 Bacteria 4551
177 nmdc:mga05p37_10594_c1 3300050507 Bacteria 10934
178 nmdc:mga05p37_29267_c1 3300050507 Bacteria 6723
179 nmdc:mga05p37_293971_c1 3300050507 Bacteria 1933
180 nmdc:mga09592_11839_c1 3300050508 Bacteria 7095
181 nmdc:mga09592_879_c1 3300050508 Bacteria 23524
182 nmdc:mga0qj67_289019_c1 3300050509 Bacteria 1329
183 nmdc:mga0qj67_66982_c1 3300050509 Bacteria 2861
184 nmdc:mga06r32_106_c1 3300050510 Bacteria 58645
185 nmdc:mga06r32_32725_c1 3300050510 Bacteria 4895
186 nmdc:mga08y16_15931_c1 3300050511 Bacteria 7902
187 nmdc:mga08y16_22570_c1 3300050511 Bacteria 6645
188 Ga0500644_0000047 3300053088 Bacteria 73844
189 Ga0500556_0000676 3300053104 Bacteria 21088
190 Ga0501084_0012903 3300054114 Bacteria 6919
191 Ga0501084_0148513 3300054114 Bacteria 1975
192 Ga0501082_0012185 3300060353 Bacteria 7388
193 Ga0501082_0099350 3300060353 Bacteria 2516
194 Ga0530510_0127010 3300061734 Bacteria 1875

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300032005 Ga0307411_10815897 Ga0307411_108158971 246
2 3300013102 Ga0157371_10016377 Ga0157371_100163772 247
3 3300025932 Ga0207690_10013510 Ga0207690_100135102 247
4 iso_pu_bacteria 2515154088 2515495285 247
5 iso_pu_bacteria 2515154137 2515754763 247
6 iso_pu_bacteria 2515154155 2515850611 247
7 iso_pu_bacteria 2515154203 2516088404 247
8 iso_pu_bacteria 2643221576 2643893614 247
9 iso_pu_bacteria 2643221590 2643962664 247
10 iso_pu_bacteria 2643221641 2644232229 247
11 iso_pu_bacteria 2675903058 2676475176 247
12 iso_pu_bacteria 2739367898 2740169362 247
13 iso_pu_bacteria 2818991472 2819739995 247
14 iso_pu_bacteria 2827628540 2827629891 247
15 iso_pu_bacteria 2858868258 2858871865 247
16 iso_pu_bacteria 2867312974 2867318799 247
17 iso_pu_bacteria 2867319477 2867320788 247
18 iso_pu_bacteria 2902582711 2902585855 247
19 iso_pu_bacteria 2996221748 2996223096 247
20 iso_pu_bacteria 8055412473 8055414585 247
21 3300005985 Ga0081539_10145019 Ga0081539_101450191 248
22 3300049572 Ga0501036_0139437 Ga0501036_0139437_286_1032 248
23 3300005329 Ga0070683_100187824 Ga0070683_1001878241 251
24 3300005341 Ga0070691_10013052 Ga0070691_100130522 251
25 3300005345 Ga0070692_10033270 Ga0070692_100332702 251
26 3300005347 Ga0070668_100199575 Ga0070668_1001995752 251
27 3300005347 Ga0070668_100446516 Ga0070668_1004465161 251
28 3300005365 Ga0070688_100302926 Ga0070688_1003029262 251
29 3300005435 Ga0070714_100867087 Ga0070714_1008670871 251
30 3300005436 Ga0070713_100336948 Ga0070713_1003369482 251
31 3300005445 Ga0070708_100000926 Ga0070708_1000009265 251
32 3300005455 Ga0070663_100222398 Ga0070663_1002223981 251
33 3300005459 Ga0068867_100002627 Ga0068867_1000026277 251
34 3300005467 Ga0070706_100037954 Ga0070706_1000379542 251
35 3300005468 Ga0070707_100016144 Ga0070707_1000161443 251
36 3300005471 Ga0070698_100000013 Ga0070698_10000001389 251
37 3300005471 Ga0070698_100013490 Ga0070698_1000134905 251
38 3300005535 Ga0070684_100186538 Ga0070684_1001865381 251
39 3300005539 Ga0068853_100038265 Ga0068853_1000382653 251
40 3300005544 Ga0070686_100180915 Ga0070686_1001809151 251
41 3300005578 Ga0068854_100107833 Ga0068854_1001078332 251
42 3300005615 Ga0070702_100003997 Ga0070702_1000039974 251
43 3300005616 Ga0068852_100204414 Ga0068852_1002044142 251
44 3300005718 Ga0068866_10060690 Ga0068866_100606902 251
45 3300005937 Ga0081455_10000155 Ga0081455_1000015574 251
46 3300005937 Ga0081455_10003021 Ga0081455_1000302110 251
47 3300005981 Ga0081538_10032429 Ga0081538_100324292 251
48 3300006028 Ga0070717_10003217 Ga0070717_100032173 251
49 3300006038 Ga0075365_10047441 Ga0075365_100474412 251
50 3300006038 Ga0075365_10148267 Ga0075365_101482672 251
51 3300006042 Ga0075368_10000188 Ga0075368_100001882 251
52 3300006048 Ga0075363_100002506 Ga0075363_1000025067 251
53 3300006048 Ga0075363_100030983 Ga0075363_1000309832 251
54 3300006048 Ga0075363_100161163 Ga0075363_1001611631 251
55 3300006051 Ga0075364_10003508 Ga0075364_100035086 251
56 3300006051 Ga0075364_10011958 Ga0075364_100119585 251
57 3300006175 Ga0070712_100086316 Ga0070712_1000863163 251
58 3300006177 Ga0075362_10019949 Ga0075362_100199493 251
59 3300006178 Ga0075367_10088069 Ga0075367_100880692 251
60 3300006353 Ga0075370_10010177 Ga0075370_100101773 251
61 3300006844 Ga0075428_100000550 Ga0075428_10000055023 251
62 3300006844 Ga0075428_100021440 Ga0075428_1000214405 251
63 3300006844 Ga0075428_100120439 Ga0075428_1001204392 251
64 3300006846 Ga0075430_100002231 Ga0075430_1000022319 251
65 3300006847 Ga0075431_100012933 Ga0075431_1000129332 251
66 3300006847 Ga0075431_100030869 Ga0075431_1000308696 251
67 3300006847 Ga0075431_100213656 Ga0075431_1002136562 251
68 3300006880 Ga0075429_100075860 Ga0075429_1000758602 251
69 3300006880 Ga0075429_100195187 Ga0075429_1001951872 251
70 3300006881 Ga0068865_100025150 Ga0068865_1000251507 251
71 3300009094 Ga0111539_10119386 Ga0111539_101193862 251
72 3300009098 Ga0105245_10007411 Ga0105245_100074119 251
73 3300009147 Ga0114129_10000517 Ga0114129_1000051720 251
74 3300009147 Ga0114129_10029189 Ga0114129_100291892 251
75 3300009147 Ga0114129_10062897 Ga0114129_100628976 251
76 3300009148 Ga0105243_10003418 Ga0105243_100034184 251
77 3300009177 Ga0105248_10054246 Ga0105248_100542463 251
78 3300009553 Ga0105249_10727987 Ga0105249_107279871 251
79 3300013308 Ga0157375_10206749 Ga0157375_102067492 251
80 3300014325 Ga0163163_10079546 Ga0163163_100795462 251
81 3300014326 Ga0157380_10007373 Ga0157380_100073739 251
82 3300014497 Ga0182008_10039145 Ga0182008_100391452 251
83 3300014745 Ga0157377_10001644 Ga0157377_100016444 251
84 3300020082 Ga0206353_10767591 Ga0206353_107675911 251
85 3300025315 Ga0207697_10122015 Ga0207697_101220152 251
86 3300025901 Ga0207688_10023758 Ga0207688_100237583 251
87 3300025910 Ga0207684_10011744 Ga0207684_100117443 251
88 3300025915 Ga0207693_10168743 Ga0207693_101687431 251
89 3300025922 Ga0207646_10008556 Ga0207646_100085564 251
90 3300025927 Ga0207687_10020239 Ga0207687_100202393 251
91 3300025938 Ga0207704_10034877 Ga0207704_100348772 251
92 3300025940 Ga0207691_10000938 Ga0207691_1000093817 251
93 3300025944 Ga0207661_10601502 Ga0207661_106015022 251
94 3300025944 Ga0207661_10826567 Ga0207661_108265671 251
95 3300026041 Ga0207639_10052207 Ga0207639_100522073 251
96 3300026067 Ga0207678_10066540 Ga0207678_100665402 251
97 3300026075 Ga0207708_10000379 Ga0207708_1000037934 251
98 3300026089 Ga0207648_10003882 Ga0207648_100038827 251
99 3300026118 Ga0207675_100001224 Ga0207675_10000122414 251
100 3300027907 Ga0207428_10011810 Ga0207428_100118108 251
101 3300031548 Ga0307408_100224886 Ga0307408_1002248862 251
102 3300031548 Ga0307408_100629048 Ga0307408_1006290481 251
103 3300031852 Ga0307410_10373585 Ga0307410_103735852 251
104 3300031901 Ga0307406_10279328 Ga0307406_102793281 251
105 3300031903 Ga0307407_10497537 Ga0307407_104975371 251
106 3300031995 Ga0307409_100010585 Ga0307409_1000105858 251
107 3300031995 Ga0307409_100388191 Ga0307409_1003881912 251
108 3300031995 Ga0307409_100473218 Ga0307409_1004732182 251
109 3300032002 Ga0307416_100394891 Ga0307416_1003948912 251
110 3300032002 Ga0307416_100467422 Ga0307416_1004674222 251
111 3300032002 Ga0307416_100897097 Ga0307416_1008970971 251
112 3300032004 Ga0307414_10541610 Ga0307414_105416101 251
113 3300032004 Ga0307414_10665548 Ga0307414_106655481 251
114 3300032005 Ga0307411_10558176 Ga0307411_105581762 251
115 3300035083 Ga0373926_0000514 Ga0373926_0000514_5717_6523 251
116 3300035171 Ga0373946_0093180 Ga0373946_0093180_107_913 251
117 3300035172 Ga0373955_0185189 Ga0373955_0185189_403_1161 251
118 3300035692 Ga0373935_0013389 Ga0373935_0013389_2490_3296 251
119 3300035725 Ga0373947_0000001 Ga0373947_0000001_119280_120086 251
120 3300037418 Ga0395900_0346876 Ga0395900_0346876_628_1389 251
121 3300037466 Ga0395898_0014295 Ga0395898_0014295_6613_7374 251
122 3300037471 Ga0395905_0248227 Ga0395905_0248227_527_1288 251
123 3300038443 Ga0395901_0474327 Ga0395901_0474327_216_971 251
124 3300041494 Ga0451837_0915454 Ga0451837_0915454_256_1011 251
125 3300044658 Ga0466972_0117806 Ga0466972_0117806_23_793 251
126 3300044658 Ga0466972_0134687 Ga0466972_0134687_240_1010 251
127 3300044683 Ga0466965_0139405 Ga0466965_0139405_304_1074 251
128 3300044684 Ga0466966_0133818 Ga0466966_0133818_397_1167 251
129 3300044694 Ga0466963_0012219 Ga0466963_0012219_2724_3482 251
130 3300044694 Ga0466963_0189879 Ga0466963_0189879_118_876 251
131 3300044765 Ga0466970_0174406 Ga0466970_0174406_298_1056 251
132 3300044842 Ga0466957_0015231 Ga0466957_0015231_1816_2574 251
133 3300044842 Ga0466957_0051105 Ga0466957_0051105_625_1380 251
134 3300044901 Ga0466960_0056796 Ga0466960_0056796_621_1391 251
135 3300044901 Ga0466960_0138329 Ga0466960_0138329_383_1141 251
136 3300044901 Ga0466960_0190719 Ga0466960_0190719_339_1097 251
137 3300045836 Ga0466958_0133586 Ga0466958_0133586_377_1135 251
138 3300046462 Ga0495651_0291755 Ga0495651_0291755_221_979 251
139 3300046680 Ga0495646_0171856 Ga0495646_0171856_418_1176 251
140 3300046683 Ga0495658_0053367 Ga0495658_0053367_986_1747 251
141 3300048088 Ga0495602_0063472 Ga0495602_0063472_1767_2525 251
142 3300048904 Ga0496101_0455972 Ga0496101_0455972_114_869 251
143 3300048911 Ga0496108_0006366 Ga0496108_0006366_7795_8550 251
144 3300048917 Ga0496114_0176684 Ga0496114_0176684_240_995 251
145 3300048917 Ga0496114_0369390 Ga0496114_0369390_444_1199 251
146 3300049568 Ga0501031_0476139 Ga0501031_0476139_29_784 251
147 3300049569 Ga0501032_0172037 Ga0501032_0172037_40_795 251
148 3300049570 Ga0501033_0305779 Ga0501033_0305779_200_958 251
149 3300049571 Ga0501034_0040403 Ga0501034_0040403_670_1428 251
150 3300049572 Ga0501036_0135576 Ga0501036_0135576_1230_1985 251
151 3300049572 Ga0501036_0393794 Ga0501036_0393794_143_901 251
152 3300049574 Ga0501038_0141135 Ga0501038_0141135_617_1372 251
153 3300049575 Ga0501039_0028234 Ga0501039_0028234_2487_3242 251
154 3300049575 Ga0501039_0324438 Ga0501039_0324438_114_869 251
155 3300049576 Ga0501040_0510175 Ga0501040_0510175_95_850 251
156 3300049580 Ga0501046_0136224 Ga0501046_0136224_624_1379 251
157 3300049583 Ga0501067_0009760 Ga0501067_0009760_1699_2457 251
158 3300049583 Ga0501067_0017107 Ga0501067_0017107_951_1706 251
159 3300049584 Ga0501068_0005940 Ga0501068_0005940_1541_2299 251
160 3300049584 Ga0501068_0322206 Ga0501068_0322206_156_917 251
161 3300049585 Ga0501069_0102558 Ga0501069_0102558_730_1485 251
162 3300049585 Ga0501069_0152105 Ga0501069_0152105_431_1186 251
163 3300049586 Ga0501070_0036139 Ga0501070_0036139_1874_2632 251
164 3300049586 Ga0501070_0342965 Ga0501070_0342965_199_954 251
165 3300049587 Ga0501071_0028920 Ga0501071_0028920_2481_3236 251
166 3300049588 Ga0501072_0031485 Ga0501072_0031485_918_1673 251
167 3300049588 Ga0501072_0084198 Ga0501072_0084198_52_810 251
168 3300049589 Ga0501073_0024892 Ga0501073_0024892_682_1440 251
169 3300049590 Ga0501074_0010032 Ga0501074_0010032_4676_5434 251
170 3300049590 Ga0501074_0393448 Ga0501074_0393448_70_825 251
171 3300049591 Ga0501075_0155629 Ga0501075_0155629_632_1387 251
172 3300049592 Ga0501076_0113352 Ga0501076_0113352_602_1360 251
173 3300049593 Ga0501077_0155884 Ga0501077_0155884_160_918 251
174 3300049741 Ga0501079_0019015 Ga0501079_0019015_3034_3792 251
175 3300049742 Ga0501080_0018824 Ga0501080_0018824_3763_4521 251
176 3300049744 Ga0501083_0036996 Ga0501083_0036996_670_1428 251
177 3300049823 Ga0501044_0189707 Ga0501044_0189707_773_1534 251
178 3300049824 Ga0501045_0056581 Ga0501045_0056581_1773_2528 251
179 3300049824 Ga0501045_0208795 Ga0501045_0208795_207_965 251
180 3300049824 Ga0501045_0484008 Ga0501045_0484008_126_884 251
181 3300050490 nmdc:mga03n38_22547_c1 nmdc:mga03n38_22547_c1_1248_2003 251
182 3300050490 nmdc:mga03n38_95443_c1 nmdc:mga03n38_95443_c1_61_816 251
183 3300050491 nmdc:mga00v17_217173_c1 nmdc:mga00v17_217173_c1_347_1102 251
184 3300050491 nmdc:mga00v17_3010_c1 nmdc:mga00v17_3010_c1_861_1616 251
185 3300050491 nmdc:mga00v17_48140_c1 nmdc:mga00v17_48140_c1_1331_2086 251
186 3300050491 nmdc:mga00v17_92564_c1 nmdc:mga00v17_92564_c1_35_805 251
187 3300050492 nmdc:mga0yw44_11040_c1 nmdc:mga0yw44_11040_c1_2489_3244 251
188 3300050492 nmdc:mga0yw44_212595_c1 nmdc:mga0yw44_212595_c1_74_829 251
189 3300050492 nmdc:mga0yw44_3410_c1 nmdc:mga0yw44_3410_c1_1918_2673 251
190 3300050492 nmdc:mga0yw44_93641_c1 nmdc:mga0yw44_93641_c1_349_1104 251
191 3300050494 nmdc:mga06z11_15081_c1 nmdc:mga06z11_15081_c1_1367_2122 251
192 3300050495 nmdc:mga04h51_42123_c1 nmdc:mga04h51_42123_c1_30_785 251
193 3300050496 nmdc:mga07m45_12115_c1 nmdc:mga07m45_12115_c1_1988_2743 251
194 3300050507 nmdc:mga05p37_10594_c1 nmdc:mga05p37_10594_c1_5303_6061 251
195 3300050507 nmdc:mga05p37_29267_c1 nmdc:mga05p37_29267_c1_3192_3950 251
196 3300050507 nmdc:mga05p37_293971_c1 nmdc:mga05p37_293971_c1_1123_1881 251
197 3300050508 nmdc:mga09592_11839_c1 nmdc:mga09592_11839_c1_163_921 251
198 3300050508 nmdc:mga09592_879_c1 nmdc:mga09592_879_c1_11871_12629 251
199 3300050509 nmdc:mga0qj67_289019_c1 nmdc:mga0qj67_289019_c1_298_1056 251
200 3300050509 nmdc:mga0qj67_66982_c1 nmdc:mga0qj67_66982_c1_48_806 251
201 3300050510 nmdc:mga06r32_106_c1 nmdc:mga06r32_106_c1_48702_49460 251
202 3300050510 nmdc:mga06r32_32725_c1 nmdc:mga06r32_32725_c1_1241_1999 251
203 3300050511 nmdc:mga08y16_15931_c1 nmdc:mga08y16_15931_c1_2695_3453 251
204 3300050511 nmdc:mga08y16_22570_c1 nmdc:mga08y16_22570_c1_5788_6543 251
205 3300053088 Ga0500644_0000047 Ga0500644_0000047_29863_30618 251
206 3300053104 Ga0500556_0000676 Ga0500556_0000676_17305_18060 251
207 3300054114 Ga0501084_0012903 Ga0501084_0012903_3372_4130 251
208 3300054114 Ga0501084_0148513 Ga0501084_0148513_903_1658 251
209 3300060353 Ga0501082_0012185 Ga0501082_0012185_1981_2739 251
210 3300060353 Ga0501082_0099350 Ga0501082_0099350_1577_2332 251
211 3300061734 Ga0530510_0127010 Ga0530510_0127010_604_1359 251

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

4

197

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

10

247

0.91

PF08659

KR

KR domain

4

124

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ihi-assembly1.cif.gz_D crystal structure of rasadh 3b3/i91v from ralstonia.sp in complex with nadph and a6o 0.9593 5 250
4i5d-assembly1.cif.gz_A crystal structure of ralstonia sp. alcohol dehydrogenase in its apo form 0.955 3 250
4bmn-assembly1.cif.gz_D apo structure of short-chain alcohol dehydrogenase from ralstonia sp. dsm 6428 0.955 3 250
5itv-assembly1.cif.gz_A crystal structure of bacillus subtilis bacc dihydroanticapsin 7-dehydrogenase in complex with nadh 0.9539 1 247
4fgs-assembly1.cif.gz_D crystal structure of a probable dehydrogenase protein 0.9516 5 247
ID Description Score Start End Superfamily
af_A0A0P0X9U1_21_128_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9585 2 85 3.40.50.720
5itvA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9539 1 247 3.40.50.720
1iy8A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9441 6 246 3.40.50.720
5t5qC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9431 6 250 3.40.50.720
4ni5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9419 5 248 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A387HRM3-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] reductase FabG (EC 1.1.1.100) 0.9886 1 247 GO:0004316
AF-A0A7K3HL56-F1-model_v4 SDR family oxidoreductase 0.9874 1 251 GO:0016491
AF-A0A4R1W5U3-F1-model_v4 3-oxoacyl-[acyl-carrier protein] reductase 0.9874 2 251 GO:0016491
AF-A0A7K2L3V7-F1-model_v4 SDR family oxidoreductase 0.9853 1 251 GO:0016491
AF-A0A7K3HL56-F1-model_v4 SDR family oxidoreductase 0.9835 1 251 GO:0016491

Feature Viewer

pLDDT pTM Quality
93.78 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map