F322165

General Info

Members Datasets Scaffolds Average Seq Length
211 135 422 119

Family's Representative Sequence

Representative Sequence 3300053118|Ga0500594_0211149|Ga0500594_0211149_88_519
Length 143
Sequence VIIIYSVISYPGNQPGKTFFMNIEELRDYCLQKPGAVEEFPFGPDTLVFKVGGKLFLLAGLTEGDRFNAKCDPELAIEWRERYAEVQPGYHMNKKHWNTVYMNGSLTGKQLRELIDHSYELVSKSLPGKGRKNQGHKRGLGNL

Samples

Sample ID Description Type Environment
1 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
23 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
24 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
25 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
26 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
27 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
30 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
34 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
35 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
43 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
44 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
45 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
46 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
48 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
49 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
50 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
52 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
72 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
73 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
74 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
75 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
76 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
77 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
78 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
79 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
80 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
81 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
82 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
83 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
84 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
85 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
86 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
87 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
88 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
89 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
90 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
91 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
92 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
93 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
94 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
95 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
96 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
97 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
98 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
99 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
100 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
101 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
102 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
103 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
104 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
105 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
106 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
107 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
108 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
109 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
110 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
111 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
112 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
113 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
114 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
115 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
116 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
117 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
118 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
119 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
120 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
121 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
122 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
123 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
124 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
125 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
126 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
127 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
128 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
129 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
130 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
131 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
132 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
133 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
134 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
135 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.1
Metatranscriptomes 0.95
Isolates 0.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.43
Nodule 0
Rhizoplane 0.95
Rhizosphere 81.99
Stem 0
Stem Tuber 0
Unclassified 6.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500594_0211149 3300053118 Bacteria 640
2 JGI24739J22299_10136040 3300001989 Bacteria 730
3 JGI24737J22298_10000485 3300001990 Bacteria 13799
4 JGI24735J21928_10000017 3300002067 Bacteria 114440
5 JGI25162J39368_1000055 3300002737 Bacteria 147236
6 rootL2_10157553 3300003322 Bacteria 11066
7 rootL2_10281899 3300003322 Bacteria 2620
8 JGI25160J50197_1000262 3300003354 Bacteria 39642
9 Ga0058862_10242068 3300004803 Bacteria 3027
10 Ga0070670_100775597 3300005331 Bacteria 865
11 Ga0070680_100017601 3300005336 Bacteria 5637
12 Ga0070660_100076766 3300005339 Bacteria 2617
13 Ga0070674_100066205 3300005356 Bacteria 2538
14 Ga0070659_100315846 3300005366 Bacteria 1305
15 Ga0070662_100000062 3300005457 Bacteria 57251
16 Ga0070662_100467290 3300005457 Bacteria 1049
17 Ga0070681_11582657 3300005458 Unclassified 581
18 Ga0070681_11818160 3300005458 Bacteria 536
19 Ga0070706_100083239 3300005467 Unclassified 2964
20 Ga0070707_100000765 3300005468 Bacteria 31778
21 Ga0070707_100051250 3300005468 Bacteria 3957
22 Ga0070679_100008020 3300005530 Bacteria 9918
23 Ga0070679_100592126 3300005530 Bacteria 1052
24 Ga0070693_101323636 3300005547 Unclassified 557
25 Ga0068855_100009987 3300005563 Bacteria 11440
26 Ga0068856_100963317 3300005614 Bacteria 872
27 Ga0075369_10231501 3300006186 Bacteria 856
28 Ga0075366_10007114 3300006195 Bacteria 6161
29 Ga0068871_100822929 3300006358 Bacteria 857
30 Ga0075436_101169468 3300006914 Bacteria 580
31 Ga0075435_100118528 3300007076 Bacteria 2206
32 Ga0105251_10310085 3300009011 Bacteria 716
33 Ga0105240_10000515 3300009093 Bacteria 71183
34 Ga0105240_10010684 3300009093 Bacteria 12883
35 Ga0105240_10018105 3300009093 Bacteria 9472
36 Ga0105240_10056377 3300009093 Bacteria 4918
37 Ga0105240_10455639 3300009093 Bacteria 1430
38 Ga0105240_10652614 3300009093 Bacteria 1153
39 Ga0105241_10000282 3300009174 Bacteria 37799
40 Ga0105241_10107492 3300009174 Bacteria 2228
41 Ga0105241_10168029 3300009174 Bacteria 1809
42 Ga0105241_11200426 3300009174 Bacteria 718
43 Ga0105237_10000400 3300009545 Bacteria 61626
44 Ga0105237_10033045 3300009545 Bacteria 5240
45 Ga0105237_10210470 3300009545 Bacteria 1944
46 Ga0105237_11480794 3300009545 Bacteria 685
47 Ga0105237_11713595 3300009545 Bacteria 636
48 Ga0105238_10092350 3300009551 Bacteria 3014
49 Ga0105239_10000764 3300010375 Bacteria 45433
50 Ga0105239_10001703 3300010375 Bacteria 28972
51 Ga0105239_10020781 3300010375 Bacteria 7245
52 Ga0105239_10041746 3300010375 Bacteria 5027
53 Ga0105239_10059414 3300010375 Bacteria 4196
54 Ga0105239_10128277 3300010375 Bacteria 2820
55 Ga0105239_10186197 3300010375 Bacteria 2323
56 Ga0105239_11540357 3300010375 Bacteria 768
57 Ga0105246_10030304 3300011119 Bacteria 3572
58 Ga0105246_10157280 3300011119 Bacteria 1728
59 Ga0157373_10006493 3300013100 Bacteria 8728
60 Ga0157373_10451974 3300013100 Bacteria 925
61 Ga0157371_10002932 3300013102 Bacteria 15914
62 Ga0157371_10066828 3300013102 Bacteria 2545
63 Ga0157370_10000865 3300013104 Bacteria 38427
64 Ga0157370_10080273 3300013104 Bacteria 3071
65 Ga0157370_10086588 3300013104 Bacteria 2943
66 Ga0157370_10401419 3300013104 Bacteria 1262
67 Ga0157370_10621350 3300013104 Bacteria 989
68 Ga0157369_10000101 3300013105 Bacteria 118683
69 Ga0157369_10123904 3300013105 Bacteria 2741
70 Ga0157369_10182964 3300013105 Bacteria 2205
71 Ga0157369_10856772 3300013105 Bacteria 933
72 Ga0157369_11299796 3300013105 Bacteria 741
73 Ga0157374_10001470 3300013296 Bacteria 19891
74 Ga0163162_10025964 3300013306 Bacteria 5789
75 Ga0157372_10000041 3300013307 Bacteria 158494
76 Ga0157372_10000856 3300013307 Bacteria 33028
77 Ga0157372_10006390 3300013307 Bacteria 12536
78 Ga0157372_10016400 3300013307 Bacteria 7948
79 Ga0157372_11358182 3300013307 Bacteria 820
80 Ga0157375_10090716 3300013308 Bacteria 3115
81 Ga0182008_10000299 3300014497 Bacteria 38806
82 Ga0157379_11658782 3300014968 Unclassified 625
83 Ga0157376_10335867 3300014969 Bacteria 1441
84 Ga0163161_10053863 3300017792 Bacteria 2918
85 Ga0163161_10212763 3300017792 Bacteria 1494
86 Ga0206351_10467604 3300020077 Bacteria 620
87 Ga0209437_100130 3300025233 Bacteria 183731
88 Ga0209026_1001481 3300025250 Bacteria 10344
89 Ga0209129_1009688 3300025258 Bacteria 2500
90 Ga0209455_1035814 3300025272 Bacteria 795
91 Ga0207426_1000059 3300025302 Bacteria 363842
92 Ga0207647_10000012 3300025904 Bacteria 152879
93 Ga0207647_10019177 3300025904 Bacteria 4604
94 Ga0207684_10274945 3300025910 Bacteria 1453
95 Ga0207654_10004075 3300025911 Bacteria 7361
96 Ga0207654_10041603 3300025911 Bacteria 2596
97 Ga0207654_10316712 3300025911 Bacteria 1065
98 Ga0207654_10789831 3300025911 Bacteria 685
99 Ga0207707_10036950 3300025912 Bacteria 4268
100 Ga0207695_10000267 3300025913 Bacteria 131133
101 Ga0207695_10004146 3300025913 Bacteria 19899
102 Ga0207695_10015376 3300025913 Bacteria 9008
103 Ga0207695_10200552 3300025913 Bacteria 1909
104 Ga0207695_10315691 3300025913 Bacteria 1452
105 Ga0207695_10514900 3300025913 Bacteria 1078
106 Ga0207671_10000244 3300025914 Bacteria 81258
107 Ga0207671_10008259 3300025914 Bacteria 8857
108 Ga0207671_10038951 3300025914 Bacteria 3521
109 Ga0207671_10132704 3300025914 Bacteria 1913
110 Ga0207660_10007508 3300025917 Bacteria 7056
111 Ga0207657_10086890 3300025919 Bacteria 2617
112 Ga0207652_10124385 3300025921 Bacteria 2297
113 Ga0207652_10503784 3300025921 Bacteria 1090
114 Ga0207646_10009863 3300025922 Bacteria 9400
115 Ga0207694_10448113 3300025924 Unclassified 1077
116 Ga0207706_10000430 3300025933 Bacteria 44993
117 Ga0207667_10000014 3300025949 Bacteria 421261
118 Ga0207667_10027882 3300025949 Bacteria 6139
119 Ga0207667_10657229 3300025949 Unclassified 1053
120 Ga0207640_10012433 3300025981 Bacteria 4846
121 Ga0207677_10161177 3300026023 Bacteria 1743
122 Ga0207703_11797741 3300026035 Bacteria 589
123 Ga0207639_10359851 3300026041 Bacteria 1302
124 Ga0207702_10022105 3300026078 Bacteria 5270
125 Ga0207702_10780374 3300026078 Bacteria 944
126 Ga0207702_11264861 3300026078 Bacteria 732
127 Ga0207698_10293063 3300026142 Bacteria 1511
128 Ga0307515_10031449 3300028794 Bacteria 8849
129 Ga0265338_10017682 3300028800 Bacteria 7668
130 Ga0265327_10242946 3300031251 Unclassified 804
131 Ga0307513_10617032 3300031456 Unclassified 793
132 Ga0307509_10015731 3300031507 Bacteria 8807
133 Ga0307509_10069425 3300031507 Bacteria 3683
134 Ga0307509_10414698 3300031507 Unclassified 1049
135 Ga0307508_10000294 3300031616 Bacteria 61066
136 Ga0307508_10248324 3300031616 Bacteria 1376
137 Ga0316576_10690959 3300031727 Bacteria 740
138 Ga0307413_11515372 3300031824 Bacteria 593
139 Ga0307412_10044378 3300031911 Bacteria 2900
140 Ga0307412_11665147 3300031911 Unclassified 584
141 Ga0307414_10006652 3300032004 Bacteria 6463
142 Ga0373947_0641772 3300035725 Bacteria 724
143 Ga0395899_0000024 3300037312 Bacteria 357402
144 Ga0395901_1550315 3300038443 Bacteria 617
145 Ga0451791_0709372 3300041451 Bacteria 953
146 Ga0451807_0467592 3300041486 Bacteria 1168
147 Ga0466969_0025984 3300044656 Bacteria 3006
148 Ga0466966_0070817 3300044684 Bacteria 2185
149 Ga0466961_0004369 3300044693 Bacteria 8858
150 Ga0453684_0002226 3300044712 Bacteria 48082
151 Ga0453684_1835435 3300044712 Bacteria 615
152 Ga0451576_0461736 3300045051 Bacteria 1333
153 Ga0466958_0014756 3300045836 Bacteria 4463
154 Ga0495638_0052915 3300046460 Bacteria 2528
155 Ga0495638_0288831 3300046460 Bacteria 888
156 Ga0495651_0362956 3300046462 Bacteria 954
157 Ga0495650_0000050 3300046471 Bacteria 318894
158 Ga0495580_0902914 3300046472 Bacteria 568
159 Ga0495585_0000100 3300046492 Bacteria 91669
160 Ga0495583_0013383 3300046506 Bacteria 4579
161 Ga0495583_0134895 3300046506 Bacteria 1031
162 Ga0495606_0000505 3300046507 Bacteria 63449
163 Ga0495610_0000167 3300046512 Bacteria 73458
164 Ga0495610_0241089 3300046512 Bacteria 721
165 Ga0495616_0000987 3300046513 Bacteria 20375
166 Ga0495616_0002517 3300046513 Bacteria 12118
167 Ga0495637_0020290 3300046520 Bacteria 3060
168 Ga0495637_0121358 3300046520 Bacteria 1005
169 Ga0495648_0070375 3300046524 Bacteria 2033
170 Ga0495609_0052854 3300046538 Bacteria 1807
171 Ga0495633_0054891 3300046558 Bacteria 1873
172 Ga0495668_0006901 3300046616 Bacteria 7354
173 Ga0495668_0089675 3300046616 Bacteria 1685
174 Ga0495625_0000077 3300046660 Bacteria 163166
175 Ga0495625_0011030 3300046660 Bacteria 7409
176 Ga0495625_0015724 3300046660 Bacteria 5978
177 Ga0495625_0060129 3300046660 Bacteria 2693
178 Ga0495661_0107857 3300046665 Bacteria 1556
179 Ga0495613_0518487 3300046689 Bacteria 801
180 Ga0495671_0142715 3300046692 Bacteria 1167
181 Ga0495671_0255937 3300046692 Bacteria 845
182 Ga0495649_0000011 3300046694 Bacteria 416695
183 Ga0495649_0041461 3300046694 Bacteria 2518
184 Ga0495649_0153740 3300046694 Bacteria 1208
185 Ga0495660_0003243 3300046810 Bacteria 10113
186 Ga0495683_0161416 3300047323 Bacteria 1036
187 Ga0495687_000556 3300047443 Bacteria 44028
188 Ga0495687_001943 3300047443 Bacteria 17724
189 Ga0495679_043917 3300047446 Bacteria 1371
190 Ga0495673_0019128 3300047469 Bacteria 3437
191 Ga0495686_0047569 3300047472 Bacteria 2708
192 Ga0496122_0001441 3300048925 Bacteria 38496
193 Ga0496123_0044648 3300048926 Bacteria 3029
194 Ga0496125_0253224 3300048928 Bacteria 1109
195 Ga0495678_043919 3300049459 Unclassified 1771
196 nmdc:mga0k408_2000_c1 3300050493 Bacteria 10942
197 nmdc:mga0rr50_682162_c1 3300050513 Bacteria 877
198 nmdc:mga0sz30_214072_c1 3300050516 Bacteria 856
199 Ga0500635_0005985 3300053080 Bacteria 3227
200 Ga0500647_0113593 3300053091 Bacteria 1286
201 Ga0500597_423666 3300053120 Unclassified 501
202 Ga0500608_191530 3300053122 Bacteria 855
203 Ga0500618_007925 3300053125 Bacteria 3000
204 Ga0500618_078216 3300053125 Bacteria 742
205 Ga0500652_253346 3300053131 Bacteria 696
206 Ga0500564_076864 3300053138 Unclassified 1501
207 Ga0500588_0006182 3300053146 Bacteria 2699
208 Ga0500622_0193299 3300053156 Bacteria 931
209 Ga0500624_000334 3300053157 Bacteria 15832
210 2919439506 2919437846 Bacteria 6199444
211 2977234745 2977232053 Bacteria 5485925
212 Ga0500594_0211149
213 JGI24739J22299_10136040
214 JGI24737J22298_10000485
215 JGI24735J21928_10000017
216 JGI25162J39368_1000055
217 rootL2_10157553
218 rootL2_10281899
219 JGI25160J50197_1000262
220 Ga0058862_10242068
221 Ga0070670_100775597
222 Ga0070680_100017601
223 Ga0070660_100076766
224 Ga0070674_100066205
225 Ga0070659_100315846
226 Ga0070662_100000062
227 Ga0070662_100467290
228 Ga0070681_11582657
229 Ga0070681_11818160
230 Ga0070706_100083239
231 Ga0070707_100000765
232 Ga0070707_100051250
233 Ga0070679_100008020
234 Ga0070679_100592126
235 Ga0070693_101323636
236 Ga0068855_100009987
237 Ga0068856_100963317
238 Ga0075369_10231501
239 Ga0075366_10007114
240 Ga0068871_100822929
241 Ga0075436_101169468
242 Ga0075435_100118528
243 Ga0105251_10310085
244 Ga0105240_10000515
245 Ga0105240_10010684
246 Ga0105240_10018105
247 Ga0105240_10056377
248 Ga0105240_10455639
249 Ga0105240_10652614
250 Ga0105241_10000282
251 Ga0105241_10107492
252 Ga0105241_10168029
253 Ga0105241_11200426
254 Ga0105237_10000400
255 Ga0105237_10033045
256 Ga0105237_10210470
257 Ga0105237_11480794
258 Ga0105237_11713595
259 Ga0105238_10092350
260 Ga0105239_10000764
261 Ga0105239_10001703
262 Ga0105239_10020781
263 Ga0105239_10041746
264 Ga0105239_10059414
265 Ga0105239_10128277
266 Ga0105239_10186197
267 Ga0105239_11540357
268 Ga0105246_10030304
269 Ga0105246_10157280
270 Ga0157373_10006493
271 Ga0157373_10451974
272 Ga0157371_10002932
273 Ga0157371_10066828
274 Ga0157370_10000865
275 Ga0157370_10080273
276 Ga0157370_10086588
277 Ga0157370_10401419
278 Ga0157370_10621350
279 Ga0157369_10000101
280 Ga0157369_10123904
281 Ga0157369_10182964
282 Ga0157369_10856772
283 Ga0157369_11299796
284 Ga0157374_10001470
285 Ga0163162_10025964
286 Ga0157372_10000041
287 Ga0157372_10000856
288 Ga0157372_10006390
289 Ga0157372_10016400
290 Ga0157372_11358182
291 Ga0157375_10090716
292 Ga0182008_10000299
293 Ga0157379_11658782
294 Ga0157376_10335867
295 Ga0163161_10053863
296 Ga0163161_10212763
297 Ga0206351_10467604
298 Ga0209437_100130
299 Ga0209026_1001481
300 Ga0209129_1009688
301 Ga0209455_1035814
302 Ga0207426_1000059
303 Ga0207647_10000012
304 Ga0207647_10019177
305 Ga0207684_10274945
306 Ga0207654_10004075
307 Ga0207654_10041603
308 Ga0207654_10316712
309 Ga0207654_10789831
310 Ga0207707_10036950
311 Ga0207695_10000267
312 Ga0207695_10004146
313 Ga0207695_10015376
314 Ga0207695_10200552
315 Ga0207695_10315691
316 Ga0207695_10514900
317 Ga0207671_10000244
318 Ga0207671_10008259
319 Ga0207671_10038951
320 Ga0207671_10132704
321 Ga0207660_10007508
322 Ga0207657_10086890
323 Ga0207652_10124385
324 Ga0207652_10503784
325 Ga0207646_10009863
326 Ga0207694_10448113
327 Ga0207706_10000430
328 Ga0207667_10000014
329 Ga0207667_10027882
330 Ga0207667_10657229
331 Ga0207640_10012433
332 Ga0207677_10161177
333 Ga0207703_11797741
334 Ga0207639_10359851
335 Ga0207702_10022105
336 Ga0207702_10780374
337 Ga0207702_11264861
338 Ga0207698_10293063
339 Ga0307515_10031449
340 Ga0265338_10017682
341 Ga0265327_10242946
342 Ga0307513_10617032
343 Ga0307509_10015731
344 Ga0307509_10069425
345 Ga0307509_10414698
346 Ga0307508_10000294
347 Ga0307508_10248324
348 Ga0316576_10690959
349 Ga0307413_11515372
350 Ga0307412_10044378
351 Ga0307412_11665147
352 Ga0307414_10006652
353 Ga0373947_0641772
354 Ga0395899_0000024
355 Ga0395901_1550315
356 Ga0451791_0709372
357 Ga0451807_0467592
358 Ga0466969_0025984
359 Ga0466966_0070817
360 Ga0466961_0004369
361 Ga0453684_0002226
362 Ga0453684_1835435
363 Ga0451576_0461736
364 Ga0466958_0014756
365 Ga0495638_0052915
366 Ga0495638_0288831
367 Ga0495651_0362956
368 Ga0495650_0000050
369 Ga0495580_0902914
370 Ga0495585_0000100
371 Ga0495583_0013383
372 Ga0495583_0134895
373 Ga0495606_0000505
374 Ga0495610_0000167
375 Ga0495610_0241089
376 Ga0495616_0000987
377 Ga0495616_0002517
378 Ga0495637_0020290
379 Ga0495637_0121358
380 Ga0495648_0070375
381 Ga0495609_0052854
382 Ga0495633_0054891
383 Ga0495668_0006901
384 Ga0495668_0089675
385 Ga0495625_0000077
386 Ga0495625_0011030
387 Ga0495625_0015724
388 Ga0495625_0060129
389 Ga0495661_0107857
390 Ga0495613_0518487
391 Ga0495671_0142715
392 Ga0495671_0255937
393 Ga0495649_0000011
394 Ga0495649_0041461
395 Ga0495649_0153740
396 Ga0495660_0003243
397 Ga0495683_0161416
398 Ga0495687_000556
399 Ga0495687_001943
400 Ga0495679_043917
401 Ga0495673_0019128
402 Ga0495686_0047569
403 Ga0496122_0001441
404 Ga0496123_0044648
405 Ga0496125_0253224
406 Ga0495678_043919
407 nmdc:mga0k408_2000_c1
408 nmdc:mga0rr50_682162_c1
409 nmdc:mga0sz30_214072_c1
410 Ga0500635_0005985
411 Ga0500647_0113593
412 Ga0500597_423666
413 Ga0500608_191530
414 Ga0500618_007925
415 Ga0500618_078216
416 Ga0500652_253346
417 Ga0500564_076864
418 Ga0500588_0006182
419 Ga0500622_0193299
420 Ga0500624_000334
421 2919439506
422 2977234745

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04237

YjbR

YjbR

31

121

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2a1v-assembly1.cif.gz_A crystal structure of deinococcus radiodurans protein dr2400, pfam domain duf419 0.9339 2 115
2a1v-assembly1.cif.gz_A crystal structure of deinococcus radiodurans protein dr2400, pfam domain duf419 0.9037 2 115
3h9x-assembly1.cif.gz_A crystal structure of the pspto_3016 protein from pseudomonas syringae, northeast structural genomics consortium target psr293 0.8384 1 101
2fki-assembly1.cif.gz_A nmr structure of protein yjbr from escherichia coli; northeast structural genomics consortium target er226 0.8216 1 117
2fki-assembly1.cif.gz_A nmr structure of protein yjbr from escherichia coli; northeast structural genomics consortium target er226 0.8153 1 117
ID Description Score Start End Superfamily
af_P0AAT2_2_121_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.9438 4 114 3.90.1150.30
2a1vA00 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.934 2 115 3.90.1150.30
af_P0AF50_1_117_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.9316 1 115 3.90.1150.30
2a1vA00 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.9037 2 115 3.90.1150.30
af_P0AAT2_2_121_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.8895 4 114 3.90.1150.30
ID Description Score Start End GO Terms
AF-A0A1T5DRJ3-F1-model_v4 Predicted DNA-binding protein, MmcQ/YjbR family 0.9988 1 112 GO:0003677
AF-A0A1Q6A5Y6-F1-model_v4 MmcQ-like protein 0.9946 1 117
AF-A0A5B8UR26-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.9939 1 114 GO:0003677
AF-A6EKG1-F1-model_v4 MmcQ-like protein 0.9925 1 117
AF-A0A4Q3F204-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.9905 1 99 GO:0003677

Map