F322133

General Info

Members Datasets Scaffolds Average Seq Length
211 164 422 168

Family's Representative Sequence

Representative Sequence 3300050491|nmdc:mga00v17_37142_c1|nmdc:mga00v17_37142_c1_842_1378
Length 178
Sequence MGARTFIVFFAVLAVLGLLGYGLLSKNEQALAVGDPAPDKELSTLDGSGKGQLADYRGKWVLVNFWASWCEPCRREAPALEEFHKQHADDGFTVVGINLDDTTDDAAAFVSRFGLTYPQLRDGDGRERRDAYGMTGFPENFLIDPEGKLALIRRGPIDTEYLARYVQPLIARAGAATQ

Samples

Sample ID Description Type Environment
1 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
29 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
78 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
79 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
80 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
81 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
82 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
83 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
84 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
85 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
86 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
87 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
88 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
89 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
90 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
91 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
92 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
93 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
94 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
95 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
96 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
97 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
98 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
99 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
100 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
101 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
102 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
103 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
104 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
105 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
106 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
107 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
108 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
109 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
110 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
111 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
112 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
113 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
114 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
115 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
116 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
117 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
118 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
119 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
120 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
121 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
122 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
123 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
124 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
125 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
126 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
127 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
128 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
129 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
130 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
131 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
132 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
133 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
134 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
135 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
136 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
137 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
138 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
139 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
140 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
141 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
142 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
143 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
144 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
145 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
146 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
147 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
148 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
149 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
150 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
151 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
153 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
154 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
155 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
156 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
157 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
158 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
159 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
160 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
161 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
162 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
163 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
164 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.84
Nodule 0
Rhizoplane 9.95
Rhizosphere 86.26
Stem 0
Stem Tuber 0
Unclassified 0.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga00v17_37142_c1 3300050491 Bacteria 2906
2 LJNas_1006000 3300000546 Bacteria 1320
3 JGI24740J21852_10001804 3300001979 Bacteria 9819
4 Ga0070683_100015225 3300005329 Bacteria 6752
5 Ga0070683_100497373 3300005329 Bacteria 1165
6 Ga0070670_100086170 3300005331 Bacteria 2699
7 Ga0070682_100000045 3300005337 Bacteria 131960
8 Ga0070689_100319085 3300005340 Bacteria 1297
9 Ga0070691_10000230 3300005341 Bacteria 19043
10 Ga0070692_10356508 3300005345 Bacteria 910
11 Ga0070668_100528546 3300005347 Bacteria 1024
12 Ga0070675_100000111 3300005354 Bacteria 47699
13 Ga0070688_100000590 3300005365 Bacteria 18271
14 Ga0070688_100117649 3300005365 Bacteria 1776
15 Ga0070659_100011329 3300005366 Bacteria 6594
16 Ga0070659_100409968 3300005366 Bacteria 1145
17 Ga0070713_100000325 3300005436 Bacteria 31202
18 Ga0070713_100034653 3300005436 Bacteria 4059
19 Ga0070711_100015824 3300005439 Bacteria 4777
20 Ga0070694_100187118 3300005444 Bacteria 1535
21 Ga0070678_100031795 3300005456 Bacteria 3646
22 Ga0070685_10000189 3300005466 Bacteria 41176
23 Ga0070685_10042371 3300005466 Bacteria 2598
24 Ga0070684_100014613 3300005535 Bacteria 6366
25 Ga0068853_100292503 3300005539 Bacteria 1504
26 Ga0070672_100000015 3300005543 Bacteria 72591
27 Ga0070665_100001339 3300005548 Bacteria 29297
28 Ga0068855_100255451 3300005563 Bacteria 1954
29 Ga0068854_100000136 3300005578 Bacteria 51080
30 Ga0068856_100000757 3300005614 Bacteria 35080
31 Ga0068856_100026616 3300005614 Bacteria 5640
32 Ga0068852_100000184 3300005616 Bacteria 42515
33 Ga0068852_100030323 3300005616 Bacteria 4451
34 Ga0068864_100000045 3300005618 Bacteria 154739
35 Ga0068866_10005617 3300005718 Bacteria 5192
36 Ga0068851_10002439 3300005834 Bacteria 8163
37 Ga0068863_100010414 3300005841 Bacteria 9039
38 Ga0081455_10015401 3300005937 Bacteria 7432
39 Ga0075433_10001554 3300006852 Bacteria 16977
40 Ga0068865_100000160 3300006881 Bacteria 36781
41 Ga0105240_10094559 3300009093 Bacteria 3645
42 Ga0105245_10000456 3300009098 Bacteria 37383
43 Ga0105245_10001844 3300009098 Bacteria 19294
44 Ga0105247_10000393 3300009101 Bacteria 37140
45 Ga0105242_10001264 3300009176 Bacteria 19974
46 Ga0105242_10019660 3300009176 Bacteria 5293
47 Ga0105248_10000249 3300009177 Bacteria 62662
48 Ga0105028_110003 3300009993 Bacteria 994
49 Ga0105239_10113221 3300010375 Bacteria 3009
50 Ga0157371_10012329 3300013102 Bacteria 6541
51 Ga0157370_10808759 3300013104 Bacteria 853
52 Ga0157369_10000110 3300013105 Bacteria 115514
53 Ga0157378_10002995 3300013297 Bacteria 15012
54 Ga0157378_10004828 3300013297 Bacteria 11815
55 Ga0157372_10000129 3300013307 Bacteria 82491
56 Ga0157375_10001152 3300013308 Bacteria 22842
57 Ga0157375_12158511 3300013308 Bacteria 663
58 Ga0157380_10023719 3300014326 Bacteria 4632
59 Ga0157377_10117025 3300014745 Bacteria 1610
60 Ga0157376_10021892 3300014969 Bacteria 4971
61 Ga0207656_10000964 3300025321 Bacteria 9407
62 Ga0207642_10018149 3300025899 Bacteria 2694
63 Ga0207710_10000195 3300025900 Bacteria 57216
64 Ga0207705_10180936 3300025909 Unclassified 1591
65 Ga0207695_10533900 3300025913 Bacteria 1054
66 Ga0207659_10000010 3300025926 Bacteria 286639
67 Ga0207687_10000007 3300025927 Bacteria 604185
68 Ga0207687_10000985 3300025927 Bacteria 19335
69 Ga0207700_10000081 3300025928 Bacteria 59083
70 Ga0207700_10022644 3300025928 Bacteria 4316
71 Ga0207690_10016890 3300025932 Bacteria 4449
72 Ga0207690_10364637 3300025932 Bacteria 1145
73 Ga0207686_10000033 3300025934 Bacteria 143602
74 Ga0207686_10009391 3300025934 Bacteria 5306
75 Ga0207670_10080987 3300025936 Bacteria 2271
76 Ga0207704_10001688 3300025938 Bacteria 9886
77 Ga0207691_10000044 3300025940 Bacteria 100027
78 Ga0207711_10000020 3300025941 Bacteria 363325
79 Ga0207689_10864420 3300025942 Bacteria 763
80 Ga0207661_10023035 3300025944 Bacteria 4701
81 Ga0207661_10942684 3300025944 Bacteria 795
82 Ga0207668_10406713 3300025972 Bacteria 1152
83 Ga0207640_10000015 3300025981 Bacteria 215411
84 Ga0207677_10033491 3300026023 Bacteria 3317
85 Ga0207639_10263673 3300026041 Bacteria 1508
86 Ga0207708_10381565 3300026075 Bacteria 1162
87 Ga0207708_10621184 3300026075 Unclassified 917
88 Ga0207702_10000060 3300026078 Bacteria 125473
89 Ga0207702_10017993 3300026078 Bacteria 5849
90 Ga0207641_10007464 3300026088 Bacteria 9096
91 Ga0207676_10000016 3300026095 Bacteria 311561
92 Ga0207683_10041010 3300026121 Bacteria 4041
93 Ga0207698_10000012 3300026142 Bacteria 260061
94 Ga0268266_10003138 3300028379 Bacteria 16794
95 Ga0268266_10093645 3300028379 Bacteria 2636
96 Ga0268266_10483737 3300028379 Bacteria 1180
97 Ga0268266_10562301 3300028379 Bacteria 1093
98 Ga0265337_1000231 3300028556 Bacteria 30088
99 Ga0265326_10000102 3300028558 Bacteria 43681
100 Ga0265319_1000025 3300028563 Bacteria 142639
101 Ga0265322_10000001 3300028654 Bacteria 543854
102 Ga0265336_10025783 3300028666 Bacteria 1850
103 Ga0265336_10065202 3300028666 Bacteria 1090
104 Ga0265338_10000473 3300028800 Bacteria 71777
105 Ga0265324_10002801 3300029957 Bacteria 8604
106 Ga0265320_10000002 3300031240 Bacteria 542875
107 Ga0265325_10056065 3300031241 Bacteria 2013
108 Ga0265329_10003038 3300031242 Bacteria 7447
109 Ga0265339_10111687 3300031249 Bacteria 1413
110 Ga0265331_10001887 3300031250 Bacteria 14737
111 Ga0265327_10000011 3300031251 Bacteria 543807
112 Ga0265316_10010658 3300031344 Bacteria 8357
113 Ga0265314_10000062 3300031711 Bacteria 159496
114 Ga0265342_10089332 3300031712 Bacteria 1768
115 Ga0307405_10454589 3300031731 Bacteria 1016
116 Ga0307415_100007634 3300032126 Bacteria 5931
117 Ga0395899_0143176 3300037312 Bacteria 1700
118 Ga0395900_0856906 3300037418 Bacteria 834
119 Ga0395898_0110306 3300037466 Bacteria 2638
120 Ga0395898_1547181 3300037466 Bacteria 588
121 Ga0395905_0196856 3300037471 Bacteria 1890
122 Ga0395901_0102817 3300038443 Bacteria 2998
123 Ga0451802_2130457 3300041460 Bacteria 554
124 Ga0451807_1572860 3300041486 Bacteria 638
125 Ga0451833_0057109 3300041491 Bacteria 1426
126 Ga0466963_0019696 3300044694 Bacteria 4236
127 Ga0466963_0225718 3300044694 Bacteria 1312
128 Ga0466957_0074067 3300044842 Bacteria 2111
129 Ga0466957_0093799 3300044842 Bacteria 1884
130 Ga0466957_0409823 3300044842 Bacteria 928
131 Ga0466967_0000009 3300045976 Bacteria 122610
132 Ga0495603_0000030 3300046455 Bacteria 60760
133 Ga0495629_0000846 3300046459 Bacteria 24704
134 Ga0495629_0007077 3300046459 Bacteria 8265
135 Ga0495641_0031439 3300046461 Bacteria 2536
136 Ga0495651_0046768 3300046462 Bacteria 3349
137 Ga0495662_0036253 3300046476 Bacteria 2380
138 Ga0495608_0000068 3300046511 Bacteria 79694
139 Ga0495618_0101402 3300046514 Bacteria 1843
140 Ga0495628_0304093 3300046516 Bacteria 1180
141 Ga0495630_0000056 3300046517 Bacteria 91477
142 Ga0495637_0232223 3300046520 Bacteria 668
143 Ga0495644_0000091 3300046523 Bacteria 45180
144 Ga0495652_0000019 3300046529 Bacteria 190248
145 Ga0495640_0006130 3300046533 Bacteria 9529
146 Ga0495587_0008535 3300046536 Bacteria 6581
147 Ga0495587_0151373 3300046536 Bacteria 1322
148 Ga0495587_0280815 3300046536 Bacteria 933
149 Ga0495598_0001214 3300046537 Bacteria 4994
150 Ga0495667_0000032 3300046559 Bacteria 143493
151 Ga0495657_0000004 3300046675 Bacteria 266465
152 Ga0495599_0156278 3300046678 Bacteria 1411
153 Ga0495647_0000169 3300046681 Bacteria 17284
154 Ga0495658_0007065 3300046683 Bacteria 5542
155 Ga0495613_0000113 3300046689 Bacteria 79559
156 Ga0495613_0301839 3300046689 Bacteria 1108
157 Ga0495613_0597223 3300046689 Bacteria 735
158 Ga0495624_0000267 3300046690 Bacteria 41318
159 Ga0495670_0042052 3300046691 Bacteria 2280
160 Ga0495600_0019925 3300046809 Bacteria 4288
161 Ga0495604_0002470 3300047317 Bacteria 14758
162 Ga0495604_0012318 3300047317 Bacteria 6798
163 Ga0495674_0001564 3300047319 Bacteria 22423
164 Ga0495672_0121167 3300047320 Bacteria 1390
165 Ga0495676_0079575 3300047321 Bacteria 2491
166 Ga0495680_0025406 3300047322 Bacteria 4903
167 Ga0495680_0071059 3300047322 Bacteria 2651
168 Ga0495675_0000107 3300047444 Bacteria 59970
169 Ga0495593_0036247 3300047673 Bacteria 2675
170 Ga0495602_0000208 3300048088 Bacteria 54818
171 Ga0495602_0083327 3300048088 Bacteria 2680
172 Ga0496102_0000039 3300048905 Bacteria 198306
173 Ga0496103_0000008 3300048906 Bacteria 340474
174 Ga0496104_0000129 3300048907 Bacteria 69982
175 Ga0496104_0220695 3300048907 Bacteria 1808
176 Ga0496105_0000001 3300048908 Bacteria 1328178
177 Ga0496105_0000860 3300048908 Bacteria 20739
178 Ga0496108_0000062 3300048911 Bacteria 122391
179 Ga0496109_0000007 3300048912 Bacteria 247554
180 Ga0496110_0000062 3300048913 Bacteria 53333
181 Ga0496110_0275747 3300048913 Bacteria 1531
182 Ga0496111_0000010 3300048914 Bacteria 92600
183 Ga0496111_0104646 3300048914 Bacteria 2082
184 Ga0496112_0001122 3300048915 Bacteria 19906
185 Ga0496113_0000014 3300048916 Bacteria 79850
186 Ga0496114_0000014 3300048917 Bacteria 297902
187 Ga0496114_0811784 3300048917 Bacteria 814
188 Ga0496115_0000003 3300048918 Bacteria 354994
189 Ga0496115_0000125 3300048918 Bacteria 69936
190 Ga0496115_0002082 3300048918 Bacteria 14330
191 Ga0496119_0031686 3300048922 Bacteria 3538
192 Ga0501042_0089780 3300049578 Bacteria 2205
193 Ga0501072_1286987 3300049588 Bacteria 567
194 Ga0501075_0007680 3300049591 Bacteria 7486
195 Ga0501075_0516119 3300049591 Bacteria 912
196 Ga0501081_0567635 3300049743 Bacteria 848
197 nmdc:mga03683_561030_c1 3300050489 Bacteria 556
198 nmdc:mga00v17_813587_c1 3300050491 Bacteria 595
199 nmdc:mga0a205_24_c2 3300050515 Bacteria 81894
200 Ga0495601_0000013 3300053077 Bacteria 226476
201 Ga0495601_0184141 3300053077 Bacteria 1365
202 Ga0495655_0000001 3300053083 Bacteria 419518
203 Ga0495655_0006489 3300053083 Bacteria 2128
204 Ga0495595_0000003 3300053084 Bacteria 266465
205 Ga0495595_0009155 3300053084 Bacteria 4092
206 Ga0495619_0000031 3300053085 Bacteria 145508
207 Ga0495619_0000106 3300053085 Bacteria 62413
208 Ga0500566_0015417 3300053094 Bacteria 4485
209 Ga0500614_000397 3300053123 Bacteria 11312
210 Ga0500628_000010 3300053129 Bacteria 122210
211 Ga0501084_0922913 3300054114 Bacteria 734
212 nmdc:mga00v17_37142_c1
213 LJNas_1006000
214 JGI24740J21852_10001804
215 Ga0070683_100015225
216 Ga0070683_100497373
217 Ga0070670_100086170
218 Ga0070682_100000045
219 Ga0070689_100319085
220 Ga0070691_10000230
221 Ga0070692_10356508
222 Ga0070668_100528546
223 Ga0070675_100000111
224 Ga0070688_100000590
225 Ga0070688_100117649
226 Ga0070659_100011329
227 Ga0070659_100409968
228 Ga0070713_100000325
229 Ga0070713_100034653
230 Ga0070711_100015824
231 Ga0070694_100187118
232 Ga0070678_100031795
233 Ga0070685_10000189
234 Ga0070685_10042371
235 Ga0070684_100014613
236 Ga0068853_100292503
237 Ga0070672_100000015
238 Ga0070665_100001339
239 Ga0068855_100255451
240 Ga0068854_100000136
241 Ga0068856_100000757
242 Ga0068856_100026616
243 Ga0068852_100000184
244 Ga0068852_100030323
245 Ga0068864_100000045
246 Ga0068866_10005617
247 Ga0068851_10002439
248 Ga0068863_100010414
249 Ga0081455_10015401
250 Ga0075433_10001554
251 Ga0068865_100000160
252 Ga0105240_10094559
253 Ga0105245_10000456
254 Ga0105245_10001844
255 Ga0105247_10000393
256 Ga0105242_10001264
257 Ga0105242_10019660
258 Ga0105248_10000249
259 Ga0105028_110003
260 Ga0105239_10113221
261 Ga0157371_10012329
262 Ga0157370_10808759
263 Ga0157369_10000110
264 Ga0157378_10002995
265 Ga0157378_10004828
266 Ga0157372_10000129
267 Ga0157375_10001152
268 Ga0157375_12158511
269 Ga0157380_10023719
270 Ga0157377_10117025
271 Ga0157376_10021892
272 Ga0207656_10000964
273 Ga0207642_10018149
274 Ga0207710_10000195
275 Ga0207705_10180936
276 Ga0207695_10533900
277 Ga0207659_10000010
278 Ga0207687_10000007
279 Ga0207687_10000985
280 Ga0207700_10000081
281 Ga0207700_10022644
282 Ga0207690_10016890
283 Ga0207690_10364637
284 Ga0207686_10000033
285 Ga0207686_10009391
286 Ga0207670_10080987
287 Ga0207704_10001688
288 Ga0207691_10000044
289 Ga0207711_10000020
290 Ga0207689_10864420
291 Ga0207661_10023035
292 Ga0207661_10942684
293 Ga0207668_10406713
294 Ga0207640_10000015
295 Ga0207677_10033491
296 Ga0207639_10263673
297 Ga0207708_10381565
298 Ga0207708_10621184
299 Ga0207702_10000060
300 Ga0207702_10017993
301 Ga0207641_10007464
302 Ga0207676_10000016
303 Ga0207683_10041010
304 Ga0207698_10000012
305 Ga0268266_10003138
306 Ga0268266_10093645
307 Ga0268266_10483737
308 Ga0268266_10562301
309 Ga0265337_1000231
310 Ga0265326_10000102
311 Ga0265319_1000025
312 Ga0265322_10000001
313 Ga0265336_10025783
314 Ga0265336_10065202
315 Ga0265338_10000473
316 Ga0265324_10002801
317 Ga0265320_10000002
318 Ga0265325_10056065
319 Ga0265329_10003038
320 Ga0265339_10111687
321 Ga0265331_10001887
322 Ga0265327_10000011
323 Ga0265316_10010658
324 Ga0265314_10000062
325 Ga0265342_10089332
326 Ga0307405_10454589
327 Ga0307415_100007634
328 Ga0395899_0143176
329 Ga0395900_0856906
330 Ga0395898_0110306
331 Ga0395898_1547181
332 Ga0395905_0196856
333 Ga0395901_0102817
334 Ga0451802_2130457
335 Ga0451807_1572860
336 Ga0451833_0057109
337 Ga0466963_0019696
338 Ga0466963_0225718
339 Ga0466957_0074067
340 Ga0466957_0093799
341 Ga0466957_0409823
342 Ga0466967_0000009
343 Ga0495603_0000030
344 Ga0495629_0000846
345 Ga0495629_0007077
346 Ga0495641_0031439
347 Ga0495651_0046768
348 Ga0495662_0036253
349 Ga0495608_0000068
350 Ga0495618_0101402
351 Ga0495628_0304093
352 Ga0495630_0000056
353 Ga0495637_0232223
354 Ga0495644_0000091
355 Ga0495652_0000019
356 Ga0495640_0006130
357 Ga0495587_0008535
358 Ga0495587_0151373
359 Ga0495587_0280815
360 Ga0495598_0001214
361 Ga0495667_0000032
362 Ga0495657_0000004
363 Ga0495599_0156278
364 Ga0495647_0000169
365 Ga0495658_0007065
366 Ga0495613_0000113
367 Ga0495613_0301839
368 Ga0495613_0597223
369 Ga0495624_0000267
370 Ga0495670_0042052
371 Ga0495600_0019925
372 Ga0495604_0002470
373 Ga0495604_0012318
374 Ga0495674_0001564
375 Ga0495672_0121167
376 Ga0495676_0079575
377 Ga0495680_0025406
378 Ga0495680_0071059
379 Ga0495675_0000107
380 Ga0495593_0036247
381 Ga0495602_0000208
382 Ga0495602_0083327
383 Ga0496102_0000039
384 Ga0496103_0000008
385 Ga0496104_0000129
386 Ga0496104_0220695
387 Ga0496105_0000001
388 Ga0496105_0000860
389 Ga0496108_0000062
390 Ga0496109_0000007
391 Ga0496110_0000062
392 Ga0496110_0275747
393 Ga0496111_0000010
394 Ga0496111_0104646
395 Ga0496112_0001122
396 Ga0496113_0000014
397 Ga0496114_0000014
398 Ga0496114_0811784
399 Ga0496115_0000003
400 Ga0496115_0000125
401 Ga0496115_0002082
402 Ga0496119_0031686
403 Ga0501042_0089780
404 Ga0501072_1286987
405 Ga0501075_0007680
406 Ga0501075_0516119
407 Ga0501081_0567635
408 nmdc:mga03683_561030_c1
409 nmdc:mga00v17_813587_c1
410 nmdc:mga0a205_24_c2
411 Ga0495601_0000013
412 Ga0495601_0184141
413 Ga0495655_0000001
414 Ga0495655_0006489
415 Ga0495595_0000003
416 Ga0495595_0009155
417 Ga0495619_0000031
418 Ga0495619_0000106
419 Ga0500566_0015417
420 Ga0500614_000397
421 Ga0500628_000010
422 Ga0501084_0922913

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

33

152

0.95

PF13905

Thioredoxin_8

Thioredoxin-like

58

149

0.93

PF08534

Redoxin

Redoxin

32

167

0.9

PF00085

Thioredoxin

Thioredoxin

50

120

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nmu-assembly2.cif.gz_B crystal structure of thiol-disulfide oxidoreductase from bacillus str. 'ames ancestor' 0.9199 17 149
3ios-assembly1.cif.gz_A structure of mtb dsbf in its mixed oxidized and reduced forms 0.9072 26 157
4ulx-assembly1.cif.gz_A crystal structure of ancestral thioredoxin, relative to the last common ancestor of the cyanobacterial, deinococcus and thermus groups, lpbca-l89k mutant. 0.9066 44 151
4ba7-assembly2.cif.gz_B crystal structure of ancestral thioredoxin relative to last bacteria common ancestor (lbca) from the precambrian period 0.9042 42 154
6nup-assembly1.cif.gz_A structure of thioredoxin (trxa) from rickettsia prowazekii str. madrid e. 0.9037 44 151
ID Description Score Start End Superfamily
af_Q9W5T4_48_199_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9113 38 156 3.40.30.10
3ul3B01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9095 46 151 3.40.30.10
af_O06392_67_205_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9077 24 157 3.40.30.10
3iosA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9072 26 157 3.40.30.10
4ulxA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9066 44 151 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A838V1L4-F1-model_v4 TlpA family protein disulfide reductase 0.9612 7 153 GO:0016209
GO:0016491
AF-A0A1F3CNA3-F1-model_v4 Thioredoxin domain-containing protein 0.9562 20 149 GO:0016491
GO:0017004
AF-A0A6L9J1B3-F1-model_v4 Redoxin domain-containing protein 0.9532 25 156 GO:0016020
GO:0016209
GO:0016491
AF-A0A7W1RRR8-F1-model_v4 TlpA family protein disulfide reductase 0.9509 20 156 GO:0016209
GO:0016491
AF-A0A535YDP2-F1-model_v4 TlpA family protein disulfide reductase 0.9506 20 149 GO:0016209
GO:0016491

Map