F322092

General Info

Members Datasets Scaffolds Average Seq Length
211 142 207 273

Family's Representative Sequence

Representative Sequence 3300049581|Ga0501047_0145075|Ga0501047_0145075_187_999
Length 270
Sequence MPDRYAAYRRLRFDRPAEGVLRISMINAANPRNAADAAMHAELSEVWHDVDKDPEVGAVILRGSDAAFSAGAEFAMIEQIVGDIDFRMRAWKEARNIVYNVINCGKPIIAAMNGPAVGAGLAAAMVCDITIAAKNARIIDGHTRLGVAAGDHSVIIWPLLVGMAKAKYYLLTCEALTGEEAERIGLVSLCVDDDKLEGKSIEVASKLAGGARTAISFTKYALNNWLRMMGPNFDASLALEFMGWDTGDAKEGLASFREKRKPSLPKKSPI

Samples

Sample ID Description Type Environment
1 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
2 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
4 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
15 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
16 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
17 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
18 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
19 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
20 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
23 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
24 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
25 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
30 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
42 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
43 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
44 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
59 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
63 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
64 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
65 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
66 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
67 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
68 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
69 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
70 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
71 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
72 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
73 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
74 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
75 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
76 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
77 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
78 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
79 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
80 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
81 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
82 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
83 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
84 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
85 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
86 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
87 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
88 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
89 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
90 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
91 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
92 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
93 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
94 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
95 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
96 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
97 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
98 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
99 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
100 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
101 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
102 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
103 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
104 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
105 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
106 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
116 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
117 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
118 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
119 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
120 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
121 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
122 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
123 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
126 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
127 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
128 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
129 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
130 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
131 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
132 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
133 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
134 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
135 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
136 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
137 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
138 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
139 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
140 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
141 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
142 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.1
Metatranscriptomes 0
Isolates 1.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.69
Nodule 0
Rhizoplane 6.64
Rhizosphere 67.77
Stem 0
Stem Tuber 0
Unclassified 10.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100227566 3300005329 Bacteria 1773
2 Ga0070670_100412684 3300005331 Bacteria 1193
3 Ga0070668_100023992 3300005347 Bacteria 4619
4 Ga0070668_100511420 3300005347 Bacteria 1041
5 Ga0070671_100045708 3300005355 Bacteria 3640
6 Ga0070667_100000663 3300005367 Bacteria 33405
7 Ga0070694_100225055 3300005444 Bacteria 1409
8 Ga0070708_100042559 3300005445 Bacteria 3988
9 Ga0070681_10093292 3300005458 Bacteria 2959
10 Ga0070665_100003914 3300005548 Bacteria 15737
11 Ga0068859_100001876 3300005617 Bacteria 21398
12 Ga0068859_100570293 3300005617 Bacteria 1226
13 Ga0068864_100569281 3300005618 Bacteria 1097
14 Ga0068863_100000260 3300005841 Bacteria 55182
15 Ga0068863_100387193 3300005841 Bacteria 1366
16 Ga0068858_100008544 3300005842 Bacteria 9840
17 Ga0068860_100000099 3300005843 Bacteria 145436
18 Ga0068860_100022929 3300005843 Bacteria 6037
19 Ga0068860_100028330 3300005843 Bacteria 5391
20 Ga0068862_100000086 3300005844 Bacteria 110489
21 Ga0068862_100119765 3300005844 Bacteria 2319
22 Ga0068862_100178761 3300005844 Bacteria 1903
23 Ga0081455_10069540 3300005937 Bacteria 2927
24 Ga0081539_10121804 3300005985 Bacteria 1294
25 Ga0075365_10024813 3300006038 Bacteria 3789
26 Ga0075365_10026674 3300006038 Bacteria 3669
27 Ga0075365_10280384 3300006038 Bacteria 1173
28 Ga0075365_10400886 3300006038 Bacteria 968
29 Ga0075363_100004890 3300006048 Bacteria 5920
30 Ga0075363_100025007 3300006048 Bacteria 3041
31 Ga0075363_100052780 3300006048 Bacteria 2170
32 Ga0075364_10000942 3300006051 Bacteria 15335
33 Ga0075364_10016978 3300006051 Bacteria 4537
34 Ga0075364_10030876 3300006051 Bacteria 3441
35 Ga0075364_10222321 3300006051 Bacteria 1282
36 Ga0075369_10000014 3300006186 Bacteria 63974
37 Ga0075369_10045874 3300006186 Bacteria 1880
38 Ga0075369_10058310 3300006186 Bacteria 1681
39 Ga0075428_100073849 3300006844 Bacteria 3725
40 Ga0075428_100303329 3300006844 Bacteria 1717
41 Ga0075430_100042943 3300006846 Bacteria 3822
42 Ga0075431_100258842 3300006847 Bacteria 1766
43 Ga0075429_100119854 3300006880 Bacteria 2299
44 Ga0068865_100233028 3300006881 Bacteria 1445
45 Ga0097620_100001876 3300006931 Bacteria 21398
46 Ga0097620_100570312 3300006931 Bacteria 1226
47 Ga0111539_10034826 3300009094 Bacteria 6100
48 Ga0111539_10099713 3300009094 Bacteria 3410
49 Ga0105245_10400480 3300009098 Bacteria 1371
50 Ga0105247_10000051 3300009101 Bacteria 145981
51 Ga0114129_10049480 3300009147 Bacteria 5905
52 Ga0114129_10247614 3300009147 Bacteria 2394
53 Ga0105248_10002584 3300009177 Bacteria 20125
54 Ga0105237_10234914 3300009545 Bacteria 1834
55 Ga0105249_10000020 3300009553 Bacteria 260634
56 Ga0105249_10063496 3300009553 Bacteria 3393
57 Ga0105239_10034735 3300010375 Bacteria 5539
58 Ga0105239_10648674 3300010375 Bacteria 1206
59 Ga0157369_10467810 3300013105 Bacteria 1305
60 Ga0157379_10283607 3300014968 Bacteria 1507
61 Ga0213876_10002262 3300021384 Bacteria 11366
62 Ga0213876_10026609 3300021384 Bacteria 3051
63 Ga0213876_10195262 3300021384 Bacteria 1076
64 Ga0213875_10001332 3300021388 Bacteria 16262
65 Ga0207710_10000010 3300025900 Bacteria 482087
66 Ga0207707_10333798 3300025912 Bacteria 1308
67 Ga0207681_10002927 3300025923 Bacteria 10777
68 Ga0207650_10331432 3300025925 Bacteria 1248
69 Ga0207704_10090813 3300025938 Bacteria 2005
70 Ga0207711_10001045 3300025941 Bacteria 26479
71 Ga0207661_10600443 3300025944 Bacteria 1010
72 Ga0207712_10000010 3300025961 Bacteria 455972
73 Ga0207712_10026234 3300025961 Bacteria 3879
74 Ga0207668_10183758 3300025972 Bacteria 1651
75 Ga0207640_10396168 3300025981 Bacteria 1123
76 Ga0207658_10000873 3300025986 Bacteria 25135
77 Ga0207703_10033405 3300026035 Bacteria 4078
78 Ga0207641_10000445 3300026088 Bacteria 47406
79 Ga0207641_10135792 3300026088 Bacteria 2214
80 Ga0207641_10487019 3300026088 Bacteria 1196
81 Ga0207675_100725090 3300026118 Bacteria 1004
82 Ga0207428_10061793 3300027907 Bacteria 2964
83 Ga0268266_10011976 3300028379 Bacteria 7508
84 Ga0268265_10000014 3300028380 Bacteria 330186
85 Ga0268265_10099290 3300028380 Bacteria 2347
86 Ga0268264_10000137 3300028381 Bacteria 176081
87 Ga0268264_10049513 3300028381 Bacteria 3496
88 Ga0373947_0392501 3300035725 Bacteria 935
89 Ga0373937_0124739 3300036401 Bacteria 2402
90 Ga0436364_0340375 3300037853 Bacteria 4409
91 Ga0436364_0820637 3300037853 Bacteria 33747
92 Ga0436364_1074189 3300037853 Bacteria 2837
93 Ga0436365_0997390 3300039437 Bacteria 10372
94 Ga0436365_1066271 3300039437 Bacteria 18255
95 Ga0436365_1167796 3300039437 Bacteria 11139
96 Ga0436365_1499581 3300039437 Bacteria 19401
97 Ga0436363_0090709 3300039450 Bacteria 1663
98 Ga0451798_0430412 3300041458 Bacteria 949
99 Ga0466966_0010346 3300044684 Bacteria 6193
100 Ga0466961_0011212 3300044693 Bacteria 5731
101 Ga0466963_0283198 3300044694 Bacteria 1165
102 Ga0453684_0004754 3300044712 Bacteria 28043
103 Ga0466971_0024456 3300044719 Bacteria 2695
104 Ga0466957_0001211 3300044842 Bacteria 13445
105 Ga0466957_0009484 3300044842 Bacteria 5558
106 Ga0466957_0163786 3300044842 Bacteria 1445
107 Ga0466960_0003574 3300044901 Bacteria 5997
108 Ga0466959_0002707 3300045049 Bacteria 11386
109 Ga0451576_0266190 3300045051 Bacteria 1792
110 Ga0466958_0064862 3300045836 Bacteria 2228
111 Ga0466958_0198281 3300045836 Bacteria 1277
112 Ga0466967_0037473 3300045976 Bacteria 4150
113 Ga0466967_0055567 3300045976 Bacteria 3487
114 Ga0466967_0164180 3300045976 Bacteria 2086
115 Ga0466967_0423424 3300045976 Bacteria 1298
116 Ga0495629_0036477 3300046459 Bacteria 3470
117 Ga0495653_0221330 3300046463 Bacteria 1272
118 Ga0495608_0018522 3300046511 Bacteria 4801
119 Ga0495608_0107594 3300046511 Bacteria 1794
120 Ga0495621_0016245 3300046539 Bacteria 2386
121 Ga0495667_0091021 3300046559 Bacteria 1976
122 Ga0495657_0056948 3300046675 Bacteria 2601
123 Ga0495600_0181815 3300046809 Bacteria 1355
124 Ga0495680_0060284 3300047322 Bacteria 2926
125 Ga0495680_0223190 3300047322 Bacteria 1344
126 Ga0495684_0392521 3300047471 Bacteria 976
127 Ga0496101_0012154 3300048904 Bacteria 5738
128 Ga0496102_0000118 3300048905 Bacteria 113499
129 Ga0496102_0592181 3300048905 Bacteria 1032
130 Ga0496103_0000227 3300048906 Bacteria 54745
131 Ga0496105_0142655 3300048908 Bacteria 1971
132 Ga0496106_0192919 3300048909 Bacteria 1620
133 Ga0496107_0015308 3300048910 Bacteria 5376
134 Ga0496108_0088671 3300048911 Bacteria 2629
135 Ga0496112_0081248 3300048915 Bacteria 3205
136 Ga0496113_0291781 3300048916 Bacteria 1305
137 Ga0496113_0350897 3300048916 Bacteria 1184
138 Ga0496114_0163303 3300048917 Bacteria 1938
139 Ga0496115_0103660 3300048918 Bacteria 2334
140 Ga0496116_0062694 3300048919 Bacteria 2399
141 Ga0496117_0000880 3300048920 Bacteria 46333
142 Ga0496117_0047016 3300048920 Bacteria 3099
143 Ga0496118_0004431 3300048921 Bacteria 16657
144 Ga0496119_0002733 3300048922 Bacteria 19003
145 Ga0496120_0004184 3300048923 Bacteria 12347
146 Ga0496121_0005193 3300048924 Bacteria 16877
147 Ga0496126_0001341 3300048929 Bacteria 39083
148 Ga0496126_0008356 3300048929 Bacteria 11172
149 Ga0501031_0088487 3300049568 Bacteria 2019
150 Ga0501032_0096439 3300049569 Bacteria 1960
151 Ga0501033_0014758 3300049570 Bacteria 5932
152 Ga0501034_0012916 3300049571 Bacteria 8612
153 Ga0501038_0485985 3300049574 Bacteria 946
154 Ga0501043_0033560 3300049579 Bacteria 4039
155 Ga0501046_0002821 3300049580 Bacteria 16183
156 Ga0501046_0196411 3300049580 Bacteria 1503
157 Ga0501047_0099123 3300049581 Bacteria 2792
158 Ga0501047_0145075 3300049581 Bacteria 2251
159 Ga0501048_0155611 3300049582 Bacteria 1617
160 Ga0501069_0000005 3300049585 Bacteria 189293
161 Ga0501070_0000001 3300049586 Bacteria 519187
162 Ga0501070_0011948 3300049586 Bacteria 7333
163 Ga0501071_0041227 3300049587 Bacteria 3306
164 Ga0501071_0124265 3300049587 Bacteria 1914
165 Ga0501072_0022360 3300049588 Bacteria 4905
166 Ga0501072_0201784 3300049588 Bacteria 1586
167 Ga0501073_0071659 3300049589 Bacteria 2414
168 Ga0501074_0237122 3300049590 Bacteria 1298
169 Ga0501075_0220798 3300049591 Bacteria 1446
170 Ga0501080_0000809 3300049742 Bacteria 25504
171 Ga0501080_0028992 3300049742 Bacteria 5153
172 Ga0501035_0014567 3300049822 Bacteria 7258
173 Ga0501035_0044665 3300049822 Bacteria 3989
174 Ga0501035_0251877 3300049822 Bacteria 1499
175 Ga0501044_0001384 3300049823 Bacteria 28445
176 Ga0501044_0085172 3300049823 Bacteria 3194
177 Ga0501045_0128649 3300049824 Bacteria 1882
178 nmdc:mga03683_3928_c1 3300050489 Bacteria 4861
179 nmdc:mga03683_6903_c1 3300050489 Bacteria 3912
180 nmdc:mga00v17_124541_c1 3300050491 Bacteria 1644
181 nmdc:mga00v17_16422_c1 3300050491 Bacteria 4173
182 nmdc:mga00v17_240493_c1 3300050491 Bacteria 1174
183 nmdc:mga00v17_43296_c2 3300050491 Bacteria 1624
184 nmdc:mga00v17_82711_c1 3300050491 Bacteria 2007
185 nmdc:mga0yw44_107689_c1 3300050492 Bacteria 1783
186 nmdc:mga0yw44_37058_c1 3300050492 Bacteria 2878
187 nmdc:mga0yw44_99742_c1 3300050492 Bacteria 1848
188 nmdc:mga06z11_175011_c1 3300050494 Bacteria 1234
189 nmdc:mga06z11_227701_c1 3300050494 Bacteria 1091
190 nmdc:mga05p37_388941_c1 3300050507 Bacteria 1632
191 nmdc:mga06r32_58685_c1 3300050510 Bacteria 3699
192 nmdc:mga06r32_679062_c1 3300050510 Bacteria 997
193 nmdc:mga06r32_85023_c1 3300050510 Bacteria 3084
194 nmdc:mga08y16_219228_c1 3300050511 Bacteria 1970
195 nmdc:mga0sz30_17142_c3 3300050516 Bacteria 1474
196 nmdc:mga0sz30_747_c1 3300050516 Bacteria 11888
197 nmdc:mga0sz30_80524_c1 3300050516 Bacteria 1409
198 Ga0495601_0101331 3300053077 Bacteria 1860
199 Ga0495612_0008909 3300053078 Bacteria 4068
200 Ga0495595_0041807 3300053084 Bacteria 2099
201 Ga0495619_0091969 3300053085 Bacteria 2054
202 Ga0495619_0161165 3300053085 Bacteria 1549
203 Ga0500616_0005271 3300053153 Bacteria 8836
204 Ga0500634_0162972 3300053161 Bacteria 1027
205 Ga0501084_0153883 3300054114 Bacteria 1939
206 Ga0501082_0316865 3300060353 Bacteria 1359
207 Ga0466962_0076210 3300061719 Bacteria 1603

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026118 Ga0207675_100725090 Ga0207675_1007250901 246
2 iso_pu_bacteria 2501025502 2501083028 258
3 iso_pu_bacteria 2510917013 2511090995 258
4 iso_pu_bacteria 2870782633 2870787894 258
5 3300045051 Ga0451576_0266190 Ga0451576_0266190_135_929 260
6 iso_pu_bacteria 2558860112 2558911681 260
7 3300044712 Ga0453684_0004754 Ga0453684_0004754_6135_6923 262
8 3300045836 Ga0466958_0198281 Ga0466958_0198281_369_1157 262
9 3300045976 Ga0466967_0037473 Ga0466967_0037473_2606_3406 262
10 3300049822 Ga0501035_0251877 Ga0501035_0251877_486_1298 262
11 3300005347 Ga0070668_100023992 Ga0070668_1000239922 263
12 3300005355 Ga0070671_100045708 Ga0070671_1000457084 263
13 3300005458 Ga0070681_10093292 Ga0070681_100932922 263
14 3300005618 Ga0068864_100569281 Ga0068864_1005692812 263
15 3300005843 Ga0068860_100022929 Ga0068860_1000229295 263
16 3300006038 Ga0075365_10024813 Ga0075365_100248132 263
17 3300009098 Ga0105245_10400480 Ga0105245_104004801 263
18 3300009553 Ga0105249_10063496 Ga0105249_100634963 263
19 3300013105 Ga0157369_10467810 Ga0157369_104678102 263
20 3300025961 Ga0207712_10026234 Ga0207712_100262343 263
21 3300025972 Ga0207668_10183758 Ga0207668_101837582 263
22 3300025981 Ga0207640_10396168 Ga0207640_103961681 263
23 3300028381 Ga0268264_10049513 Ga0268264_100495132 263
24 3300046539 Ga0495621_0016245 Ga0495621_0016245_1481_2284 263
25 3300048908 Ga0496105_0142655 Ga0496105_0142655_744_1541 263
26 3300050492 nmdc:mga0yw44_99742_c1 nmdc:mga0yw44_99742_c1_862_1668 263
27 3300053161 Ga0500634_0162972 Ga0500634_0162972_87_884 263
28 3300005331 Ga0070670_100412684 Ga0070670_1004126841 264
29 3300005347 Ga0070668_100511420 Ga0070668_1005114201 264
30 3300005367 Ga0070667_100000663 Ga0070667_10000066319 264
31 3300005444 Ga0070694_100225055 Ga0070694_1002250552 264
32 3300005445 Ga0070708_100042559 Ga0070708_1000425596 264
33 3300005617 Ga0068859_100570293 Ga0068859_1005702932 264
34 3300005841 Ga0068863_100387193 Ga0068863_1003871932 264
35 3300005843 Ga0068860_100028330 Ga0068860_1000283304 264
36 3300005844 Ga0068862_100119765 Ga0068862_1001197652 264
37 3300005844 Ga0068862_100178761 Ga0068862_1001787612 264
38 3300006038 Ga0075365_10280384 Ga0075365_102803842 264
39 3300006186 Ga0075369_10000014 Ga0075369_1000001422 264
40 3300006186 Ga0075369_10045874 Ga0075369_100458742 264
41 3300006881 Ga0068865_100233028 Ga0068865_1002330281 264
42 3300006931 Ga0097620_100570312 Ga0097620_1005703122 264
43 3300009101 Ga0105247_10000051 Ga0105247_1000005112 264
44 3300009545 Ga0105237_10234914 Ga0105237_102349142 264
45 3300009553 Ga0105249_10000020 Ga0105249_10000020125 264
46 3300010375 Ga0105239_10034735 Ga0105239_100347352 264
47 3300014968 Ga0157379_10283607 Ga0157379_102836072 264
48 3300021384 Ga0213876_10002262 Ga0213876_100022625 264
49 3300021388 Ga0213875_10001332 Ga0213875_1000133213 264
50 3300025912 Ga0207707_10333798 Ga0207707_103337982 264
51 3300025925 Ga0207650_10331432 Ga0207650_103314322 264
52 3300025938 Ga0207704_10090813 Ga0207704_100908131 264
53 3300026035 Ga0207703_10033405 Ga0207703_100334051 264
54 3300026088 Ga0207641_10135792 Ga0207641_101357921 264
55 3300026088 Ga0207641_10487019 Ga0207641_104870192 264
56 3300028380 Ga0268265_10099290 Ga0268265_100992904 264
57 3300035725 Ga0373947_0392501 Ga0373947_0392501_76_885 264
58 3300036401 Ga0373937_0124739 Ga0373937_0124739_387_1196 264
59 3300037853 Ga0436364_0340375 Ga0436364_0340375_3515_4324 264
60 3300037853 Ga0436364_0820637 Ga0436364_0820637_12033_12839 264
61 3300039437 Ga0436365_0997390 Ga0436365_0997390_4383_5192 264
62 3300039437 Ga0436365_1066271 Ga0436365_1066271_2385_3188 264
63 3300039450 Ga0436363_0090709 Ga0436363_0090709_771_1592 264
64 3300041458 Ga0451798_0430412 Ga0451798_0430412_62_883 264
65 3300044719 Ga0466971_0024456 Ga0466971_0024456_1018_1965 264
66 3300044842 Ga0466957_0009484 Ga0466957_0009484_2434_3249 264
67 3300044842 Ga0466957_0163786 Ga0466957_0163786_471_1301 264
68 3300044901 Ga0466960_0003574 Ga0466960_0003574_1050_1880 264
69 3300045836 Ga0466958_0064862 Ga0466958_0064862_332_1162 264
70 3300045976 Ga0466967_0055567 Ga0466967_0055567_959_1789 264
71 3300045976 Ga0466967_0423424 Ga0466967_0423424_240_1046 264
72 3300046459 Ga0495629_0036477 Ga0495629_0036477_550_1356 264
73 3300046463 Ga0495653_0221330 Ga0495653_0221330_25_834 264
74 3300046511 Ga0495608_0018522 Ga0495608_0018522_1694_2500 264
75 3300046511 Ga0495608_0107594 Ga0495608_0107594_518_1327 264
76 3300046559 Ga0495667_0091021 Ga0495667_0091021_304_1110 264
77 3300046675 Ga0495657_0056948 Ga0495657_0056948_199_1008 264
78 3300046809 Ga0495600_0181815 Ga0495600_0181815_191_1000 264
79 3300047322 Ga0495680_0060284 Ga0495680_0060284_799_1605 264
80 3300047322 Ga0495680_0223190 Ga0495680_0223190_397_1206 264
81 3300047471 Ga0495684_0392521 Ga0495684_0392521_59_868 264
82 3300048904 Ga0496101_0012154 Ga0496101_0012154_2079_2909 264
83 3300048905 Ga0496102_0000118 Ga0496102_0000118_97975_98805 264
84 3300048905 Ga0496102_0592181 Ga0496102_0592181_166_972 264
85 3300048906 Ga0496103_0000227 Ga0496103_0000227_40820_41650 264
86 3300048909 Ga0496106_0192919 Ga0496106_0192919_584_1414 264
87 3300048910 Ga0496107_0015308 Ga0496107_0015308_394_1224 264
88 3300048915 Ga0496112_0081248 Ga0496112_0081248_1108_1917 264
89 3300048916 Ga0496113_0291781 Ga0496113_0291781_104_913 264
90 3300048917 Ga0496114_0163303 Ga0496114_0163303_216_1025 264
91 3300048918 Ga0496115_0103660 Ga0496115_0103660_127_957 264
92 3300048919 Ga0496116_0062694 Ga0496116_0062694_519_1349 264
93 3300048920 Ga0496117_0000880 Ga0496117_0000880_16551_17381 264
94 3300048920 Ga0496117_0047016 Ga0496117_0047016_863_1669 264
95 3300048921 Ga0496118_0004431 Ga0496118_0004431_14777_15607 264
96 3300048922 Ga0496119_0002733 Ga0496119_0002733_10830_11660 264
97 3300048923 Ga0496120_0004184 Ga0496120_0004184_3893_4723 264
98 3300048924 Ga0496121_0005193 Ga0496121_0005193_12021_12851 264
99 3300048929 Ga0496126_0001341 Ga0496126_0001341_5992_6822 264
100 3300049569 Ga0501032_0096439 Ga0501032_0096439_107_904 264
101 3300049581 Ga0501047_0145075 Ga0501047_0145075_187_999 264
102 3300049585 Ga0501069_0000005 Ga0501069_0000005_45983_46789 264
103 3300049586 Ga0501070_0000001 Ga0501070_0000001_483003_483809 264
104 3300049587 Ga0501071_0041227 Ga0501071_0041227_149_955 264
105 3300049742 Ga0501080_0000809 Ga0501080_0000809_3396_4202 264
106 3300050491 nmdc:mga00v17_240493_c1 nmdc:mga00v17_240493_c1_67_885 264
107 3300050516 nmdc:mga0sz30_17142_c3 nmdc:mga0sz30_17142_c3_495_1313 264
108 3300050516 nmdc:mga0sz30_747_c1 nmdc:mga0sz30_747_c1_4808_5626 264
109 3300053077 Ga0495601_0101331 Ga0495601_0101331_591_1400 264
110 3300053078 Ga0495612_0008909 Ga0495612_0008909_2736_3545 264
111 3300053084 Ga0495595_0041807 Ga0495595_0041807_190_996 264
112 3300053085 Ga0495619_0091969 Ga0495619_0091969_15_821 264
113 3300053085 Ga0495619_0161165 Ga0495619_0161165_412_1221 264
114 3300053153 Ga0500616_0005271 Ga0500616_0005271_7476_8282 264
115 3300060353 Ga0501082_0316865 Ga0501082_0316865_432_1238 264
116 3300061719 Ga0466962_0076210 Ga0466962_0076210_499_1329 264
117 3300006844 Ga0075428_100303329 Ga0075428_1003033292 265
118 3300009094 Ga0111539_10034826 Ga0111539_100348263 265
119 3300009147 Ga0114129_10049480 Ga0114129_100494802 265
120 3300021384 Ga0213876_10195262 Ga0213876_101952622 265
121 3300039437 Ga0436365_1499581 Ga0436365_1499581_7890_8720 265
122 3300050507 nmdc:mga05p37_388941_c1 nmdc:mga05p37_388941_c1_50_859 265
123 3300050510 nmdc:mga06r32_85023_c1 nmdc:mga06r32_85023_c1_208_1017 265
124 3300005548 Ga0070665_100003914 Ga0070665_1000039148 266
125 3300005617 Ga0068859_100001876 Ga0068859_1000018768 266
126 3300005841 Ga0068863_100000260 Ga0068863_10000026046 266
127 3300005842 Ga0068858_100008544 Ga0068858_10000854410 266
128 3300005843 Ga0068860_100000099 Ga0068860_10000009914 266
129 3300005844 Ga0068862_100000086 Ga0068862_10000008614 266
130 3300005937 Ga0081455_10069540 Ga0081455_100695403 266
131 3300006038 Ga0075365_10026674 Ga0075365_100266743 266
132 3300006048 Ga0075363_100004890 Ga0075363_1000048902 266
133 3300006048 Ga0075363_100025007 Ga0075363_1000250073 266
134 3300006048 Ga0075363_100052780 Ga0075363_1000527802 266
135 3300006051 Ga0075364_10000942 Ga0075364_1000094213 266
136 3300006051 Ga0075364_10016978 Ga0075364_100169784 266
137 3300006051 Ga0075364_10030876 Ga0075364_100308764 266
138 3300006051 Ga0075364_10222321 Ga0075364_102223211 266
139 3300006186 Ga0075369_10058310 Ga0075369_100583102 266
140 3300006847 Ga0075431_100258842 Ga0075431_1002588422 266
141 3300006931 Ga0097620_100001876 Ga0097620_1000018768 266
142 3300009177 Ga0105248_10002584 Ga0105248_1000258414 266
143 3300025900 Ga0207710_10000010 Ga0207710_10000010255 266
144 3300025923 Ga0207681_10002927 Ga0207681_100029278 266
145 3300025941 Ga0207711_10001045 Ga0207711_1000104517 266
146 3300025961 Ga0207712_10000010 Ga0207712_10000010139 266
147 3300025986 Ga0207658_10000873 Ga0207658_1000087314 266
148 3300026088 Ga0207641_10000445 Ga0207641_1000044545 266
149 3300028379 Ga0268266_10011976 Ga0268266_100119768 266
150 3300028380 Ga0268265_10000014 Ga0268265_10000014303 266
151 3300028381 Ga0268264_10000137 Ga0268264_10000137151 266
152 3300048929 Ga0496126_0008356 Ga0496126_0008356_9042_9938 266
153 3300049570 Ga0501033_0014758 Ga0501033_0014758_2325_3215 266
154 3300049588 Ga0501072_0022360 Ga0501072_0022360_2629_3489 266
155 3300049822 Ga0501035_0044665 Ga0501035_0044665_2862_3752 266
156 3300049823 Ga0501044_0085172 Ga0501044_0085172_343_1242 266
157 3300050489 nmdc:mga03683_3928_c1 nmdc:mga03683_3928_c1_1559_2371 266
158 3300050489 nmdc:mga03683_6903_c1 nmdc:mga03683_6903_c1_562_1374 266
159 3300050491 nmdc:mga00v17_124541_c1 nmdc:mga00v17_124541_c1_698_1510 266
160 3300050491 nmdc:mga00v17_16422_c1 nmdc:mga00v17_16422_c1_2746_3558 266
161 3300050491 nmdc:mga00v17_43296_c2 nmdc:mga00v17_43296_c2_189_1004 266
162 3300050491 nmdc:mga00v17_82711_c1 nmdc:mga00v17_82711_c1_797_1609 266
163 3300050492 nmdc:mga0yw44_107689_c1 nmdc:mga0yw44_107689_c1_62_874 266
164 3300050492 nmdc:mga0yw44_37058_c1 nmdc:mga0yw44_37058_c1_2054_2866 266
165 3300050494 nmdc:mga06z11_175011_c1 nmdc:mga06z11_175011_c1_249_1061 266
166 3300050510 nmdc:mga06r32_679062_c1 nmdc:mga06r32_679062_c1_157_978 266
167 3300050516 nmdc:mga0sz30_80524_c1 nmdc:mga0sz30_80524_c1_296_1108 266
168 3300005985 Ga0081539_10121804 Ga0081539_101218042 267
169 3300006038 Ga0075365_10400886 Ga0075365_104008861 267
170 3300006844 Ga0075428_100073849 Ga0075428_1000738492 267
171 3300006846 Ga0075430_100042943 Ga0075430_1000429434 267
172 3300006880 Ga0075429_100119854 Ga0075429_1001198542 267
173 3300009094 Ga0111539_10099713 Ga0111539_100997133 267
174 3300009147 Ga0114129_10247614 Ga0114129_102476142 267
175 3300010375 Ga0105239_10648674 Ga0105239_106486741 267
176 3300027907 Ga0207428_10061793 Ga0207428_100617932 267
177 3300048911 Ga0496108_0088671 Ga0496108_0088671_185_988 267
178 3300048916 Ga0496113_0350897 Ga0496113_0350897_52_870 267
179 3300049568 Ga0501031_0088487 Ga0501031_0088487_1159_1986 267
180 3300049580 Ga0501046_0196411 Ga0501046_0196411_341_1168 267
181 3300049582 Ga0501048_0155611 Ga0501048_0155611_454_1281 267
182 3300049587 Ga0501071_0124265 Ga0501071_0124265_905_1732 267
183 3300049588 Ga0501072_0201784 Ga0501072_0201784_583_1410 267
184 3300049590 Ga0501074_0237122 Ga0501074_0237122_207_1034 267
185 3300049591 Ga0501075_0220798 Ga0501075_0220798_299_1126 267
186 3300049824 Ga0501045_0128649 Ga0501045_0128649_420_1247 267
187 3300050494 nmdc:mga06z11_227701_c1 nmdc:mga06z11_227701_c1_187_1014 267
188 3300050510 nmdc:mga06r32_58685_c1 nmdc:mga06r32_58685_c1_670_1503 267
189 3300050511 nmdc:mga08y16_219228_c1 nmdc:mga08y16_219228_c1_125_958 267
190 3300054114 Ga0501084_0153883 Ga0501084_0153883_1089_1916 267
191 3300005329 Ga0070683_100227566 Ga0070683_1002275662 269
192 3300021384 Ga0213876_10026609 Ga0213876_100266092 269
193 3300025944 Ga0207661_10600443 Ga0207661_106004431 269
194 3300037853 Ga0436364_1074189 Ga0436364_1074189_552_1373 269
195 3300039437 Ga0436365_1167796 Ga0436365_1167796_3160_3981 269
196 3300044684 Ga0466966_0010346 Ga0466966_0010346_4771_5607 269
197 3300044693 Ga0466961_0011212 Ga0466961_0011212_1753_2589 269
198 3300044694 Ga0466963_0283198 Ga0466963_0283198_149_958 269
199 3300044842 Ga0466957_0001211 Ga0466957_0001211_6784_7620 269
200 3300045049 Ga0466959_0002707 Ga0466959_0002707_8080_8916 269
201 3300045976 Ga0466967_0164180 Ga0466967_0164180_850_1659 269
202 3300049571 Ga0501034_0012916 Ga0501034_0012916_1525_2406 269
203 3300049574 Ga0501038_0485985 Ga0501038_0485985_83_892 269
204 3300049579 Ga0501043_0033560 Ga0501043_0033560_33_914 269
205 3300049580 Ga0501046_0002821 Ga0501046_0002821_9133_10014 269
206 3300049581 Ga0501047_0099123 Ga0501047_0099123_918_1799 269
207 3300049586 Ga0501070_0011948 Ga0501070_0011948_307_1116 269
208 3300049589 Ga0501073_0071659 Ga0501073_0071659_1346_2227 269
209 3300049742 Ga0501080_0028992 Ga0501080_0028992_3991_4872 269
210 3300049822 Ga0501035_0014567 Ga0501035_0014567_5590_6471 269
211 3300049823 Ga0501044_0001384 Ga0501044_0001384_17831_18712 269

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

15

267

0.92

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

21

224

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3q1t-assembly1.cif.gz_A crystal structure of enoyl-coa hydratase from mycobacterium avium 0.8787 9 267
3q1t-assembly1.cif.gz_A crystal structure of enoyl-coa hydratase from mycobacterium avium 0.8754 9 267
3qk8-assembly1.cif.gz_B crystal structure of enoyl-coa hydratase echa15 from mycobacterium marinum in complex with an unknown ligand 0.871 8 267
7m3w-assembly1.cif.gz_B crystal structure of enoyl-coa hydratase echa15 protein from mycolicibacterium paratuberculosis 0.8701 2 268
3qk8-assembly1.cif.gz_B crystal structure of enoyl-coa hydratase echa15 from mycobacterium marinum in complex with an unknown ligand 0.8678 8 267
ID Description Score Start End Superfamily
3rrvD00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8474 15 257 3.90.226.10
1wz8A01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8382 11 210 3.90.226.10
3rrvD00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8217 15 257 3.90.226.10
1wz8A01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8115 11 210 3.90.226.10
4di1B01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8091 16 213 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A7U8U893-F1-model_v4 deleted 0.9106 2 166
AF-A0A7W1R674-F1-model_v4 Enoyl-CoA hydratase/isomerase family protein 0.8801 10 249 GO:0016853
AF-A0A7Z9Y011-F1-model_v4 Enoyl-CoA hydratase/isomerase family protein 0.8778 8 245 GO:0016853
AF-A0A402CEV6-F1-model_v4 Enoyl-CoA hydratase 0.8748 14 262 GO:0004300
GO:0006631
AF-A0A6N7Z4N2-F1-model_v4 Enoyl-CoA hydratase/isomerase family protein 0.8737 11 247 GO:0016853

Feature Viewer

pLDDT pTM Quality
81.19 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map