F321926

General Info

Members Datasets Scaffolds Average Seq Length
211 82 422 170

Family's Representative Sequence

Representative Sequence 3300045836|Ga0466958_0579474|Ga0466958_0579474_131_703
Length 190
Sequence MTEVIGERARAAIPEPRVVTGGEEVLWFLGTVARMKLVGHDTAGRFALWEGVLPRGAAPPLHSHPQDETFYVLDGELTSWLVEPDLADDDAEPPQWVRTRGRRCGVGAVMFAPAGTPHTFRVESDTARMLFLSAPAGIEDYVRALAEPAQWPWLQPPRHGPRVDLERTAAVERELGVVRHGPPPPSQDRS

Samples

Sample ID Description Type Environment
1 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
17 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
21 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
22 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
23 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
24 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
25 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
26 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
27 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
28 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
29 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
30 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
44 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
45 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
46 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
47 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
48 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
49 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
50 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
51 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
52 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
53 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
54 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
55 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
56 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
57 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
58 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
59 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
60 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
61 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
62 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
63 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
64 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
65 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
66 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
67 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
68 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
69 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
70 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
71 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
72 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
73 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
74 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
75 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
76 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
77 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
78 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
79 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
80 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
81 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
82 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.63
Metatranscriptomes 2.37
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.47
Rhizosphere 98.1
Stem 0
Stem Tuber 0
Unclassified 23.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466958_0579474 3300045836 Bacteria 729
2 Ga0070658_10070710 3300005327 Bacteria 2857
3 Ga0070658_10104149 3300005327 Unclassified 2347
4 Ga0070683_100030151 3300005329 Bacteria 4919
5 Ga0070683_100107254 3300005329 Bacteria 2633
6 Ga0070680_100073679 3300005336 Bacteria 2809
7 Ga0070660_100017369 3300005339 Bacteria 5244
8 Ga0070660_100033563 3300005339 Unclassified 3869
9 Ga0070660_100086905 3300005339 Bacteria 2461
10 Ga0070661_100018822 3300005344 Bacteria 4915
11 Ga0070659_100314970 3300005366 Bacteria 1307
12 Ga0070659_100408496 3300005366 Unclassified 1147
13 Ga0070659_101440374 3300005366 Bacteria 613
14 Ga0070714_100029868 3300005435 Unclassified 4534
15 Ga0070714_100181398 3300005435 Bacteria 1916
16 Ga0070714_100385686 3300005435 Bacteria 1322
17 Ga0070663_100099860 3300005455 Bacteria 2164
18 Ga0070681_10003531 3300005458 Bacteria 14651
19 Ga0070707_101333834 3300005468 Bacteria 684
20 Ga0070679_100017354 3300005530 Bacteria 6968
21 Ga0070684_100067390 3300005535 Bacteria 3144
22 Ga0068853_100183595 3300005539 Unclassified 1898
23 Ga0068855_100053472 3300005563 Bacteria 4751
24 Ga0068855_100347072 3300005563 Bacteria 1635
25 Ga0068857_100126757 3300005577 Bacteria 2301
26 Ga0068854_100180856 3300005578 Bacteria 1647
27 Ga0068856_100047452 3300005614 Unclassified 4231
28 Ga0068856_100129698 3300005614 Bacteria 2526
29 Ga0068856_100734554 3300005614 Bacteria 1007
30 Ga0068856_101309301 3300005614 Bacteria 740
31 Ga0068852_100013595 3300005616 Bacteria 6231
32 Ga0070712_100945828 3300006175 Unclassified 744
33 Ga0105240_10132188 3300009093 Bacteria 2993
34 Ga0105237_10848385 3300009545 Bacteria 920
35 Ga0157373_10107344 3300013100 Bacteria 1963
36 Ga0157370_10023434 3300013104 Bacteria 6127
37 Ga0157370_10116942 3300013104 Bacteria 2491
38 Ga0157370_10337473 3300013104 Unclassified 1389
39 Ga0157369_10005333 3300013105 Bacteria 14979
40 Ga0157369_10019394 3300013105 Bacteria 7608
41 Ga0157369_10252555 3300013105 Unclassified 1840
42 Ga0157369_10700839 3300013105 Bacteria 1043
43 Ga0157372_10015758 3300013307 Bacteria 8108
44 Ga0157372_10493938 3300013307 Bacteria 1427
45 Ga0206356_11694475 3300020070 Unclassified 1904
46 Ga0206354_10004426 3300020081 Bacteria 753
47 Ga0206354_10900999 3300020081 Bacteria 910
48 Ga0206353_10238928 3300020082 Unclassified 3863
49 Ga0206353_10976970 3300020082 Bacteria 919
50 Ga0207705_10345217 3300025909 Bacteria 1146
51 Ga0207705_10552952 3300025909 Bacteria 895
52 Ga0207707_10178837 3300025912 Unclassified 1852
53 Ga0207660_10587809 3300025917 Bacteria 906
54 Ga0207657_10001123 3300025919 Bacteria 28402
55 Ga0207657_10017382 3300025919 Bacteria 6899
56 Ga0207657_10045409 3300025919 Bacteria 3856
57 Ga0207649_10026251 3300025920 Unclassified 3405
58 Ga0207664_10001372 3300025929 Bacteria 16010
59 Ga0207664_10514445 3300025929 Bacteria 1072
60 Ga0207690_10227660 3300025932 Bacteria 1430
61 Ga0207661_10008285 3300025944 Bacteria 7427
62 Ga0207661_10110996 3300025944 Bacteria 2319
63 Ga0207661_10577447 3300025944 Bacteria 1031
64 Ga0207667_10094845 3300025949 Bacteria 3080
65 Ga0207667_10603856 3300025949 Bacteria 1106
66 Ga0207639_10267741 3300026041 Unclassified 1497
67 Ga0207702_10090558 3300026078 Unclassified 2677
68 Ga0207702_10566010 3300026078 Bacteria 1113
69 Ga0207674_10205132 3300026116 Bacteria 1921
70 Ga0207698_10026548 3300026142 Bacteria 4098
71 Ga0207698_10649090 3300026142 Bacteria 1045
72 Ga0395899_0029965 3300037312 Bacteria 4095
73 Ga0395899_0059080 3300037312 Unclassified 2827
74 Ga0395899_0520808 3300037312 Bacteria 768
75 Ga0395900_0023530 3300037418 Bacteria 6303
76 Ga0395900_1236579 3300037418 Unclassified 662
77 Ga0395898_0005234 3300037466 Bacteria 14021
78 Ga0395898_0053825 3300037466 Bacteria 3929
79 Ga0395898_0072802 3300037466 Bacteria 3319
80 Ga0395905_0083943 3300037471 Bacteria 2984
81 Ga0395905_0339158 3300037471 Bacteria 1394
82 Ga0395905_0826663 3300037471 Bacteria 829
83 Ga0436364_0129064 3300037853 Bacteria 1355
84 Ga0395901_0000927 3300038443 Bacteria 31921
85 Ga0395901_0011768 3300038443 Bacteria 8871
86 Ga0395901_0029945 3300038443 Bacteria 5607
87 Ga0436365_1206045 3300039437 Bacteria 1077
88 Ga0436361_0288488 3300039447 Bacteria 760
89 Ga0436363_0348240 3300039450 Bacteria 726
90 Ga0466969_0088320 3300044656 Unclassified 1471
91 Ga0466969_0377718 3300044656 Bacteria 642
92 Ga0466966_0001227 3300044684 Bacteria 16468
93 Ga0466966_0006567 3300044684 Bacteria 7700
94 Ga0466966_0018568 3300044684 Unclassified 4584
95 Ga0466966_0066376 3300044684 Bacteria 2267
96 Ga0466966_0773041 3300044684 Bacteria 579
97 Ga0466961_0003128 3300044693 Bacteria 10302
98 Ga0466961_0035889 3300044693 Unclassified 3182
99 Ga0466961_0041296 3300044693 Bacteria 2957
100 Ga0466961_0149705 3300044693 Bacteria 1457
101 Ga0466961_0184412 3300044693 Unclassified 1295
102 Ga0466961_0193012 3300044693 Bacteria 1262
103 Ga0466961_0354469 3300044693 Unclassified 893
104 Ga0466961_0442985 3300044693 Unclassified 786
105 Ga0466963_0001291 3300044694 Bacteria 13294
106 Ga0466963_0004444 3300044694 Bacteria 8152
107 Ga0466963_0033090 3300044694 Bacteria 3353
108 Ga0466963_0066373 3300044694 Bacteria 2420
109 Ga0466963_0095693 3300044694 Unclassified 2027
110 Ga0466963_0103642 3300044694 Bacteria 1949
111 Ga0466963_0158617 3300044694 Bacteria 1574
112 Ga0466963_0212361 3300044694 Bacteria 1354
113 Ga0466963_0247729 3300044694 Bacteria 1250
114 Ga0466963_0471471 3300044694 Unclassified 886
115 Ga0466964_0060459 3300044706 Bacteria 1576
116 Ga0466964_0120447 3300044706 Bacteria 1182
117 Ga0466971_0009439 3300044719 Bacteria 4260
118 Ga0466971_0013831 3300044719 Unclassified 3549
119 Ga0466971_0225316 3300044719 Bacteria 889
120 Ga0466971_0226162 3300044719 Bacteria 888
121 Ga0466971_0323011 3300044719 Bacteria 744
122 Ga0466971_0459761 3300044719 Unclassified 625
123 Ga0466968_0017686 3300044735 Bacteria 2853
124 Ga0466968_0078418 3300044735 Unclassified 1448
125 Ga0466968_0079112 3300044735 Bacteria 1442
126 Ga0466968_0666368 3300044735 Unclassified 529
127 Ga0466970_0064137 3300044765 Bacteria 1970
128 Ga0466970_0318400 3300044765 Bacteria 879
129 Ga0466957_0017686 3300044842 Bacteria 4180
130 Ga0466957_0018445 3300044842 Bacteria 4098
131 Ga0466957_0030193 3300044842 Bacteria 3236
132 Ga0466957_0465842 3300044842 Unclassified 872
133 Ga0466957_0536780 3300044842 Bacteria 814
134 Ga0466957_0838101 3300044842 Unclassified 655
135 Ga0466959_0000308 3300045049 Bacteria 28958
136 Ga0466959_0000435 3300045049 Bacteria 24320
137 Ga0466959_0019371 3300045049 Bacteria 5004
138 Ga0466959_0035357 3300045049 Unclassified 3696
139 Ga0466959_0255267 3300045049 Unclassified 1208
140 Ga0466959_0278713 3300045049 Bacteria 1148
141 Ga0466959_0343002 3300045049 Bacteria 1019
142 Ga0466959_0720087 3300045049 Bacteria 668
143 Ga0466958_0002018 3300045836 Bacteria 10011
144 Ga0466958_0005597 3300045836 Bacteria 6779
145 Ga0466958_0017729 3300045836 Bacteria 4122
146 Ga0466958_0023440 3300045836 Bacteria 3624
147 Ga0466958_0032746 3300045836 Bacteria 3093
148 Ga0466958_0034269 3300045836 Unclassified 3028
149 Ga0466958_0094541 3300045836 Unclassified 1852
150 Ga0466958_0161683 3300045836 Bacteria 1415
151 Ga0466958_0238206 3300045836 Unclassified 1162
152 Ga0466958_0344393 3300045836 Bacteria 959
153 Ga0466958_0602851 3300045836 Bacteria 714
154 Ga0466967_0009948 3300045976 Bacteria 7101
155 Ga0466967_0011788 3300045976 Bacteria 6647
156 Ga0466967_0014698 3300045976 Bacteria 6111
157 Ga0466967_0027762 3300045976 Bacteria 4712
158 Ga0466967_0035223 3300045976 Bacteria 4258
159 Ga0466967_0062180 3300045976 Bacteria 3314
160 Ga0466967_0078284 3300045976 Bacteria 2978
161 Ga0466967_0086069 3300045976 Bacteria 2847
162 Ga0466967_0088445 3300045976 Bacteria 2811
163 Ga0466967_0124094 3300045976 Bacteria 2390
164 Ga0466967_0128108 3300045976 Bacteria 2353
165 Ga0466967_0147862 3300045976 Bacteria 2193
166 Ga0466967_0183351 3300045976 Bacteria 1975
167 Ga0466967_0196413 3300045976 Bacteria 1909
168 Ga0466967_0331321 3300045976 Bacteria 1470
169 Ga0466967_0407180 3300045976 Unclassified 1324
170 Ga0466967_0485372 3300045976 Bacteria 1211
171 Ga0466967_0551040 3300045976 Bacteria 1135
172 Ga0466967_0552232 3300045976 Unclassified 1134
173 Ga0466967_0614806 3300045976 Bacteria 1073
174 Ga0466967_0654599 3300045976 Bacteria 1039
175 Ga0496113_0993869 3300048916 Bacteria 661
176 Ga0501034_0022792 3300049571 Bacteria 6380
177 Ga0501043_0005786 3300049579 Bacteria 9949
178 Ga0501046_0009191 3300049580 Bacteria 8559
179 Ga0501046_0655618 3300049580 Unclassified 742
180 Ga0501047_0000178 3300049581 Bacteria 77670
181 Ga0501047_0010295 3300049581 Bacteria 8844
182 Ga0501047_0073844 3300049581 Bacteria 3284
183 Ga0501047_0363233 3300049581 Unclassified 1283
184 Ga0501067_0053767 3300049583 Unclassified 2231
185 Ga0501068_0001304 3300049584 Bacteria 13220
186 Ga0501068_0102762 3300049584 Unclassified 1772
187 Ga0501069_0006691 3300049585 Bacteria 6035
188 Ga0501069_0096647 3300049585 Unclassified 1674
189 Ga0501070_0000096 3300049586 Bacteria 75811
190 Ga0501070_0227380 3300049586 Unclassified 1529
191 Ga0501070_0623278 3300049586 Bacteria 858
192 Ga0501071_0972342 3300049587 Bacteria 656
193 Ga0501072_0000266 3300049588 Bacteria 38055
194 Ga0501073_0000049 3300049589 Bacteria 75259
195 Ga0501073_0989598 3300049589 Unclassified 579
196 Ga0501074_0000136 3300049590 Bacteria 38031
197 Ga0501074_0919554 3300049590 Unclassified 616
198 Ga0501079_0000329 3300049741 Bacteria 29869
199 Ga0501080_0000008 3300049742 Bacteria 134920
200 Ga0501080_0033763 3300049742 Bacteria 4776
201 Ga0501083_0000196 3300049744 Bacteria 39027
202 Ga0501035_0156366 3300049822 Bacteria 1976
203 Ga0501035_0161205 3300049822 Unclassified 1941
204 Ga0501035_0442579 3300049822 Unclassified 1076
205 Ga0501044_0003405 3300049823 Bacteria 17914
206 Ga0501082_0000124 3300060353 Bacteria 61918
207 Ga0466962_0002589 3300061719 Bacteria 8593
208 Ga0466962_0030021 3300061719 Bacteria 2602
209 Ga0466962_0066812 3300061719 Unclassified 1717
210 Ga0466962_0067852 3300061719 Unclassified 1703
211 Ga0466962_0107947 3300061719 Bacteria 1339
212 Ga0466958_0579474
213 Ga0070658_10070710
214 Ga0070658_10104149
215 Ga0070683_100030151
216 Ga0070683_100107254
217 Ga0070680_100073679
218 Ga0070660_100017369
219 Ga0070660_100033563
220 Ga0070660_100086905
221 Ga0070661_100018822
222 Ga0070659_100314970
223 Ga0070659_100408496
224 Ga0070659_101440374
225 Ga0070714_100029868
226 Ga0070714_100181398
227 Ga0070714_100385686
228 Ga0070663_100099860
229 Ga0070681_10003531
230 Ga0070707_101333834
231 Ga0070679_100017354
232 Ga0070684_100067390
233 Ga0068853_100183595
234 Ga0068855_100053472
235 Ga0068855_100347072
236 Ga0068857_100126757
237 Ga0068854_100180856
238 Ga0068856_100047452
239 Ga0068856_100129698
240 Ga0068856_100734554
241 Ga0068856_101309301
242 Ga0068852_100013595
243 Ga0070712_100945828
244 Ga0105240_10132188
245 Ga0105237_10848385
246 Ga0157373_10107344
247 Ga0157370_10023434
248 Ga0157370_10116942
249 Ga0157370_10337473
250 Ga0157369_10005333
251 Ga0157369_10019394
252 Ga0157369_10252555
253 Ga0157369_10700839
254 Ga0157372_10015758
255 Ga0157372_10493938
256 Ga0206356_11694475
257 Ga0206354_10004426
258 Ga0206354_10900999
259 Ga0206353_10238928
260 Ga0206353_10976970
261 Ga0207705_10345217
262 Ga0207705_10552952
263 Ga0207707_10178837
264 Ga0207660_10587809
265 Ga0207657_10001123
266 Ga0207657_10017382
267 Ga0207657_10045409
268 Ga0207649_10026251
269 Ga0207664_10001372
270 Ga0207664_10514445
271 Ga0207690_10227660
272 Ga0207661_10008285
273 Ga0207661_10110996
274 Ga0207661_10577447
275 Ga0207667_10094845
276 Ga0207667_10603856
277 Ga0207639_10267741
278 Ga0207702_10090558
279 Ga0207702_10566010
280 Ga0207674_10205132
281 Ga0207698_10026548
282 Ga0207698_10649090
283 Ga0395899_0029965
284 Ga0395899_0059080
285 Ga0395899_0520808
286 Ga0395900_0023530
287 Ga0395900_1236579
288 Ga0395898_0005234
289 Ga0395898_0053825
290 Ga0395898_0072802
291 Ga0395905_0083943
292 Ga0395905_0339158
293 Ga0395905_0826663
294 Ga0436364_0129064
295 Ga0395901_0000927
296 Ga0395901_0011768
297 Ga0395901_0029945
298 Ga0436365_1206045
299 Ga0436361_0288488
300 Ga0436363_0348240
301 Ga0466969_0088320
302 Ga0466969_0377718
303 Ga0466966_0001227
304 Ga0466966_0006567
305 Ga0466966_0018568
306 Ga0466966_0066376
307 Ga0466966_0773041
308 Ga0466961_0003128
309 Ga0466961_0035889
310 Ga0466961_0041296
311 Ga0466961_0149705
312 Ga0466961_0184412
313 Ga0466961_0193012
314 Ga0466961_0354469
315 Ga0466961_0442985
316 Ga0466963_0001291
317 Ga0466963_0004444
318 Ga0466963_0033090
319 Ga0466963_0066373
320 Ga0466963_0095693
321 Ga0466963_0103642
322 Ga0466963_0158617
323 Ga0466963_0212361
324 Ga0466963_0247729
325 Ga0466963_0471471
326 Ga0466964_0060459
327 Ga0466964_0120447
328 Ga0466971_0009439
329 Ga0466971_0013831
330 Ga0466971_0225316
331 Ga0466971_0226162
332 Ga0466971_0323011
333 Ga0466971_0459761
334 Ga0466968_0017686
335 Ga0466968_0078418
336 Ga0466968_0079112
337 Ga0466968_0666368
338 Ga0466970_0064137
339 Ga0466970_0318400
340 Ga0466957_0017686
341 Ga0466957_0018445
342 Ga0466957_0030193
343 Ga0466957_0465842
344 Ga0466957_0536780
345 Ga0466957_0838101
346 Ga0466959_0000308
347 Ga0466959_0000435
348 Ga0466959_0019371
349 Ga0466959_0035357
350 Ga0466959_0255267
351 Ga0466959_0278713
352 Ga0466959_0343002
353 Ga0466959_0720087
354 Ga0466958_0002018
355 Ga0466958_0005597
356 Ga0466958_0017729
357 Ga0466958_0023440
358 Ga0466958_0032746
359 Ga0466958_0034269
360 Ga0466958_0094541
361 Ga0466958_0161683
362 Ga0466958_0238206
363 Ga0466958_0344393
364 Ga0466958_0602851
365 Ga0466967_0009948
366 Ga0466967_0011788
367 Ga0466967_0014698
368 Ga0466967_0027762
369 Ga0466967_0035223
370 Ga0466967_0062180
371 Ga0466967_0078284
372 Ga0466967_0086069
373 Ga0466967_0088445
374 Ga0466967_0124094
375 Ga0466967_0128108
376 Ga0466967_0147862
377 Ga0466967_0183351
378 Ga0466967_0196413
379 Ga0466967_0331321
380 Ga0466967_0407180
381 Ga0466967_0485372
382 Ga0466967_0551040
383 Ga0466967_0552232
384 Ga0466967_0614806
385 Ga0466967_0654599
386 Ga0496113_0993869
387 Ga0501034_0022792
388 Ga0501043_0005786
389 Ga0501046_0009191
390 Ga0501046_0655618
391 Ga0501047_0000178
392 Ga0501047_0010295
393 Ga0501047_0073844
394 Ga0501047_0363233
395 Ga0501067_0053767
396 Ga0501068_0001304
397 Ga0501068_0102762
398 Ga0501069_0006691
399 Ga0501069_0096647
400 Ga0501070_0000096
401 Ga0501070_0227380
402 Ga0501070_0623278
403 Ga0501071_0972342
404 Ga0501072_0000266
405 Ga0501073_0000049
406 Ga0501073_0989598
407 Ga0501074_0000136
408 Ga0501074_0919554
409 Ga0501079_0000329
410 Ga0501080_0000008
411 Ga0501080_0033763
412 Ga0501083_0000196
413 Ga0501035_0156366
414 Ga0501035_0161205
415 Ga0501035_0442579
416 Ga0501044_0003405
417 Ga0501082_0000124
418 Ga0466962_0002589
419 Ga0466962_0030021
420 Ga0466962_0066812
421 Ga0466962_0067852
422 Ga0466962_0107947

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

49

90

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5fq0-assembly1.cif.gz_A the structure of kdgf from halomonas sp. 0.9166 10 115
2pfw-assembly1.cif.gz_B crystal structure of a rmlc-like cupin (sfri_3105) from shewanella frigidimarina ncimb 400 at 1.90 a resolution 0.9152 10 117
7zyb-assembly1.cif.gz_A bekdgf with ca 0.9147 10 117
5fq0-assembly2.cif.gz_D the structure of kdgf from halomonas sp. 0.9134 10 115
2ozj-assembly2.cif.gz_B-3 crystal structure of a cupin superfamily protein (dsy2733) from desulfitobacterium hafniense dcb-2 at 1.60 a resolution 0.9087 11 109
ID Description Score Start End Superfamily
3fjsA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9264 25 109 2.60.120.10
2pfwB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8997 10 117 2.60.120.10
1o4tB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8955 11 110 2.60.120.10
2dctB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8907 11 110 2.60.120.10
1gqhB01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.887 5 125 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A4Q3PA46-F1-model_v4 deleted 0.946 10 158
AF-A0A2V7VZW7-F1-model_v4 Cupin domain-containing protein 0.936 3 153
AF-A0A5B8U9N1-F1-model_v4 Cupin domain-containing protein 0.932 2 160
AF-A0A6J4PXV2-F1-model_v4 Cupin type-2 domain-containing protein 0.9319 4 114
AF-A0A5C7SN96-F1-model_v4 Cupin domain-containing protein 0.9293 10 158

Map