F321926
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 211 | 82 | 422 | 170 |
Family's Representative Sequence
| Representative Sequence | 3300045836|Ga0466958_0579474|Ga0466958_0579474_131_703 |
| Length | 190 |
| Sequence | MTEVIGERARAAIPEPRVVTGGEEVLWFLGTVARMKLVGHDTAGRFALWEGVLPRGAAPPLHSHPQDETFYVLDGELTSWLVEPDLADDDAEPPQWVRTRGRRCGVGAVMFAPAGTPHTFRVESDTARMLFLSAPAGIEDYVRALAEPAQWPWLQPPRHGPRVDLERTAAVERELGVVRHGPPPPSQDRS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 15 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 16 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 17 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 18 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 19 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 20 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 22 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 23 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 24 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 25 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 26 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 27 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 28 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 29 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 30 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 31 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 32 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 33 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 34 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 44 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 45 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 46 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 47 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 48 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 49 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 50 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 51 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 52 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 53 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 54 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 55 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 56 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 57 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 58 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 59 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 60 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 61 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 62 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 63 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 64 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 65 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 66 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 67 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 68 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 69 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 70 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 71 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 72 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 73 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 74 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 75 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 76 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 77 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 78 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 79 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 80 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 81 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 82 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.63 |
| Metatranscriptomes | 2.37 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.47 |
| Rhizosphere | 98.1 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 23.7 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466958_0579474 | 3300045836 | Bacteria | 729 |
| 2 | Ga0070658_10070710 | 3300005327 | Bacteria | 2857 |
| 3 | Ga0070658_10104149 | 3300005327 | Unclassified | 2347 |
| 4 | Ga0070683_100030151 | 3300005329 | Bacteria | 4919 |
| 5 | Ga0070683_100107254 | 3300005329 | Bacteria | 2633 |
| 6 | Ga0070680_100073679 | 3300005336 | Bacteria | 2809 |
| 7 | Ga0070660_100017369 | 3300005339 | Bacteria | 5244 |
| 8 | Ga0070660_100033563 | 3300005339 | Unclassified | 3869 |
| 9 | Ga0070660_100086905 | 3300005339 | Bacteria | 2461 |
| 10 | Ga0070661_100018822 | 3300005344 | Bacteria | 4915 |
| 11 | Ga0070659_100314970 | 3300005366 | Bacteria | 1307 |
| 12 | Ga0070659_100408496 | 3300005366 | Unclassified | 1147 |
| 13 | Ga0070659_101440374 | 3300005366 | Bacteria | 613 |
| 14 | Ga0070714_100029868 | 3300005435 | Unclassified | 4534 |
| 15 | Ga0070714_100181398 | 3300005435 | Bacteria | 1916 |
| 16 | Ga0070714_100385686 | 3300005435 | Bacteria | 1322 |
| 17 | Ga0070663_100099860 | 3300005455 | Bacteria | 2164 |
| 18 | Ga0070681_10003531 | 3300005458 | Bacteria | 14651 |
| 19 | Ga0070707_101333834 | 3300005468 | Bacteria | 684 |
| 20 | Ga0070679_100017354 | 3300005530 | Bacteria | 6968 |
| 21 | Ga0070684_100067390 | 3300005535 | Bacteria | 3144 |
| 22 | Ga0068853_100183595 | 3300005539 | Unclassified | 1898 |
| 23 | Ga0068855_100053472 | 3300005563 | Bacteria | 4751 |
| 24 | Ga0068855_100347072 | 3300005563 | Bacteria | 1635 |
| 25 | Ga0068857_100126757 | 3300005577 | Bacteria | 2301 |
| 26 | Ga0068854_100180856 | 3300005578 | Bacteria | 1647 |
| 27 | Ga0068856_100047452 | 3300005614 | Unclassified | 4231 |
| 28 | Ga0068856_100129698 | 3300005614 | Bacteria | 2526 |
| 29 | Ga0068856_100734554 | 3300005614 | Bacteria | 1007 |
| 30 | Ga0068856_101309301 | 3300005614 | Bacteria | 740 |
| 31 | Ga0068852_100013595 | 3300005616 | Bacteria | 6231 |
| 32 | Ga0070712_100945828 | 3300006175 | Unclassified | 744 |
| 33 | Ga0105240_10132188 | 3300009093 | Bacteria | 2993 |
| 34 | Ga0105237_10848385 | 3300009545 | Bacteria | 920 |
| 35 | Ga0157373_10107344 | 3300013100 | Bacteria | 1963 |
| 36 | Ga0157370_10023434 | 3300013104 | Bacteria | 6127 |
| 37 | Ga0157370_10116942 | 3300013104 | Bacteria | 2491 |
| 38 | Ga0157370_10337473 | 3300013104 | Unclassified | 1389 |
| 39 | Ga0157369_10005333 | 3300013105 | Bacteria | 14979 |
| 40 | Ga0157369_10019394 | 3300013105 | Bacteria | 7608 |
| 41 | Ga0157369_10252555 | 3300013105 | Unclassified | 1840 |
| 42 | Ga0157369_10700839 | 3300013105 | Bacteria | 1043 |
| 43 | Ga0157372_10015758 | 3300013307 | Bacteria | 8108 |
| 44 | Ga0157372_10493938 | 3300013307 | Bacteria | 1427 |
| 45 | Ga0206356_11694475 | 3300020070 | Unclassified | 1904 |
| 46 | Ga0206354_10004426 | 3300020081 | Bacteria | 753 |
| 47 | Ga0206354_10900999 | 3300020081 | Bacteria | 910 |
| 48 | Ga0206353_10238928 | 3300020082 | Unclassified | 3863 |
| 49 | Ga0206353_10976970 | 3300020082 | Bacteria | 919 |
| 50 | Ga0207705_10345217 | 3300025909 | Bacteria | 1146 |
| 51 | Ga0207705_10552952 | 3300025909 | Bacteria | 895 |
| 52 | Ga0207707_10178837 | 3300025912 | Unclassified | 1852 |
| 53 | Ga0207660_10587809 | 3300025917 | Bacteria | 906 |
| 54 | Ga0207657_10001123 | 3300025919 | Bacteria | 28402 |
| 55 | Ga0207657_10017382 | 3300025919 | Bacteria | 6899 |
| 56 | Ga0207657_10045409 | 3300025919 | Bacteria | 3856 |
| 57 | Ga0207649_10026251 | 3300025920 | Unclassified | 3405 |
| 58 | Ga0207664_10001372 | 3300025929 | Bacteria | 16010 |
| 59 | Ga0207664_10514445 | 3300025929 | Bacteria | 1072 |
| 60 | Ga0207690_10227660 | 3300025932 | Bacteria | 1430 |
| 61 | Ga0207661_10008285 | 3300025944 | Bacteria | 7427 |
| 62 | Ga0207661_10110996 | 3300025944 | Bacteria | 2319 |
| 63 | Ga0207661_10577447 | 3300025944 | Bacteria | 1031 |
| 64 | Ga0207667_10094845 | 3300025949 | Bacteria | 3080 |
| 65 | Ga0207667_10603856 | 3300025949 | Bacteria | 1106 |
| 66 | Ga0207639_10267741 | 3300026041 | Unclassified | 1497 |
| 67 | Ga0207702_10090558 | 3300026078 | Unclassified | 2677 |
| 68 | Ga0207702_10566010 | 3300026078 | Bacteria | 1113 |
| 69 | Ga0207674_10205132 | 3300026116 | Bacteria | 1921 |
| 70 | Ga0207698_10026548 | 3300026142 | Bacteria | 4098 |
| 71 | Ga0207698_10649090 | 3300026142 | Bacteria | 1045 |
| 72 | Ga0395899_0029965 | 3300037312 | Bacteria | 4095 |
| 73 | Ga0395899_0059080 | 3300037312 | Unclassified | 2827 |
| 74 | Ga0395899_0520808 | 3300037312 | Bacteria | 768 |
| 75 | Ga0395900_0023530 | 3300037418 | Bacteria | 6303 |
| 76 | Ga0395900_1236579 | 3300037418 | Unclassified | 662 |
| 77 | Ga0395898_0005234 | 3300037466 | Bacteria | 14021 |
| 78 | Ga0395898_0053825 | 3300037466 | Bacteria | 3929 |
| 79 | Ga0395898_0072802 | 3300037466 | Bacteria | 3319 |
| 80 | Ga0395905_0083943 | 3300037471 | Bacteria | 2984 |
| 81 | Ga0395905_0339158 | 3300037471 | Bacteria | 1394 |
| 82 | Ga0395905_0826663 | 3300037471 | Bacteria | 829 |
| 83 | Ga0436364_0129064 | 3300037853 | Bacteria | 1355 |
| 84 | Ga0395901_0000927 | 3300038443 | Bacteria | 31921 |
| 85 | Ga0395901_0011768 | 3300038443 | Bacteria | 8871 |
| 86 | Ga0395901_0029945 | 3300038443 | Bacteria | 5607 |
| 87 | Ga0436365_1206045 | 3300039437 | Bacteria | 1077 |
| 88 | Ga0436361_0288488 | 3300039447 | Bacteria | 760 |
| 89 | Ga0436363_0348240 | 3300039450 | Bacteria | 726 |
| 90 | Ga0466969_0088320 | 3300044656 | Unclassified | 1471 |
| 91 | Ga0466969_0377718 | 3300044656 | Bacteria | 642 |
| 92 | Ga0466966_0001227 | 3300044684 | Bacteria | 16468 |
| 93 | Ga0466966_0006567 | 3300044684 | Bacteria | 7700 |
| 94 | Ga0466966_0018568 | 3300044684 | Unclassified | 4584 |
| 95 | Ga0466966_0066376 | 3300044684 | Bacteria | 2267 |
| 96 | Ga0466966_0773041 | 3300044684 | Bacteria | 579 |
| 97 | Ga0466961_0003128 | 3300044693 | Bacteria | 10302 |
| 98 | Ga0466961_0035889 | 3300044693 | Unclassified | 3182 |
| 99 | Ga0466961_0041296 | 3300044693 | Bacteria | 2957 |
| 100 | Ga0466961_0149705 | 3300044693 | Bacteria | 1457 |
| 101 | Ga0466961_0184412 | 3300044693 | Unclassified | 1295 |
| 102 | Ga0466961_0193012 | 3300044693 | Bacteria | 1262 |
| 103 | Ga0466961_0354469 | 3300044693 | Unclassified | 893 |
| 104 | Ga0466961_0442985 | 3300044693 | Unclassified | 786 |
| 105 | Ga0466963_0001291 | 3300044694 | Bacteria | 13294 |
| 106 | Ga0466963_0004444 | 3300044694 | Bacteria | 8152 |
| 107 | Ga0466963_0033090 | 3300044694 | Bacteria | 3353 |
| 108 | Ga0466963_0066373 | 3300044694 | Bacteria | 2420 |
| 109 | Ga0466963_0095693 | 3300044694 | Unclassified | 2027 |
| 110 | Ga0466963_0103642 | 3300044694 | Bacteria | 1949 |
| 111 | Ga0466963_0158617 | 3300044694 | Bacteria | 1574 |
| 112 | Ga0466963_0212361 | 3300044694 | Bacteria | 1354 |
| 113 | Ga0466963_0247729 | 3300044694 | Bacteria | 1250 |
| 114 | Ga0466963_0471471 | 3300044694 | Unclassified | 886 |
| 115 | Ga0466964_0060459 | 3300044706 | Bacteria | 1576 |
| 116 | Ga0466964_0120447 | 3300044706 | Bacteria | 1182 |
| 117 | Ga0466971_0009439 | 3300044719 | Bacteria | 4260 |
| 118 | Ga0466971_0013831 | 3300044719 | Unclassified | 3549 |
| 119 | Ga0466971_0225316 | 3300044719 | Bacteria | 889 |
| 120 | Ga0466971_0226162 | 3300044719 | Bacteria | 888 |
| 121 | Ga0466971_0323011 | 3300044719 | Bacteria | 744 |
| 122 | Ga0466971_0459761 | 3300044719 | Unclassified | 625 |
| 123 | Ga0466968_0017686 | 3300044735 | Bacteria | 2853 |
| 124 | Ga0466968_0078418 | 3300044735 | Unclassified | 1448 |
| 125 | Ga0466968_0079112 | 3300044735 | Bacteria | 1442 |
| 126 | Ga0466968_0666368 | 3300044735 | Unclassified | 529 |
| 127 | Ga0466970_0064137 | 3300044765 | Bacteria | 1970 |
| 128 | Ga0466970_0318400 | 3300044765 | Bacteria | 879 |
| 129 | Ga0466957_0017686 | 3300044842 | Bacteria | 4180 |
| 130 | Ga0466957_0018445 | 3300044842 | Bacteria | 4098 |
| 131 | Ga0466957_0030193 | 3300044842 | Bacteria | 3236 |
| 132 | Ga0466957_0465842 | 3300044842 | Unclassified | 872 |
| 133 | Ga0466957_0536780 | 3300044842 | Bacteria | 814 |
| 134 | Ga0466957_0838101 | 3300044842 | Unclassified | 655 |
| 135 | Ga0466959_0000308 | 3300045049 | Bacteria | 28958 |
| 136 | Ga0466959_0000435 | 3300045049 | Bacteria | 24320 |
| 137 | Ga0466959_0019371 | 3300045049 | Bacteria | 5004 |
| 138 | Ga0466959_0035357 | 3300045049 | Unclassified | 3696 |
| 139 | Ga0466959_0255267 | 3300045049 | Unclassified | 1208 |
| 140 | Ga0466959_0278713 | 3300045049 | Bacteria | 1148 |
| 141 | Ga0466959_0343002 | 3300045049 | Bacteria | 1019 |
| 142 | Ga0466959_0720087 | 3300045049 | Bacteria | 668 |
| 143 | Ga0466958_0002018 | 3300045836 | Bacteria | 10011 |
| 144 | Ga0466958_0005597 | 3300045836 | Bacteria | 6779 |
| 145 | Ga0466958_0017729 | 3300045836 | Bacteria | 4122 |
| 146 | Ga0466958_0023440 | 3300045836 | Bacteria | 3624 |
| 147 | Ga0466958_0032746 | 3300045836 | Bacteria | 3093 |
| 148 | Ga0466958_0034269 | 3300045836 | Unclassified | 3028 |
| 149 | Ga0466958_0094541 | 3300045836 | Unclassified | 1852 |
| 150 | Ga0466958_0161683 | 3300045836 | Bacteria | 1415 |
| 151 | Ga0466958_0238206 | 3300045836 | Unclassified | 1162 |
| 152 | Ga0466958_0344393 | 3300045836 | Bacteria | 959 |
| 153 | Ga0466958_0602851 | 3300045836 | Bacteria | 714 |
| 154 | Ga0466967_0009948 | 3300045976 | Bacteria | 7101 |
| 155 | Ga0466967_0011788 | 3300045976 | Bacteria | 6647 |
| 156 | Ga0466967_0014698 | 3300045976 | Bacteria | 6111 |
| 157 | Ga0466967_0027762 | 3300045976 | Bacteria | 4712 |
| 158 | Ga0466967_0035223 | 3300045976 | Bacteria | 4258 |
| 159 | Ga0466967_0062180 | 3300045976 | Bacteria | 3314 |
| 160 | Ga0466967_0078284 | 3300045976 | Bacteria | 2978 |
| 161 | Ga0466967_0086069 | 3300045976 | Bacteria | 2847 |
| 162 | Ga0466967_0088445 | 3300045976 | Bacteria | 2811 |
| 163 | Ga0466967_0124094 | 3300045976 | Bacteria | 2390 |
| 164 | Ga0466967_0128108 | 3300045976 | Bacteria | 2353 |
| 165 | Ga0466967_0147862 | 3300045976 | Bacteria | 2193 |
| 166 | Ga0466967_0183351 | 3300045976 | Bacteria | 1975 |
| 167 | Ga0466967_0196413 | 3300045976 | Bacteria | 1909 |
| 168 | Ga0466967_0331321 | 3300045976 | Bacteria | 1470 |
| 169 | Ga0466967_0407180 | 3300045976 | Unclassified | 1324 |
| 170 | Ga0466967_0485372 | 3300045976 | Bacteria | 1211 |
| 171 | Ga0466967_0551040 | 3300045976 | Bacteria | 1135 |
| 172 | Ga0466967_0552232 | 3300045976 | Unclassified | 1134 |
| 173 | Ga0466967_0614806 | 3300045976 | Bacteria | 1073 |
| 174 | Ga0466967_0654599 | 3300045976 | Bacteria | 1039 |
| 175 | Ga0496113_0993869 | 3300048916 | Bacteria | 661 |
| 176 | Ga0501034_0022792 | 3300049571 | Bacteria | 6380 |
| 177 | Ga0501043_0005786 | 3300049579 | Bacteria | 9949 |
| 178 | Ga0501046_0009191 | 3300049580 | Bacteria | 8559 |
| 179 | Ga0501046_0655618 | 3300049580 | Unclassified | 742 |
| 180 | Ga0501047_0000178 | 3300049581 | Bacteria | 77670 |
| 181 | Ga0501047_0010295 | 3300049581 | Bacteria | 8844 |
| 182 | Ga0501047_0073844 | 3300049581 | Bacteria | 3284 |
| 183 | Ga0501047_0363233 | 3300049581 | Unclassified | 1283 |
| 184 | Ga0501067_0053767 | 3300049583 | Unclassified | 2231 |
| 185 | Ga0501068_0001304 | 3300049584 | Bacteria | 13220 |
| 186 | Ga0501068_0102762 | 3300049584 | Unclassified | 1772 |
| 187 | Ga0501069_0006691 | 3300049585 | Bacteria | 6035 |
| 188 | Ga0501069_0096647 | 3300049585 | Unclassified | 1674 |
| 189 | Ga0501070_0000096 | 3300049586 | Bacteria | 75811 |
| 190 | Ga0501070_0227380 | 3300049586 | Unclassified | 1529 |
| 191 | Ga0501070_0623278 | 3300049586 | Bacteria | 858 |
| 192 | Ga0501071_0972342 | 3300049587 | Bacteria | 656 |
| 193 | Ga0501072_0000266 | 3300049588 | Bacteria | 38055 |
| 194 | Ga0501073_0000049 | 3300049589 | Bacteria | 75259 |
| 195 | Ga0501073_0989598 | 3300049589 | Unclassified | 579 |
| 196 | Ga0501074_0000136 | 3300049590 | Bacteria | 38031 |
| 197 | Ga0501074_0919554 | 3300049590 | Unclassified | 616 |
| 198 | Ga0501079_0000329 | 3300049741 | Bacteria | 29869 |
| 199 | Ga0501080_0000008 | 3300049742 | Bacteria | 134920 |
| 200 | Ga0501080_0033763 | 3300049742 | Bacteria | 4776 |
| 201 | Ga0501083_0000196 | 3300049744 | Bacteria | 39027 |
| 202 | Ga0501035_0156366 | 3300049822 | Bacteria | 1976 |
| 203 | Ga0501035_0161205 | 3300049822 | Unclassified | 1941 |
| 204 | Ga0501035_0442579 | 3300049822 | Unclassified | 1076 |
| 205 | Ga0501044_0003405 | 3300049823 | Bacteria | 17914 |
| 206 | Ga0501082_0000124 | 3300060353 | Bacteria | 61918 |
| 207 | Ga0466962_0002589 | 3300061719 | Bacteria | 8593 |
| 208 | Ga0466962_0030021 | 3300061719 | Bacteria | 2602 |
| 209 | Ga0466962_0066812 | 3300061719 | Unclassified | 1717 |
| 210 | Ga0466962_0067852 | 3300061719 | Unclassified | 1703 |
| 211 | Ga0466962_0107947 | 3300061719 | Bacteria | 1339 |
| 212 | Ga0466958_0579474 | |||
| 213 | Ga0070658_10070710 | |||
| 214 | Ga0070658_10104149 | |||
| 215 | Ga0070683_100030151 | |||
| 216 | Ga0070683_100107254 | |||
| 217 | Ga0070680_100073679 | |||
| 218 | Ga0070660_100017369 | |||
| 219 | Ga0070660_100033563 | |||
| 220 | Ga0070660_100086905 | |||
| 221 | Ga0070661_100018822 | |||
| 222 | Ga0070659_100314970 | |||
| 223 | Ga0070659_100408496 | |||
| 224 | Ga0070659_101440374 | |||
| 225 | Ga0070714_100029868 | |||
| 226 | Ga0070714_100181398 | |||
| 227 | Ga0070714_100385686 | |||
| 228 | Ga0070663_100099860 | |||
| 229 | Ga0070681_10003531 | |||
| 230 | Ga0070707_101333834 | |||
| 231 | Ga0070679_100017354 | |||
| 232 | Ga0070684_100067390 | |||
| 233 | Ga0068853_100183595 | |||
| 234 | Ga0068855_100053472 | |||
| 235 | Ga0068855_100347072 | |||
| 236 | Ga0068857_100126757 | |||
| 237 | Ga0068854_100180856 | |||
| 238 | Ga0068856_100047452 | |||
| 239 | Ga0068856_100129698 | |||
| 240 | Ga0068856_100734554 | |||
| 241 | Ga0068856_101309301 | |||
| 242 | Ga0068852_100013595 | |||
| 243 | Ga0070712_100945828 | |||
| 244 | Ga0105240_10132188 | |||
| 245 | Ga0105237_10848385 | |||
| 246 | Ga0157373_10107344 | |||
| 247 | Ga0157370_10023434 | |||
| 248 | Ga0157370_10116942 | |||
| 249 | Ga0157370_10337473 | |||
| 250 | Ga0157369_10005333 | |||
| 251 | Ga0157369_10019394 | |||
| 252 | Ga0157369_10252555 | |||
| 253 | Ga0157369_10700839 | |||
| 254 | Ga0157372_10015758 | |||
| 255 | Ga0157372_10493938 | |||
| 256 | Ga0206356_11694475 | |||
| 257 | Ga0206354_10004426 | |||
| 258 | Ga0206354_10900999 | |||
| 259 | Ga0206353_10238928 | |||
| 260 | Ga0206353_10976970 | |||
| 261 | Ga0207705_10345217 | |||
| 262 | Ga0207705_10552952 | |||
| 263 | Ga0207707_10178837 | |||
| 264 | Ga0207660_10587809 | |||
| 265 | Ga0207657_10001123 | |||
| 266 | Ga0207657_10017382 | |||
| 267 | Ga0207657_10045409 | |||
| 268 | Ga0207649_10026251 | |||
| 269 | Ga0207664_10001372 | |||
| 270 | Ga0207664_10514445 | |||
| 271 | Ga0207690_10227660 | |||
| 272 | Ga0207661_10008285 | |||
| 273 | Ga0207661_10110996 | |||
| 274 | Ga0207661_10577447 | |||
| 275 | Ga0207667_10094845 | |||
| 276 | Ga0207667_10603856 | |||
| 277 | Ga0207639_10267741 | |||
| 278 | Ga0207702_10090558 | |||
| 279 | Ga0207702_10566010 | |||
| 280 | Ga0207674_10205132 | |||
| 281 | Ga0207698_10026548 | |||
| 282 | Ga0207698_10649090 | |||
| 283 | Ga0395899_0029965 | |||
| 284 | Ga0395899_0059080 | |||
| 285 | Ga0395899_0520808 | |||
| 286 | Ga0395900_0023530 | |||
| 287 | Ga0395900_1236579 | |||
| 288 | Ga0395898_0005234 | |||
| 289 | Ga0395898_0053825 | |||
| 290 | Ga0395898_0072802 | |||
| 291 | Ga0395905_0083943 | |||
| 292 | Ga0395905_0339158 | |||
| 293 | Ga0395905_0826663 | |||
| 294 | Ga0436364_0129064 | |||
| 295 | Ga0395901_0000927 | |||
| 296 | Ga0395901_0011768 | |||
| 297 | Ga0395901_0029945 | |||
| 298 | Ga0436365_1206045 | |||
| 299 | Ga0436361_0288488 | |||
| 300 | Ga0436363_0348240 | |||
| 301 | Ga0466969_0088320 | |||
| 302 | Ga0466969_0377718 | |||
| 303 | Ga0466966_0001227 | |||
| 304 | Ga0466966_0006567 | |||
| 305 | Ga0466966_0018568 | |||
| 306 | Ga0466966_0066376 | |||
| 307 | Ga0466966_0773041 | |||
| 308 | Ga0466961_0003128 | |||
| 309 | Ga0466961_0035889 | |||
| 310 | Ga0466961_0041296 | |||
| 311 | Ga0466961_0149705 | |||
| 312 | Ga0466961_0184412 | |||
| 313 | Ga0466961_0193012 | |||
| 314 | Ga0466961_0354469 | |||
| 315 | Ga0466961_0442985 | |||
| 316 | Ga0466963_0001291 | |||
| 317 | Ga0466963_0004444 | |||
| 318 | Ga0466963_0033090 | |||
| 319 | Ga0466963_0066373 | |||
| 320 | Ga0466963_0095693 | |||
| 321 | Ga0466963_0103642 | |||
| 322 | Ga0466963_0158617 | |||
| 323 | Ga0466963_0212361 | |||
| 324 | Ga0466963_0247729 | |||
| 325 | Ga0466963_0471471 | |||
| 326 | Ga0466964_0060459 | |||
| 327 | Ga0466964_0120447 | |||
| 328 | Ga0466971_0009439 | |||
| 329 | Ga0466971_0013831 | |||
| 330 | Ga0466971_0225316 | |||
| 331 | Ga0466971_0226162 | |||
| 332 | Ga0466971_0323011 | |||
| 333 | Ga0466971_0459761 | |||
| 334 | Ga0466968_0017686 | |||
| 335 | Ga0466968_0078418 | |||
| 336 | Ga0466968_0079112 | |||
| 337 | Ga0466968_0666368 | |||
| 338 | Ga0466970_0064137 | |||
| 339 | Ga0466970_0318400 | |||
| 340 | Ga0466957_0017686 | |||
| 341 | Ga0466957_0018445 | |||
| 342 | Ga0466957_0030193 | |||
| 343 | Ga0466957_0465842 | |||
| 344 | Ga0466957_0536780 | |||
| 345 | Ga0466957_0838101 | |||
| 346 | Ga0466959_0000308 | |||
| 347 | Ga0466959_0000435 | |||
| 348 | Ga0466959_0019371 | |||
| 349 | Ga0466959_0035357 | |||
| 350 | Ga0466959_0255267 | |||
| 351 | Ga0466959_0278713 | |||
| 352 | Ga0466959_0343002 | |||
| 353 | Ga0466959_0720087 | |||
| 354 | Ga0466958_0002018 | |||
| 355 | Ga0466958_0005597 | |||
| 356 | Ga0466958_0017729 | |||
| 357 | Ga0466958_0023440 | |||
| 358 | Ga0466958_0032746 | |||
| 359 | Ga0466958_0034269 | |||
| 360 | Ga0466958_0094541 | |||
| 361 | Ga0466958_0161683 | |||
| 362 | Ga0466958_0238206 | |||
| 363 | Ga0466958_0344393 | |||
| 364 | Ga0466958_0602851 | |||
| 365 | Ga0466967_0009948 | |||
| 366 | Ga0466967_0011788 | |||
| 367 | Ga0466967_0014698 | |||
| 368 | Ga0466967_0027762 | |||
| 369 | Ga0466967_0035223 | |||
| 370 | Ga0466967_0062180 | |||
| 371 | Ga0466967_0078284 | |||
| 372 | Ga0466967_0086069 | |||
| 373 | Ga0466967_0088445 | |||
| 374 | Ga0466967_0124094 | |||
| 375 | Ga0466967_0128108 | |||
| 376 | Ga0466967_0147862 | |||
| 377 | Ga0466967_0183351 | |||
| 378 | Ga0466967_0196413 | |||
| 379 | Ga0466967_0331321 | |||
| 380 | Ga0466967_0407180 | |||
| 381 | Ga0466967_0485372 | |||
| 382 | Ga0466967_0551040 | |||
| 383 | Ga0466967_0552232 | |||
| 384 | Ga0466967_0614806 | |||
| 385 | Ga0466967_0654599 | |||
| 386 | Ga0496113_0993869 | |||
| 387 | Ga0501034_0022792 | |||
| 388 | Ga0501043_0005786 | |||
| 389 | Ga0501046_0009191 | |||
| 390 | Ga0501046_0655618 | |||
| 391 | Ga0501047_0000178 | |||
| 392 | Ga0501047_0010295 | |||
| 393 | Ga0501047_0073844 | |||
| 394 | Ga0501047_0363233 | |||
| 395 | Ga0501067_0053767 | |||
| 396 | Ga0501068_0001304 | |||
| 397 | Ga0501068_0102762 | |||
| 398 | Ga0501069_0006691 | |||
| 399 | Ga0501069_0096647 | |||
| 400 | Ga0501070_0000096 | |||
| 401 | Ga0501070_0227380 | |||
| 402 | Ga0501070_0623278 | |||
| 403 | Ga0501071_0972342 | |||
| 404 | Ga0501072_0000266 | |||
| 405 | Ga0501073_0000049 | |||
| 406 | Ga0501073_0989598 | |||
| 407 | Ga0501074_0000136 | |||
| 408 | Ga0501074_0919554 | |||
| 409 | Ga0501079_0000329 | |||
| 410 | Ga0501080_0000008 | |||
| 411 | Ga0501080_0033763 | |||
| 412 | Ga0501083_0000196 | |||
| 413 | Ga0501035_0156366 | |||
| 414 | Ga0501035_0161205 | |||
| 415 | Ga0501035_0442579 | |||
| 416 | Ga0501044_0003405 | |||
| 417 | Ga0501082_0000124 | |||
| 418 | Ga0466962_0002589 | |||
| 419 | Ga0466962_0030021 | |||
| 420 | Ga0466962_0066812 | |||
| 421 | Ga0466962_0067852 | |||
| 422 | Ga0466962_0107947 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5fq0-assembly1.cif.gz_A | the structure of kdgf from halomonas sp. | 0.9166 | 10 | 115 |
| 2pfw-assembly1.cif.gz_B | crystal structure of a rmlc-like cupin (sfri_3105) from shewanella frigidimarina ncimb 400 at 1.90 a resolution | 0.9152 | 10 | 117 |
| 7zyb-assembly1.cif.gz_A | bekdgf with ca | 0.9147 | 10 | 117 |
| 5fq0-assembly2.cif.gz_D | the structure of kdgf from halomonas sp. | 0.9134 | 10 | 115 |
| 2ozj-assembly2.cif.gz_B-3 | crystal structure of a cupin superfamily protein (dsy2733) from desulfitobacterium hafniense dcb-2 at 1.60 a resolution | 0.9087 | 11 | 109 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3fjsA00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9264 | 25 | 109 | 2.60.120.10 |
| 2pfwB00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8997 | 10 | 117 | 2.60.120.10 |
| 1o4tB00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8955 | 11 | 110 | 2.60.120.10 |
| 2dctB00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8907 | 11 | 110 | 2.60.120.10 |
| 1gqhB01 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.887 | 5 | 125 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q3PA46-F1-model_v4 | deleted | 0.946 | 10 | 158 |
|
| AF-A0A2V7VZW7-F1-model_v4 | Cupin domain-containing protein | 0.936 | 3 | 153 |
|
| AF-A0A5B8U9N1-F1-model_v4 | Cupin domain-containing protein | 0.932 | 2 | 160 |
|
| AF-A0A6J4PXV2-F1-model_v4 | Cupin type-2 domain-containing protein | 0.9319 | 4 | 114 |
|
| AF-A0A5C7SN96-F1-model_v4 | Cupin domain-containing protein | 0.9293 | 10 | 158 |
|