F321827
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 211 | 112 | 422 | 341 |
Family's Representative Sequence
| Representative Sequence | 3300036647|Ga0316582_0007304|Ga0316582_0007304_2474_3640 |
| Length | 388 |
| Sequence | MPKKAQWRTQVQPPGQLWKGQQLKGVSIRDRSNCGLPKNNVTLEDKMALQSTWFFVWGLLWAVFFITDGFDLGIGTLYPFLGKSENDKRVMINAMGPLWDGNQVWLLTAGGVTFAAFPTLYAVMFSSLXXALMLILFALIIRGVAFEFRKKMTSTGGRRLWDLCIFLGSFLPALLFGVAFANIFRGLPIDADGIFRGTLLTLLNPYGLLGGVLFVLLFLIHGAIWLSIKSDGALHDRAVTTGKLLWPVLLIVAVIFLVNSAVSTNLYANYLAHPLLFVIILVTVAALLGIRVYLARRAYFKAWFSSALTIIGATFYGIIGLYPNMFPSTIDPAYSLTAFNASSSPLTLKIMLVVALIFVPIVLLYQAWAYNLFKSKITLKELTYEEYY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 2 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 3 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 4 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 7 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 8 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 9 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 10 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 11 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 12 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 13 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 14 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 15 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 16 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 17 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 18 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 19 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 20 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 21 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 22 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 23 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 24 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 25 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 26 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 27 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 28 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 29 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 30 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 31 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 32 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 33 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 34 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 35 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 36 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 37 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 38 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 39 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 40 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 41 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 42 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 43 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 44 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 45 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 46 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 47 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 48 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 49 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 50 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 51 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 52 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 53 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 54 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 55 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 56 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 57 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 58 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 59 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 60 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 61 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 62 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 63 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 64 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 65 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 66 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 67 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 68 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 69 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 70 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 71 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 72 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 73 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 74 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 75 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 76 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 77 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 78 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 79 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 80 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 81 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 82 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 83 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 84 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 85 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 86 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 87 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 88 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 91 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 92 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 93 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 94 | 2643221597 | Microbacterium sp. Root180 | Isolate | Unclassified |
| 95 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 96 | 2643221635 | Yonghaparkia sp. Root332 | Isolate | Unclassified |
| 97 | 2808606306 | Microbacterium sp. SLBN-146 | Isolate | Unclassified |
| 98 | 2811994872 | Microbacterium sp. MU4Y-5-1 | Isolate | Unclassified |
| 99 | 2821268502 | Microbacterium sp. YT0620BN | Isolate | Unclassified |
| 100 | 2833709550 | Microbacterium sp. 3290 | Isolate | Rhizosphere |
| 101 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 102 | 2857720070 | Microbacterium sp. R-72113 | Isolate | Unclassified |
| 103 | 2870622029 | Conyzicola lurida DSM 105784 | Isolate | Unclassified |
| 104 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 105 | 2928090899 | Microbacterium sp. 1262 | Isolate | Rhizosphere |
| 106 | 2939657138 | Conyzicola nivalis 2857 | Isolate | Rhizosphere |
| 107 | 2984580707 | Microbacterium paludicola SORGH_AS919 | Isolate | Aerial Root |
| 108 | 2995726249 | Leucobacter zeae CC-MF41 | Isolate | Rhizosphere |
| 109 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 110 | 8002811521 | Leucobacter chinensis NC76-1 | Isolate | Rhizosphere |
| 111 | 8055034563 | Leucobacter allii H21R-40 | Isolate | Rhizosphere |
| 112 | 8055037949 | Leucobacter rhizosphaerae H25R-14 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 81.52 |
| Metatranscriptomes | 9 |
| Isolates | 9.48 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.47 |
| Bulb | 0 |
| Endosphere | 4.27 |
| Nodule | 1.42 |
| Rhizoplane | 2.37 |
| Rhizosphere | 80.57 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.9 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0316582_0007304 | 3300036647 | Bacteria | 5876 |
| 2 | Ga0055526_1003515 | 3300003771 | Bacteria | 9907 |
| 3 | Ga0055524_1000069 | 3300003775 | Bacteria | 128956 |
| 4 | Ga0070687_100215774 | 3300005343 | Bacteria | 1172 |
| 5 | Ga0070669_100170771 | 3300005353 | Bacteria | 1695 |
| 6 | Ga0070701_10202672 | 3300005438 | Bacteria | 1174 |
| 7 | Ga0068854_100266921 | 3300005578 | Bacteria | 1372 |
| 8 | Ga0075365_10059938 | 3300006038 | Bacteria | 2538 |
| 9 | Ga0209564_1000052 | 3300025295 | Bacteria | 356578 |
| 10 | Ga0209256_1000172 | 3300025299 | Bacteria | 129025 |
| 11 | Ga0207643_10117339 | 3300025908 | Bacteria | 1573 |
| 12 | Ga0207671_10127477 | 3300025914 | Unclassified | 1951 |
| 13 | Ga0207662_10117701 | 3300025918 | Bacteria | 1663 |
| 14 | Ga0207690_10305308 | 3300025932 | Bacteria | 1246 |
| 15 | Ga0207706_10136519 | 3300025933 | Bacteria | 2157 |
| 16 | Ga0207689_10180212 | 3300025942 | Bacteria | 1742 |
| 17 | Ga0207661_10177765 | 3300025944 | Bacteria | 1857 |
| 18 | Ga0207708_10152542 | 3300026075 | Bacteria | 1820 |
| 19 | Ga0207676_10137353 | 3300026095 | Bacteria | 2088 |
| 20 | Ga0207683_10270597 | 3300026121 | Bacteria | 1552 |
| 21 | Ga0207698_10182597 | 3300026142 | Bacteria | 1860 |
| 22 | Ga0265334_10022135 | 3300028573 | Bacteria | 2593 |
| 23 | Ga0265332_10019246 | 3300031238 | Bacteria | 3013 |
| 24 | Ga0265332_10061543 | 3300031238 | Bacteria | 1605 |
| 25 | Ga0265340_10001433 | 3300031247 | Bacteria | 13676 |
| 26 | Ga0265339_10071107 | 3300031249 | Bacteria | 1854 |
| 27 | Ga0265331_10060434 | 3300031250 | Bacteria | 1790 |
| 28 | Ga0265316_10171058 | 3300031344 | Bacteria | 1621 |
| 29 | Ga0316575_10000527 | 3300031665 | Bacteria | 11198 |
| 30 | Ga0316579_10005621 | 3300031691 | Bacteria | 5073 |
| 31 | Ga0316579_10011648 | 3300031691 | Bacteria | 3742 |
| 32 | Ga0316579_10013992 | 3300031691 | Bacteria | 3460 |
| 33 | Ga0316579_10077837 | 3300031691 | Bacteria | 1576 |
| 34 | Ga0265314_10045213 | 3300031711 | Bacteria | 3115 |
| 35 | Ga0316576_10001402 | 3300031727 | Bacteria | 12898 |
| 36 | Ga0316576_10001405 | 3300031727 | Bacteria | 12892 |
| 37 | Ga0316576_10004677 | 3300031727 | Bacteria | 8252 |
| 38 | Ga0316576_10014600 | 3300031727 | Bacteria | 5249 |
| 39 | Ga0316576_10028440 | 3300031727 | Bacteria | 3940 |
| 40 | Ga0316576_10050913 | 3300031727 | Bacteria | 3013 |
| 41 | Ga0316576_10135817 | 3300031727 | Bacteria | 1851 |
| 42 | Ga0316576_10141659 | 3300031727 | Bacteria | 1810 |
| 43 | Ga0316576_10165415 | 3300031727 | Bacteria | 1669 |
| 44 | Ga0316576_10166217 | 3300031727 | Bacteria | 1665 |
| 45 | Ga0316576_10240633 | 3300031727 | Bacteria | 1360 |
| 46 | Ga0316576_10347960 | 3300031727 | Bacteria | 1103 |
| 47 | Ga0316578_10000222 | 3300031728 | Bacteria | 16537 |
| 48 | Ga0316578_10000517 | 3300031728 | Bacteria | 13122 |
| 49 | Ga0316578_10008302 | 3300031728 | Bacteria | 5276 |
| 50 | Ga0316578_10026711 | 3300031728 | Bacteria | 3258 |
| 51 | Ga0316578_10047802 | 3300031728 | Bacteria | 2497 |
| 52 | Ga0316578_10111728 | 3300031728 | Bacteria | 1641 |
| 53 | Ga0316577_10002019 | 3300031733 | Bacteria | 9891 |
| 54 | Ga0316577_10060990 | 3300031733 | Bacteria | 2105 |
| 55 | Ga0316577_10090740 | 3300031733 | Bacteria | 1710 |
| 56 | Ga0316577_10127879 | 3300031733 | Bacteria | 1429 |
| 57 | Ga0316577_10142820 | 3300031733 | Bacteria | 1348 |
| 58 | Ga0307415_100019643 | 3300032126 | Bacteria | 4108 |
| 59 | Ga0316583_10001784 | 3300032133 | Bacteria | 7314 |
| 60 | Ga0316583_10002276 | 3300032133 | Bacteria | 6613 |
| 61 | Ga0316583_10003488 | 3300032133 | Bacteria | 5540 |
| 62 | Ga0316583_10005714 | 3300032133 | Bacteria | 4473 |
| 63 | Ga0316583_10011926 | 3300032133 | Bacteria | 3137 |
| 64 | Ga0316583_10018947 | 3300032133 | Bacteria | 2472 |
| 65 | Ga0316585_10001106 | 3300032137 | Bacteria | 7031 |
| 66 | Ga0316585_10001146 | 3300032137 | Bacteria | 6899 |
| 67 | Ga0316585_10023221 | 3300032137 | Bacteria | 1912 |
| 68 | Ga0316585_10028779 | 3300032137 | Bacteria | 1738 |
| 69 | Ga0316580_10007997 | 3300032139 | Bacteria | 3161 |
| 70 | Ga0316580_10043387 | 3300032139 | Bacteria | 1387 |
| 71 | Ga0316593_10000203 | 3300032168 | Bacteria | 9289 |
| 72 | Ga0316593_10001053 | 3300032168 | Bacteria | 5758 |
| 73 | Ga0316593_10001685 | 3300032168 | Bacteria | 4977 |
| 74 | Ga0316593_10002212 | 3300032168 | Bacteria | 4553 |
| 75 | Ga0316593_10010255 | 3300032168 | Bacteria | 2680 |
| 76 | Ga0316593_10010261 | 3300032168 | Bacteria | 2679 |
| 77 | Ga0316593_10012864 | 3300032168 | Bacteria | 2464 |
| 78 | Ga0316593_10012870 | 3300032168 | Unclassified | 2463 |
| 79 | Ga0316593_10012880 | 3300032168 | Bacteria | 2463 |
| 80 | Ga0316593_10039440 | 3300032168 | Bacteria | 1567 |
| 81 | Ga0316593_10040654 | 3300032168 | Bacteria | 1546 |
| 82 | Ga0316592_1000113 | 3300033524 | Bacteria | 8486 |
| 83 | Ga0316596_1000732 | 3300033541 | Bacteria | 5996 |
| 84 | Ga0316596_1001838 | 3300033541 | Bacteria | 4419 |
| 85 | Ga0316596_1002120 | 3300033541 | Bacteria | 4190 |
| 86 | Ga0316596_1002436 | 3300033541 | Bacteria | 3970 |
| 87 | Ga0316596_1003667 | 3300033541 | Bacteria | 3387 |
| 88 | Ga0316596_1005543 | 3300033541 | Bacteria | 2888 |
| 89 | Ga0316596_1006144 | 3300033541 | Bacteria | 2781 |
| 90 | Ga0373954_0003317 | 3300035118 | Bacteria | 6807 |
| 91 | Ga0373957_0035284 | 3300035120 | Bacteria | 1857 |
| 92 | Ga0373955_0003519 | 3300035172 | Bacteria | 6890 |
| 93 | Ga0316574_0000089 | 3300035398 | Bacteria | 26124 |
| 94 | Ga0316574_0001230 | 3300035398 | Bacteria | 11918 |
| 95 | Ga0316574_0001678 | 3300035398 | Bacteria | 10682 |
| 96 | Ga0316574_0028657 | 3300035398 | Bacteria | 3359 |
| 97 | Ga0316574_0033708 | 3300035398 | Bacteria | 3117 |
| 98 | Ga0316574_0226083 | 3300035398 | Bacteria | 1198 |
| 99 | Ga0373933_0005888 | 3300035724 | Bacteria | 6669 |
| 100 | Ga0373937_0118040 | 3300036401 | Bacteria | 2471 |
| 101 | Ga0373937_0131297 | 3300036401 | Bacteria | 2339 |
| 102 | Ga0316582_0008146 | 3300036647 | Bacteria | 5617 |
| 103 | Ga0316582_0026396 | 3300036647 | Bacteria | 3497 |
| 104 | Ga0316582_0058841 | 3300036647 | Bacteria | 2458 |
| 105 | Ga0316582_0096136 | 3300036647 | Bacteria | 1956 |
| 106 | Ga0316582_0102699 | 3300036647 | Bacteria | 1895 |
| 107 | Ga0316582_0111878 | 3300036647 | Bacteria | 1818 |
| 108 | Ga0316582_0115563 | 3300036647 | Bacteria | 1790 |
| 109 | Ga0316582_0119989 | 3300036647 | Bacteria | 1759 |
| 110 | Ga0316582_0172089 | 3300036647 | Bacteria | 1471 |
| 111 | Ga0316584_0003202 | 3300036712 | Bacteria | 10596 |
| 112 | Ga0316584_0003995 | 3300036712 | Bacteria | 9703 |
| 113 | Ga0316584_0004852 | 3300036712 | Bacteria | 8949 |
| 114 | Ga0316584_0068657 | 3300036712 | Bacteria | 2657 |
| 115 | Ga0316584_0092555 | 3300036712 | Bacteria | 2263 |
| 116 | Ga0316584_0096496 | 3300036712 | Bacteria | 2213 |
| 117 | Ga0316584_0108538 | 3300036712 | Bacteria | 2076 |
| 118 | Ga0316584_0125314 | 3300036712 | Bacteria | 1919 |
| 119 | Ga0316584_0238027 | 3300036712 | Bacteria | 1333 |
| 120 | Ga0316584_0287186 | 3300036712 | Bacteria | 1194 |
| 121 | Ga0316584_0307858 | 3300036712 | Unclassified | 1146 |
| 122 | Ga0395899_0010808 | 3300037312 | Bacteria | 6998 |
| 123 | Ga0395900_0032974 | 3300037418 | Bacteria | 5330 |
| 124 | Ga0395898_0242980 | 3300037466 | Bacteria | 1717 |
| 125 | Ga0395905_0002859 | 3300037471 | Bacteria | 18881 |
| 126 | Ga0316581_0042748 | 3300037588 | Bacteria | 1383 |
| 127 | Ga0395901_0078999 | 3300038443 | Bacteria | 3435 |
| 128 | Ga0400485_04359 | 3300038735 | Bacteria | 24094 |
| 129 | Ga0400488_08901 | 3300038741 | Bacteria | 1610 |
| 130 | Ga0400486_10871 | 3300038742 | Bacteria | 15212 |
| 131 | Ga0400486_14516 | 3300038742 | Bacteria | 3208 |
| 132 | Ga0400486_17332 | 3300038742 | Bacteria | 21351 |
| 133 | Ga0400483_042104 | 3300039062 | Bacteria | 5488 |
| 134 | Ga0400483_224181 | 3300039062 | Bacteria | 2831 |
| 135 | Ga0400489_14965 | 3300039093 | Bacteria | 21216 |
| 136 | Ga0400489_28023 | 3300039093 | Bacteria | 8665 |
| 137 | Ga0400489_28607 | 3300039093 | Bacteria | 42332 |
| 138 | Ga0400487_07267 | 3300039110 | Unclassified | 3422 |
| 139 | Ga0400487_17700 | 3300039110 | Bacteria | 22800 |
| 140 | Ga0400487_53183 | 3300039110 | Bacteria | 6165 |
| 141 | Ga0451793_0633042 | 3300041452 | Bacteria | 1778 |
| 142 | Ga0451797_0451767 | 3300041453 | Bacteria | 2337 |
| 143 | Ga0451577_0000672 | 3300042876 | Bacteria | 53809 |
| 144 | Ga0451577_0024695 | 3300042876 | Bacteria | 5464 |
| 145 | Ga0451577_0053380 | 3300042876 | Bacteria | 3608 |
| 146 | Ga0451577_0140390 | 3300042876 | Bacteria | 2171 |
| 147 | Ga0453683_0008247 | 3300044673 | Bacteria | 7005 |
| 148 | Ga0453684_0001684 | 3300044712 | Bacteria | 59748 |
| 149 | Ga0453684_0001751 | 3300044712 | Bacteria | 58062 |
| 150 | Ga0453684_0002522 | 3300044712 | Bacteria | 44120 |
| 151 | Ga0453684_0004364 | 3300044712 | Bacteria | 30005 |
| 152 | Ga0453684_0005864 | 3300044712 | Bacteria | 23869 |
| 153 | Ga0453684_0013188 | 3300044712 | Bacteria | 13473 |
| 154 | Ga0453684_0019870 | 3300044712 | Bacteria | 10190 |
| 155 | Ga0453684_0026506 | 3300044712 | Bacteria | 8364 |
| 156 | Ga0453684_0029196 | 3300044712 | Bacteria | 7842 |
| 157 | Ga0453684_0030265 | 3300044712 | Bacteria | 7654 |
| 158 | Ga0453684_0031476 | 3300044712 | Bacteria | 7454 |
| 159 | Ga0453684_0052777 | 3300044712 | Bacteria | 5312 |
| 160 | Ga0453684_0078272 | 3300044712 | Bacteria | 4138 |
| 161 | Ga0453684_0178394 | 3300044712 | Bacteria | 2496 |
| 162 | Ga0451576_0001800 | 3300045051 | Bacteria | 35046 |
| 163 | Ga0495592_0033487 | 3300046454 | Bacteria | 3875 |
| 164 | Ga0495629_0002236 | 3300046459 | Bacteria | 14921 |
| 165 | Ga0495653_0028308 | 3300046463 | Bacteria | 4480 |
| 166 | Ga0495652_0020178 | 3300046529 | Bacteria | 5923 |
| 167 | Ga0495640_0032745 | 3300046533 | Bacteria | 3699 |
| 168 | Ga0495622_0010738 | 3300046557 | Bacteria | 4226 |
| 169 | Ga0495667_0024143 | 3300046559 | Bacteria | 4094 |
| 170 | Ga0495635_0000615 | 3300046663 | Bacteria | 22950 |
| 171 | Ga0495657_0027792 | 3300046675 | Bacteria | 3988 |
| 172 | Ga0495657_0047870 | 3300046675 | Bacteria | 2887 |
| 173 | Ga0495599_0001256 | 3300046678 | Bacteria | 14392 |
| 174 | Ga0495646_0020009 | 3300046680 | Bacteria | 4232 |
| 175 | Ga0495624_0128131 | 3300046690 | Bacteria | 1557 |
| 176 | Ga0495600_0032813 | 3300046809 | Bacteria | 3369 |
| 177 | Ga0495604_0004846 | 3300047317 | Bacteria | 10658 |
| 178 | Ga0495675_0087892 | 3300047444 | Bacteria | 1952 |
| 179 | Ga0495684_0008393 | 3300047471 | Bacteria | 7999 |
| 180 | Ga0495593_0000594 | 3300047673 | Bacteria | 20595 |
| 181 | Ga0495602_0197875 | 3300048088 | Bacteria | 1535 |
| 182 | Ga0496104_0142172 | 3300048907 | Bacteria | 2305 |
| 183 | Ga0496105_0296036 | 3300048908 | Bacteria | 1302 |
| 184 | Ga0496113_0063398 | 3300048916 | Bacteria | 2793 |
| 185 | Ga0496125_0073016 | 3300048928 | Bacteria | 2670 |
| 186 | Ga0495595_0053574 | 3300053084 | Bacteria | 1874 |
| 187 | Ga0495619_0000854 | 3300053085 | Bacteria | 19986 |
| 188 | Ga0500650_0003284 | 3300053098 | Bacteria | 5583 |
| 189 | Ga0500573_0032650 | 3300053140 | Bacteria | 3003 |
| 190 | Ga0500573_0111385 | 3300053140 | Bacteria | 1531 |
| 191 | Ga0500590_000057 | 3300053148 | Bacteria | 27288 |
| 192 | 2643986519 | 2643221595 | Bacteria | 6565519 |
| 193 | 2643995048 | 2643221597 | Bacteria | 3347721 |
| 194 | 2644152750 | 2643221627 | Bacteria | 6761570 |
| 195 | 2644198494 | 2643221635 | Bacteria | 2632343 |
| 196 | 2808630300 | 2808606306 | Bacteria | 3608896 |
| 197 | 2812324229 | 2811994872 | Bacteria | 4121241 |
| 198 | 2821270909 | 2821268502 | Bacteria | 3750023 |
| 199 | 2833711897 | 2833709550 | Bacteria | 4008291 |
| 200 | 2857374870 | 2857367948 | Bacteria | 6965560 |
| 201 | 2857722459 | 2857720070 | Bacteria | 3189373 |
| 202 | 2870623822 | 2870622029 | Bacteria | 3643329 |
| 203 | 2924734083 | 2924733363 | Bacteria | 7574837 |
| 204 | 2928092621 | 2928090899 | Bacteria | 3158267 |
| 205 | 2939658308 | 2939657138 | Bacteria | 3740283 |
| 206 | 2984583842 | 2984580707 | Bacteria | 3351387 |
| 207 | 2995727857 | 2995726249 | Bacteria | 3470435 |
| 208 | 3004272317 | 3004268573 | Bacteria | 7043476 |
| 209 | 8002811834 | 8002811521 | Bacteria | 2942897 |
| 210 | 8055036160 | 8055034563 | Bacteria | 3562128 |
| 211 | 8055038337 | 8055037949 | Bacteria | 3337834 |
| 212 | Ga0316582_0007304 | |||
| 213 | Ga0055526_1003515 | |||
| 214 | Ga0055524_1000069 | |||
| 215 | Ga0070687_100215774 | |||
| 216 | Ga0070669_100170771 | |||
| 217 | Ga0070701_10202672 | |||
| 218 | Ga0068854_100266921 | |||
| 219 | Ga0075365_10059938 | |||
| 220 | Ga0209564_1000052 | |||
| 221 | Ga0209256_1000172 | |||
| 222 | Ga0207643_10117339 | |||
| 223 | Ga0207671_10127477 | |||
| 224 | Ga0207662_10117701 | |||
| 225 | Ga0207690_10305308 | |||
| 226 | Ga0207706_10136519 | |||
| 227 | Ga0207689_10180212 | |||
| 228 | Ga0207661_10177765 | |||
| 229 | Ga0207708_10152542 | |||
| 230 | Ga0207676_10137353 | |||
| 231 | Ga0207683_10270597 | |||
| 232 | Ga0207698_10182597 | |||
| 233 | Ga0265334_10022135 | |||
| 234 | Ga0265332_10019246 | |||
| 235 | Ga0265332_10061543 | |||
| 236 | Ga0265340_10001433 | |||
| 237 | Ga0265339_10071107 | |||
| 238 | Ga0265331_10060434 | |||
| 239 | Ga0265316_10171058 | |||
| 240 | Ga0316575_10000527 | |||
| 241 | Ga0316579_10005621 | |||
| 242 | Ga0316579_10011648 | |||
| 243 | Ga0316579_10013992 | |||
| 244 | Ga0316579_10077837 | |||
| 245 | Ga0265314_10045213 | |||
| 246 | Ga0316576_10001402 | |||
| 247 | Ga0316576_10001405 | |||
| 248 | Ga0316576_10004677 | |||
| 249 | Ga0316576_10014600 | |||
| 250 | Ga0316576_10028440 | |||
| 251 | Ga0316576_10050913 | |||
| 252 | Ga0316576_10135817 | |||
| 253 | Ga0316576_10141659 | |||
| 254 | Ga0316576_10165415 | |||
| 255 | Ga0316576_10166217 | |||
| 256 | Ga0316576_10240633 | |||
| 257 | Ga0316576_10347960 | |||
| 258 | Ga0316578_10000222 | |||
| 259 | Ga0316578_10000517 | |||
| 260 | Ga0316578_10008302 | |||
| 261 | Ga0316578_10026711 | |||
| 262 | Ga0316578_10047802 | |||
| 263 | Ga0316578_10111728 | |||
| 264 | Ga0316577_10002019 | |||
| 265 | Ga0316577_10060990 | |||
| 266 | Ga0316577_10090740 | |||
| 267 | Ga0316577_10127879 | |||
| 268 | Ga0316577_10142820 | |||
| 269 | Ga0307415_100019643 | |||
| 270 | Ga0316583_10001784 | |||
| 271 | Ga0316583_10002276 | |||
| 272 | Ga0316583_10003488 | |||
| 273 | Ga0316583_10005714 | |||
| 274 | Ga0316583_10011926 | |||
| 275 | Ga0316583_10018947 | |||
| 276 | Ga0316585_10001106 | |||
| 277 | Ga0316585_10001146 | |||
| 278 | Ga0316585_10023221 | |||
| 279 | Ga0316585_10028779 | |||
| 280 | Ga0316580_10007997 | |||
| 281 | Ga0316580_10043387 | |||
| 282 | Ga0316593_10000203 | |||
| 283 | Ga0316593_10001053 | |||
| 284 | Ga0316593_10001685 | |||
| 285 | Ga0316593_10002212 | |||
| 286 | Ga0316593_10010255 | |||
| 287 | Ga0316593_10010261 | |||
| 288 | Ga0316593_10012864 | |||
| 289 | Ga0316593_10012870 | |||
| 290 | Ga0316593_10012880 | |||
| 291 | Ga0316593_10039440 | |||
| 292 | Ga0316593_10040654 | |||
| 293 | Ga0316592_1000113 | |||
| 294 | Ga0316596_1000732 | |||
| 295 | Ga0316596_1001838 | |||
| 296 | Ga0316596_1002120 | |||
| 297 | Ga0316596_1002436 | |||
| 298 | Ga0316596_1003667 | |||
| 299 | Ga0316596_1005543 | |||
| 300 | Ga0316596_1006144 | |||
| 301 | Ga0373954_0003317 | |||
| 302 | Ga0373957_0035284 | |||
| 303 | Ga0373955_0003519 | |||
| 304 | Ga0316574_0000089 | |||
| 305 | Ga0316574_0001230 | |||
| 306 | Ga0316574_0001678 | |||
| 307 | Ga0316574_0028657 | |||
| 308 | Ga0316574_0033708 | |||
| 309 | Ga0316574_0226083 | |||
| 310 | Ga0373933_0005888 | |||
| 311 | Ga0373937_0118040 | |||
| 312 | Ga0373937_0131297 | |||
| 313 | Ga0316582_0008146 | |||
| 314 | Ga0316582_0026396 | |||
| 315 | Ga0316582_0058841 | |||
| 316 | Ga0316582_0096136 | |||
| 317 | Ga0316582_0102699 | |||
| 318 | Ga0316582_0111878 | |||
| 319 | Ga0316582_0115563 | |||
| 320 | Ga0316582_0119989 | |||
| 321 | Ga0316582_0172089 | |||
| 322 | Ga0316584_0003202 | |||
| 323 | Ga0316584_0003995 | |||
| 324 | Ga0316584_0004852 | |||
| 325 | Ga0316584_0068657 | |||
| 326 | Ga0316584_0092555 | |||
| 327 | Ga0316584_0096496 | |||
| 328 | Ga0316584_0108538 | |||
| 329 | Ga0316584_0125314 | |||
| 330 | Ga0316584_0238027 | |||
| 331 | Ga0316584_0287186 | |||
| 332 | Ga0316584_0307858 | |||
| 333 | Ga0395899_0010808 | |||
| 334 | Ga0395900_0032974 | |||
| 335 | Ga0395898_0242980 | |||
| 336 | Ga0395905_0002859 | |||
| 337 | Ga0316581_0042748 | |||
| 338 | Ga0395901_0078999 | |||
| 339 | Ga0400485_04359 | |||
| 340 | Ga0400488_08901 | |||
| 341 | Ga0400486_10871 | |||
| 342 | Ga0400486_14516 | |||
| 343 | Ga0400486_17332 | |||
| 344 | Ga0400483_042104 | |||
| 345 | Ga0400483_224181 | |||
| 346 | Ga0400489_14965 | |||
| 347 | Ga0400489_28023 | |||
| 348 | Ga0400489_28607 | |||
| 349 | Ga0400487_07267 | |||
| 350 | Ga0400487_17700 | |||
| 351 | Ga0400487_53183 | |||
| 352 | Ga0451793_0633042 | |||
| 353 | Ga0451797_0451767 | |||
| 354 | Ga0451577_0000672 | |||
| 355 | Ga0451577_0024695 | |||
| 356 | Ga0451577_0053380 | |||
| 357 | Ga0451577_0140390 | |||
| 358 | Ga0453683_0008247 | |||
| 359 | Ga0453684_0001684 | |||
| 360 | Ga0453684_0001751 | |||
| 361 | Ga0453684_0002522 | |||
| 362 | Ga0453684_0004364 | |||
| 363 | Ga0453684_0005864 | |||
| 364 | Ga0453684_0013188 | |||
| 365 | Ga0453684_0019870 | |||
| 366 | Ga0453684_0026506 | |||
| 367 | Ga0453684_0029196 | |||
| 368 | Ga0453684_0030265 | |||
| 369 | Ga0453684_0031476 | |||
| 370 | Ga0453684_0052777 | |||
| 371 | Ga0453684_0078272 | |||
| 372 | Ga0453684_0178394 | |||
| 373 | Ga0451576_0001800 | |||
| 374 | Ga0495592_0033487 | |||
| 375 | Ga0495629_0002236 | |||
| 376 | Ga0495653_0028308 | |||
| 377 | Ga0495652_0020178 | |||
| 378 | Ga0495640_0032745 | |||
| 379 | Ga0495622_0010738 | |||
| 380 | Ga0495667_0024143 | |||
| 381 | Ga0495635_0000615 | |||
| 382 | Ga0495657_0027792 | |||
| 383 | Ga0495657_0047870 | |||
| 384 | Ga0495599_0001256 | |||
| 385 | Ga0495646_0020009 | |||
| 386 | Ga0495624_0128131 | |||
| 387 | Ga0495600_0032813 | |||
| 388 | Ga0495604_0004846 | |||
| 389 | Ga0495675_0087892 | |||
| 390 | Ga0495684_0008393 | |||
| 391 | Ga0495593_0000594 | |||
| 392 | Ga0495602_0197875 | |||
| 393 | Ga0496104_0142172 | |||
| 394 | Ga0496105_0296036 | |||
| 395 | Ga0496113_0063398 | |||
| 396 | Ga0496125_0073016 | |||
| 397 | Ga0495595_0053574 | |||
| 398 | Ga0495619_0000854 | |||
| 399 | Ga0500650_0003284 | |||
| 400 | Ga0500573_0032650 | |||
| 401 | Ga0500573_0111385 | |||
| 402 | Ga0500590_000057 | |||
| 403 | 2643986519 | |||
| 404 | 2643995048 | |||
| 405 | 2644152750 | |||
| 406 | 2644198494 | |||
| 407 | 2808630300 | |||
| 408 | 2812324229 | |||
| 409 | 2821270909 | |||
| 410 | 2833711897 | |||
| 411 | 2857374870 | |||
| 412 | 2857722459 | |||
| 413 | 2870623822 | |||
| 414 | 2924734083 | |||
| 415 | 2928092621 | |||
| 416 | 2939658308 | |||
| 417 | 2984583842 | |||
| 418 | 2995727857 | |||
| 419 | 3004272317 | |||
| 420 | 8002811834 | |||
| 421 | 8055036160 | |||
| 422 | 8055038337 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6rko-assembly1.cif.gz_B | cryo-em structure of the e. coli cytochrome bd-i oxidase at 2.68 a resolution | 0.9387 | 7 | 367 |
| 7ose-assembly1.cif.gz_B | cytochrome bd-ii type oxidase with bound aurachin d | 0.9377 | 7 | 367 |
| 6rko-assembly1.cif.gz_B | cryo-em structure of the e. coli cytochrome bd-i oxidase at 2.68 a resolution | 0.9214 | 7 | 367 |
| 7ose-assembly1.cif.gz_B | cytochrome bd-ii type oxidase with bound aurachin d | 0.9203 | 7 | 367 |
| 8b4o-assembly1.cif.gz_B | cryo-em structure of cytochrome bd oxidase from c. glutamicum | 0.7627 | 11 | 355 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D8PJW1_4_96_1.20.58.400 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;t-snare proteins | 0.688 | 175 | 292 | 1.20.58.400 |
| af_A0A1D8PJW1_4_96_1.20.58.400 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;t-snare proteins | 0.6515 | 175 | 292 | 1.20.58.400 |
| af_Q9SEL6_1_98_1.20.58.400 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;t-snare proteins | 0.6081 | 175 | 291 | 1.20.58.400 |
| af_Q9LVP9_1_97_1.20.58.400 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;t-snare proteins | 0.5945 | 175 | 291 | 1.20.58.400 |
| af_Q9SEL6_1_98_1.20.58.400 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;t-snare proteins | 0.5276 | 175 | 291 | 1.20.58.400 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7H4K2I8-F1-model_v4 | deleted | 0.9782 | 82 | 192 |
|
| AF-A0A524H1H5-F1-model_v4 | Cytochrome d ubiquinol oxidase subunit II | 0.9712 | 7 | 223 |
GO:0005886
GO:0009055 GO:0016682 GO:0019646 GO:0046872 GO:0070069 |
| AF-A0A3D0U6S0-F1-model_v4 | Cytochrome d ubiquinol oxidase subunit II | 0.9706 | 7 | 224 |
GO:0005886
GO:0009055 GO:0016682 GO:0019646 GO:0046872 GO:0070069 |
| AF-J9FMT0-F1-model_v4 | Cytochrome bd ubiquinol oxidase, subunit II (EC 1.10.3.-) | 0.9704 | 91 | 224 |
GO:0005886
GO:0009055 GO:0016682 GO:0019646 GO:0046872 GO:0070069 |
| AF-A0A376KWS0-F1-model_v4 | Cytochrome bd-II oxidase subunit 2 (EC 1.10.3.-) | 0.9704 | 49 | 188 |
GO:0005886
GO:0009055 GO:0016682 GO:0019646 GO:0070069 |