F321827

General Info

Members Datasets Scaffolds Average Seq Length
211 112 422 341

Family's Representative Sequence

Representative Sequence 3300036647|Ga0316582_0007304|Ga0316582_0007304_2474_3640
Length 388
Sequence MPKKAQWRTQVQPPGQLWKGQQLKGVSIRDRSNCGLPKNNVTLEDKMALQSTWFFVWGLLWAVFFITDGFDLGIGTLYPFLGKSENDKRVMINAMGPLWDGNQVWLLTAGGVTFAAFPTLYAVMFSSLXXALMLILFALIIRGVAFEFRKKMTSTGGRRLWDLCIFLGSFLPALLFGVAFANIFRGLPIDADGIFRGTLLTLLNPYGLLGGVLFVLLFLIHGAIWLSIKSDGALHDRAVTTGKLLWPVLLIVAVIFLVNSAVSTNLYANYLAHPLLFVIILVTVAALLGIRVYLARRAYFKAWFSSALTIIGATFYGIIGLYPNMFPSTIDPAYSLTAFNASSSPLTLKIMLVVALIFVPIVLLYQAWAYNLFKSKITLKELTYEEYY

Samples

Sample ID Description Type Environment
1 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
2 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
3 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
4 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
5 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
6 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
7 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
8 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
9 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
10 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
11 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
12 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
13 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
14 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
15 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
16 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
17 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
18 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
20 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
22 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
23 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
24 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
25 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
26 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
27 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
28 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
29 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
30 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
31 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
32 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
33 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
34 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
35 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
36 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
37 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
38 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
39 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
40 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
41 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
42 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
43 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
44 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
45 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
46 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
47 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
48 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
49 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
50 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
51 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
52 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
53 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
54 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
55 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
56 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
57 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
58 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
59 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
60 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
61 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
62 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
63 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
64 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
65 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
66 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
67 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
68 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
69 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
70 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
71 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
72 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
73 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
74 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
75 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
76 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
77 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
78 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
79 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
80 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
81 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
82 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
83 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
84 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
85 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
86 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
87 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
88 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
89 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
90 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
91 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
92 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
93 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
94 2643221597 Microbacterium sp. Root180 Isolate Unclassified
95 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
96 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
97 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
98 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
99 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
100 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
101 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
102 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
103 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
104 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
105 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
106 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
107 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
108 2995726249 Leucobacter zeae CC-MF41 Isolate Rhizosphere
109 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
110 8002811521 Leucobacter chinensis NC76-1 Isolate Rhizosphere
111 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere
112 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.52
Metatranscriptomes 9
Isolates 9.48

Biome Distribution

Category Percentage (%)
Aerial Root 0.47
Bulb 0
Endosphere 4.27
Nodule 1.42
Rhizoplane 2.37
Rhizosphere 80.57
Stem 0
Stem Tuber 0
Unclassified 1.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316582_0007304 3300036647 Bacteria 5876
2 Ga0055526_1003515 3300003771 Bacteria 9907
3 Ga0055524_1000069 3300003775 Bacteria 128956
4 Ga0070687_100215774 3300005343 Bacteria 1172
5 Ga0070669_100170771 3300005353 Bacteria 1695
6 Ga0070701_10202672 3300005438 Bacteria 1174
7 Ga0068854_100266921 3300005578 Bacteria 1372
8 Ga0075365_10059938 3300006038 Bacteria 2538
9 Ga0209564_1000052 3300025295 Bacteria 356578
10 Ga0209256_1000172 3300025299 Bacteria 129025
11 Ga0207643_10117339 3300025908 Bacteria 1573
12 Ga0207671_10127477 3300025914 Unclassified 1951
13 Ga0207662_10117701 3300025918 Bacteria 1663
14 Ga0207690_10305308 3300025932 Bacteria 1246
15 Ga0207706_10136519 3300025933 Bacteria 2157
16 Ga0207689_10180212 3300025942 Bacteria 1742
17 Ga0207661_10177765 3300025944 Bacteria 1857
18 Ga0207708_10152542 3300026075 Bacteria 1820
19 Ga0207676_10137353 3300026095 Bacteria 2088
20 Ga0207683_10270597 3300026121 Bacteria 1552
21 Ga0207698_10182597 3300026142 Bacteria 1860
22 Ga0265334_10022135 3300028573 Bacteria 2593
23 Ga0265332_10019246 3300031238 Bacteria 3013
24 Ga0265332_10061543 3300031238 Bacteria 1605
25 Ga0265340_10001433 3300031247 Bacteria 13676
26 Ga0265339_10071107 3300031249 Bacteria 1854
27 Ga0265331_10060434 3300031250 Bacteria 1790
28 Ga0265316_10171058 3300031344 Bacteria 1621
29 Ga0316575_10000527 3300031665 Bacteria 11198
30 Ga0316579_10005621 3300031691 Bacteria 5073
31 Ga0316579_10011648 3300031691 Bacteria 3742
32 Ga0316579_10013992 3300031691 Bacteria 3460
33 Ga0316579_10077837 3300031691 Bacteria 1576
34 Ga0265314_10045213 3300031711 Bacteria 3115
35 Ga0316576_10001402 3300031727 Bacteria 12898
36 Ga0316576_10001405 3300031727 Bacteria 12892
37 Ga0316576_10004677 3300031727 Bacteria 8252
38 Ga0316576_10014600 3300031727 Bacteria 5249
39 Ga0316576_10028440 3300031727 Bacteria 3940
40 Ga0316576_10050913 3300031727 Bacteria 3013
41 Ga0316576_10135817 3300031727 Bacteria 1851
42 Ga0316576_10141659 3300031727 Bacteria 1810
43 Ga0316576_10165415 3300031727 Bacteria 1669
44 Ga0316576_10166217 3300031727 Bacteria 1665
45 Ga0316576_10240633 3300031727 Bacteria 1360
46 Ga0316576_10347960 3300031727 Bacteria 1103
47 Ga0316578_10000222 3300031728 Bacteria 16537
48 Ga0316578_10000517 3300031728 Bacteria 13122
49 Ga0316578_10008302 3300031728 Bacteria 5276
50 Ga0316578_10026711 3300031728 Bacteria 3258
51 Ga0316578_10047802 3300031728 Bacteria 2497
52 Ga0316578_10111728 3300031728 Bacteria 1641
53 Ga0316577_10002019 3300031733 Bacteria 9891
54 Ga0316577_10060990 3300031733 Bacteria 2105
55 Ga0316577_10090740 3300031733 Bacteria 1710
56 Ga0316577_10127879 3300031733 Bacteria 1429
57 Ga0316577_10142820 3300031733 Bacteria 1348
58 Ga0307415_100019643 3300032126 Bacteria 4108
59 Ga0316583_10001784 3300032133 Bacteria 7314
60 Ga0316583_10002276 3300032133 Bacteria 6613
61 Ga0316583_10003488 3300032133 Bacteria 5540
62 Ga0316583_10005714 3300032133 Bacteria 4473
63 Ga0316583_10011926 3300032133 Bacteria 3137
64 Ga0316583_10018947 3300032133 Bacteria 2472
65 Ga0316585_10001106 3300032137 Bacteria 7031
66 Ga0316585_10001146 3300032137 Bacteria 6899
67 Ga0316585_10023221 3300032137 Bacteria 1912
68 Ga0316585_10028779 3300032137 Bacteria 1738
69 Ga0316580_10007997 3300032139 Bacteria 3161
70 Ga0316580_10043387 3300032139 Bacteria 1387
71 Ga0316593_10000203 3300032168 Bacteria 9289
72 Ga0316593_10001053 3300032168 Bacteria 5758
73 Ga0316593_10001685 3300032168 Bacteria 4977
74 Ga0316593_10002212 3300032168 Bacteria 4553
75 Ga0316593_10010255 3300032168 Bacteria 2680
76 Ga0316593_10010261 3300032168 Bacteria 2679
77 Ga0316593_10012864 3300032168 Bacteria 2464
78 Ga0316593_10012870 3300032168 Unclassified 2463
79 Ga0316593_10012880 3300032168 Bacteria 2463
80 Ga0316593_10039440 3300032168 Bacteria 1567
81 Ga0316593_10040654 3300032168 Bacteria 1546
82 Ga0316592_1000113 3300033524 Bacteria 8486
83 Ga0316596_1000732 3300033541 Bacteria 5996
84 Ga0316596_1001838 3300033541 Bacteria 4419
85 Ga0316596_1002120 3300033541 Bacteria 4190
86 Ga0316596_1002436 3300033541 Bacteria 3970
87 Ga0316596_1003667 3300033541 Bacteria 3387
88 Ga0316596_1005543 3300033541 Bacteria 2888
89 Ga0316596_1006144 3300033541 Bacteria 2781
90 Ga0373954_0003317 3300035118 Bacteria 6807
91 Ga0373957_0035284 3300035120 Bacteria 1857
92 Ga0373955_0003519 3300035172 Bacteria 6890
93 Ga0316574_0000089 3300035398 Bacteria 26124
94 Ga0316574_0001230 3300035398 Bacteria 11918
95 Ga0316574_0001678 3300035398 Bacteria 10682
96 Ga0316574_0028657 3300035398 Bacteria 3359
97 Ga0316574_0033708 3300035398 Bacteria 3117
98 Ga0316574_0226083 3300035398 Bacteria 1198
99 Ga0373933_0005888 3300035724 Bacteria 6669
100 Ga0373937_0118040 3300036401 Bacteria 2471
101 Ga0373937_0131297 3300036401 Bacteria 2339
102 Ga0316582_0008146 3300036647 Bacteria 5617
103 Ga0316582_0026396 3300036647 Bacteria 3497
104 Ga0316582_0058841 3300036647 Bacteria 2458
105 Ga0316582_0096136 3300036647 Bacteria 1956
106 Ga0316582_0102699 3300036647 Bacteria 1895
107 Ga0316582_0111878 3300036647 Bacteria 1818
108 Ga0316582_0115563 3300036647 Bacteria 1790
109 Ga0316582_0119989 3300036647 Bacteria 1759
110 Ga0316582_0172089 3300036647 Bacteria 1471
111 Ga0316584_0003202 3300036712 Bacteria 10596
112 Ga0316584_0003995 3300036712 Bacteria 9703
113 Ga0316584_0004852 3300036712 Bacteria 8949
114 Ga0316584_0068657 3300036712 Bacteria 2657
115 Ga0316584_0092555 3300036712 Bacteria 2263
116 Ga0316584_0096496 3300036712 Bacteria 2213
117 Ga0316584_0108538 3300036712 Bacteria 2076
118 Ga0316584_0125314 3300036712 Bacteria 1919
119 Ga0316584_0238027 3300036712 Bacteria 1333
120 Ga0316584_0287186 3300036712 Bacteria 1194
121 Ga0316584_0307858 3300036712 Unclassified 1146
122 Ga0395899_0010808 3300037312 Bacteria 6998
123 Ga0395900_0032974 3300037418 Bacteria 5330
124 Ga0395898_0242980 3300037466 Bacteria 1717
125 Ga0395905_0002859 3300037471 Bacteria 18881
126 Ga0316581_0042748 3300037588 Bacteria 1383
127 Ga0395901_0078999 3300038443 Bacteria 3435
128 Ga0400485_04359 3300038735 Bacteria 24094
129 Ga0400488_08901 3300038741 Bacteria 1610
130 Ga0400486_10871 3300038742 Bacteria 15212
131 Ga0400486_14516 3300038742 Bacteria 3208
132 Ga0400486_17332 3300038742 Bacteria 21351
133 Ga0400483_042104 3300039062 Bacteria 5488
134 Ga0400483_224181 3300039062 Bacteria 2831
135 Ga0400489_14965 3300039093 Bacteria 21216
136 Ga0400489_28023 3300039093 Bacteria 8665
137 Ga0400489_28607 3300039093 Bacteria 42332
138 Ga0400487_07267 3300039110 Unclassified 3422
139 Ga0400487_17700 3300039110 Bacteria 22800
140 Ga0400487_53183 3300039110 Bacteria 6165
141 Ga0451793_0633042 3300041452 Bacteria 1778
142 Ga0451797_0451767 3300041453 Bacteria 2337
143 Ga0451577_0000672 3300042876 Bacteria 53809
144 Ga0451577_0024695 3300042876 Bacteria 5464
145 Ga0451577_0053380 3300042876 Bacteria 3608
146 Ga0451577_0140390 3300042876 Bacteria 2171
147 Ga0453683_0008247 3300044673 Bacteria 7005
148 Ga0453684_0001684 3300044712 Bacteria 59748
149 Ga0453684_0001751 3300044712 Bacteria 58062
150 Ga0453684_0002522 3300044712 Bacteria 44120
151 Ga0453684_0004364 3300044712 Bacteria 30005
152 Ga0453684_0005864 3300044712 Bacteria 23869
153 Ga0453684_0013188 3300044712 Bacteria 13473
154 Ga0453684_0019870 3300044712 Bacteria 10190
155 Ga0453684_0026506 3300044712 Bacteria 8364
156 Ga0453684_0029196 3300044712 Bacteria 7842
157 Ga0453684_0030265 3300044712 Bacteria 7654
158 Ga0453684_0031476 3300044712 Bacteria 7454
159 Ga0453684_0052777 3300044712 Bacteria 5312
160 Ga0453684_0078272 3300044712 Bacteria 4138
161 Ga0453684_0178394 3300044712 Bacteria 2496
162 Ga0451576_0001800 3300045051 Bacteria 35046
163 Ga0495592_0033487 3300046454 Bacteria 3875
164 Ga0495629_0002236 3300046459 Bacteria 14921
165 Ga0495653_0028308 3300046463 Bacteria 4480
166 Ga0495652_0020178 3300046529 Bacteria 5923
167 Ga0495640_0032745 3300046533 Bacteria 3699
168 Ga0495622_0010738 3300046557 Bacteria 4226
169 Ga0495667_0024143 3300046559 Bacteria 4094
170 Ga0495635_0000615 3300046663 Bacteria 22950
171 Ga0495657_0027792 3300046675 Bacteria 3988
172 Ga0495657_0047870 3300046675 Bacteria 2887
173 Ga0495599_0001256 3300046678 Bacteria 14392
174 Ga0495646_0020009 3300046680 Bacteria 4232
175 Ga0495624_0128131 3300046690 Bacteria 1557
176 Ga0495600_0032813 3300046809 Bacteria 3369
177 Ga0495604_0004846 3300047317 Bacteria 10658
178 Ga0495675_0087892 3300047444 Bacteria 1952
179 Ga0495684_0008393 3300047471 Bacteria 7999
180 Ga0495593_0000594 3300047673 Bacteria 20595
181 Ga0495602_0197875 3300048088 Bacteria 1535
182 Ga0496104_0142172 3300048907 Bacteria 2305
183 Ga0496105_0296036 3300048908 Bacteria 1302
184 Ga0496113_0063398 3300048916 Bacteria 2793
185 Ga0496125_0073016 3300048928 Bacteria 2670
186 Ga0495595_0053574 3300053084 Bacteria 1874
187 Ga0495619_0000854 3300053085 Bacteria 19986
188 Ga0500650_0003284 3300053098 Bacteria 5583
189 Ga0500573_0032650 3300053140 Bacteria 3003
190 Ga0500573_0111385 3300053140 Bacteria 1531
191 Ga0500590_000057 3300053148 Bacteria 27288
192 2643986519 2643221595 Bacteria 6565519
193 2643995048 2643221597 Bacteria 3347721
194 2644152750 2643221627 Bacteria 6761570
195 2644198494 2643221635 Bacteria 2632343
196 2808630300 2808606306 Bacteria 3608896
197 2812324229 2811994872 Bacteria 4121241
198 2821270909 2821268502 Bacteria 3750023
199 2833711897 2833709550 Bacteria 4008291
200 2857374870 2857367948 Bacteria 6965560
201 2857722459 2857720070 Bacteria 3189373
202 2870623822 2870622029 Bacteria 3643329
203 2924734083 2924733363 Bacteria 7574837
204 2928092621 2928090899 Bacteria 3158267
205 2939658308 2939657138 Bacteria 3740283
206 2984583842 2984580707 Bacteria 3351387
207 2995727857 2995726249 Bacteria 3470435
208 3004272317 3004268573 Bacteria 7043476
209 8002811834 8002811521 Bacteria 2942897
210 8055036160 8055034563 Bacteria 3562128
211 8055038337 8055037949 Bacteria 3337834
212 Ga0316582_0007304
213 Ga0055526_1003515
214 Ga0055524_1000069
215 Ga0070687_100215774
216 Ga0070669_100170771
217 Ga0070701_10202672
218 Ga0068854_100266921
219 Ga0075365_10059938
220 Ga0209564_1000052
221 Ga0209256_1000172
222 Ga0207643_10117339
223 Ga0207671_10127477
224 Ga0207662_10117701
225 Ga0207690_10305308
226 Ga0207706_10136519
227 Ga0207689_10180212
228 Ga0207661_10177765
229 Ga0207708_10152542
230 Ga0207676_10137353
231 Ga0207683_10270597
232 Ga0207698_10182597
233 Ga0265334_10022135
234 Ga0265332_10019246
235 Ga0265332_10061543
236 Ga0265340_10001433
237 Ga0265339_10071107
238 Ga0265331_10060434
239 Ga0265316_10171058
240 Ga0316575_10000527
241 Ga0316579_10005621
242 Ga0316579_10011648
243 Ga0316579_10013992
244 Ga0316579_10077837
245 Ga0265314_10045213
246 Ga0316576_10001402
247 Ga0316576_10001405
248 Ga0316576_10004677
249 Ga0316576_10014600
250 Ga0316576_10028440
251 Ga0316576_10050913
252 Ga0316576_10135817
253 Ga0316576_10141659
254 Ga0316576_10165415
255 Ga0316576_10166217
256 Ga0316576_10240633
257 Ga0316576_10347960
258 Ga0316578_10000222
259 Ga0316578_10000517
260 Ga0316578_10008302
261 Ga0316578_10026711
262 Ga0316578_10047802
263 Ga0316578_10111728
264 Ga0316577_10002019
265 Ga0316577_10060990
266 Ga0316577_10090740
267 Ga0316577_10127879
268 Ga0316577_10142820
269 Ga0307415_100019643
270 Ga0316583_10001784
271 Ga0316583_10002276
272 Ga0316583_10003488
273 Ga0316583_10005714
274 Ga0316583_10011926
275 Ga0316583_10018947
276 Ga0316585_10001106
277 Ga0316585_10001146
278 Ga0316585_10023221
279 Ga0316585_10028779
280 Ga0316580_10007997
281 Ga0316580_10043387
282 Ga0316593_10000203
283 Ga0316593_10001053
284 Ga0316593_10001685
285 Ga0316593_10002212
286 Ga0316593_10010255
287 Ga0316593_10010261
288 Ga0316593_10012864
289 Ga0316593_10012870
290 Ga0316593_10012880
291 Ga0316593_10039440
292 Ga0316593_10040654
293 Ga0316592_1000113
294 Ga0316596_1000732
295 Ga0316596_1001838
296 Ga0316596_1002120
297 Ga0316596_1002436
298 Ga0316596_1003667
299 Ga0316596_1005543
300 Ga0316596_1006144
301 Ga0373954_0003317
302 Ga0373957_0035284
303 Ga0373955_0003519
304 Ga0316574_0000089
305 Ga0316574_0001230
306 Ga0316574_0001678
307 Ga0316574_0028657
308 Ga0316574_0033708
309 Ga0316574_0226083
310 Ga0373933_0005888
311 Ga0373937_0118040
312 Ga0373937_0131297
313 Ga0316582_0008146
314 Ga0316582_0026396
315 Ga0316582_0058841
316 Ga0316582_0096136
317 Ga0316582_0102699
318 Ga0316582_0111878
319 Ga0316582_0115563
320 Ga0316582_0119989
321 Ga0316582_0172089
322 Ga0316584_0003202
323 Ga0316584_0003995
324 Ga0316584_0004852
325 Ga0316584_0068657
326 Ga0316584_0092555
327 Ga0316584_0096496
328 Ga0316584_0108538
329 Ga0316584_0125314
330 Ga0316584_0238027
331 Ga0316584_0287186
332 Ga0316584_0307858
333 Ga0395899_0010808
334 Ga0395900_0032974
335 Ga0395898_0242980
336 Ga0395905_0002859
337 Ga0316581_0042748
338 Ga0395901_0078999
339 Ga0400485_04359
340 Ga0400488_08901
341 Ga0400486_10871
342 Ga0400486_14516
343 Ga0400486_17332
344 Ga0400483_042104
345 Ga0400483_224181
346 Ga0400489_14965
347 Ga0400489_28023
348 Ga0400489_28607
349 Ga0400487_07267
350 Ga0400487_17700
351 Ga0400487_53183
352 Ga0451793_0633042
353 Ga0451797_0451767
354 Ga0451577_0000672
355 Ga0451577_0024695
356 Ga0451577_0053380
357 Ga0451577_0140390
358 Ga0453683_0008247
359 Ga0453684_0001684
360 Ga0453684_0001751
361 Ga0453684_0002522
362 Ga0453684_0004364
363 Ga0453684_0005864
364 Ga0453684_0013188
365 Ga0453684_0019870
366 Ga0453684_0026506
367 Ga0453684_0029196
368 Ga0453684_0030265
369 Ga0453684_0031476
370 Ga0453684_0052777
371 Ga0453684_0078272
372 Ga0453684_0178394
373 Ga0451576_0001800
374 Ga0495592_0033487
375 Ga0495629_0002236
376 Ga0495653_0028308
377 Ga0495652_0020178
378 Ga0495640_0032745
379 Ga0495622_0010738
380 Ga0495667_0024143
381 Ga0495635_0000615
382 Ga0495657_0027792
383 Ga0495657_0047870
384 Ga0495599_0001256
385 Ga0495646_0020009
386 Ga0495624_0128131
387 Ga0495600_0032813
388 Ga0495604_0004846
389 Ga0495675_0087892
390 Ga0495684_0008393
391 Ga0495593_0000594
392 Ga0495602_0197875
393 Ga0496104_0142172
394 Ga0496105_0296036
395 Ga0496113_0063398
396 Ga0496125_0073016
397 Ga0495595_0053574
398 Ga0495619_0000854
399 Ga0500650_0003284
400 Ga0500573_0032650
401 Ga0500573_0111385
402 Ga0500590_000057
403 2643986519
404 2643995048
405 2644152750
406 2644198494
407 2808630300
408 2812324229
409 2821270909
410 2833711897
411 2857374870
412 2857722459
413 2870623822
414 2924734083
415 2928092621
416 2939658308
417 2984583842
418 2995727857
419 3004272317
420 8002811834
421 8055036160
422 8055038337

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02322

Cyt_bd_oxida_II

Cytochrome bd terminal oxidase subunit II

49

373

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6rko-assembly1.cif.gz_B cryo-em structure of the e. coli cytochrome bd-i oxidase at 2.68 a resolution 0.9387 7 367
7ose-assembly1.cif.gz_B cytochrome bd-ii type oxidase with bound aurachin d 0.9377 7 367
6rko-assembly1.cif.gz_B cryo-em structure of the e. coli cytochrome bd-i oxidase at 2.68 a resolution 0.9214 7 367
7ose-assembly1.cif.gz_B cytochrome bd-ii type oxidase with bound aurachin d 0.9203 7 367
8b4o-assembly1.cif.gz_B cryo-em structure of cytochrome bd oxidase from c. glutamicum 0.7627 11 355
ID Description Score Start End Superfamily
af_A0A1D8PJW1_4_96_1.20.58.400 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;t-snare proteins 0.688 175 292 1.20.58.400
af_A0A1D8PJW1_4_96_1.20.58.400 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;t-snare proteins 0.6515 175 292 1.20.58.400
af_Q9SEL6_1_98_1.20.58.400 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;t-snare proteins 0.6081 175 291 1.20.58.400
af_Q9LVP9_1_97_1.20.58.400 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;t-snare proteins 0.5945 175 291 1.20.58.400
af_Q9SEL6_1_98_1.20.58.400 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;t-snare proteins 0.5276 175 291 1.20.58.400
ID Description Score Start End GO Terms
AF-A0A7H4K2I8-F1-model_v4 deleted 0.9782 82 192
AF-A0A524H1H5-F1-model_v4 Cytochrome d ubiquinol oxidase subunit II 0.9712 7 223 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0046872
GO:0070069
AF-A0A3D0U6S0-F1-model_v4 Cytochrome d ubiquinol oxidase subunit II 0.9706 7 224 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0046872
GO:0070069
AF-J9FMT0-F1-model_v4 Cytochrome bd ubiquinol oxidase, subunit II (EC 1.10.3.-) 0.9704 91 224 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0046872
GO:0070069
AF-A0A376KWS0-F1-model_v4 Cytochrome bd-II oxidase subunit 2 (EC 1.10.3.-) 0.9704 49 188 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0070069

Map