F321781

General Info

Members Datasets Scaffolds Average Seq Length
211 149 192 196

Family's Representative Sequence

Representative Sequence 3300031901|Ga0307406_10151019|Ga0307406_101510192
Length 233
Sequence MAIELNLRTANLKSSVKGINLILKNDRLVYICVVKVLIMTKAEKTRQFIIEQSSPLFNTKGVAGTSISDIMEATKMAKGGLYGHFETKEELSHAVVDYNMKKVGEKLMAAINKETTAKGKLQAALNFFSNPLRSPIEGGCPLLNFGMEADDTNPVIRKKVKAGIEQTQHIFQEIIEQGIASGEFKDNSNAREMSIKMFAMIEGATMVCRVAGHSTQMKIILDILQKDLDAMSK

Samples

Sample ID Description Type Environment
1 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
2 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
3 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
4 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
5 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
6 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
7 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
8 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
9 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
10 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
11 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
12 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
13 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
14 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
15 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
16 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
17 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
18 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
19 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
20 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
21 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
22 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
23 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
24 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
25 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
26 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
27 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
28 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
29 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
30 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
55 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
56 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
57 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
60 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
75 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
76 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
77 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
78 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
79 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
80 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
81 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
82 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
83 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
84 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
85 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
86 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
87 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
88 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
89 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
90 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
91 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
92 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
93 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
94 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
95 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
96 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
97 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
98 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
99 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
100 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
101 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
102 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
103 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
104 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
105 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
106 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
107 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
108 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
109 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
110 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
111 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
112 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
113 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
114 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
115 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
116 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
117 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
118 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
119 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
120 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
121 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
122 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
123 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
124 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
125 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
126 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
127 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
129 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
130 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
131 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
132 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
133 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
134 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
135 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
136 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
137 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
138 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
139 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
140 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
141 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
142 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
143 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
144 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
145 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
146 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
147 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
148 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
149 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91
Metatranscriptomes 0.47
Isolates 8.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.64
Nodule 0
Rhizoplane 0.95
Rhizosphere 68.25
Stem 0
Stem Tuber 0
Unclassified 15.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1005292 3300001904 Bacteria 2181
2 JGI24740J21852_10059970 3300001979 Bacteria 1053
3 JGI24735J21928_10004992 3300002067 Bacteria 4420
4 JGI25162J39368_1004702 3300002737 Bacteria 3040
5 JGI25165J46597_1009744 3300003214 Bacteria 1430
6 rootH1_10004262 3300003316 Unclassified 4654
7 rootH1_10011283 3300003316 Bacteria 4874
8 rootH2_10004606 3300003320 Bacteria 102673
9 rootH2_10021724 3300003320 Bacteria 1753
10 rootL2_10010279 3300003322 Bacteria 1424
11 rootL2_10012284 3300003322 Bacteria 7923
12 rootL2_10042918 3300003322 Bacteria 2080
13 rootL2_10060051 3300003322 Bacteria 3395
14 rootL2_10134307 3300003322 Unclassified 2320
15 rootL2_10164923 3300003322 Bacteria 3128
16 rootL2_10174136 3300003322 Bacteria 3253
17 rootL2_10206348 3300003322 Bacteria 2706
18 rootL2_10292058 3300003322 Bacteria 3716
19 rootH1_10003192 3300003323 Bacteria 7429
20 rootH1_10063751 3300003323 Bacteria 4684
21 rootH1_10139599 3300003323 Unclassified 1280
22 rootH1_10297423 3300003323 Bacteria 1182
23 Ga0055535_1002452 3300003761 Bacteria 6468
24 Ga0055542_1015362 3300003762 Unclassified 1232
25 Ga0055531_10000036 3300003794 Bacteria 147042
26 Ga0055531_10000225 3300003794 Bacteria 62492
27 Ga0070659_100001172 3300005366 Bacteria 19121
28 Ga0070667_100342497 3300005367 Bacteria 1352
29 Ga0068853_100145061 3300005539 Bacteria 2133
30 Ga0068853_100375364 3300005539 Bacteria 1327
31 Ga0070665_100000041 3300005548 Bacteria 297849
32 Ga0068857_100060637 3300005577 Bacteria 3360
33 Ga0068859_100010988 3300005617 Bacteria 9111
34 Ga0068870_10074833 3300005840 Bacteria 1856
35 Ga0068860_100000034 3300005843 Bacteria 243128
36 Ga0068860_100000491 3300005843 Bacteria 48922
37 Ga0068862_100399196 3300005844 Unclassified 1286
38 Ga0097620_100010990 3300006931 Bacteria 9111
39 Ga0105240_10000008 3300009093 Bacteria 618862
40 Ga0105240_10000998 3300009093 Bacteria 50528
41 Ga0105240_10001686 3300009093 Bacteria 37429
42 Ga0105240_10552788 3300009093 Bacteria 1273
43 Ga0105241_10017894 3300009174 Bacteria 5211
44 Ga0105242_10751250 3300009176 Bacteria 960
45 Ga0105237_10301136 3300009545 Unclassified 1606
46 Ga0105238_10015542 3300009551 Bacteria 7706
47 Ga0105239_10047135 3300010375 Bacteria 4723
48 Ga0105239_10677384 3300010375 Unclassified 1179
49 Ga0105239_10995644 3300010375 Bacteria 964
50 Ga0157373_10014855 3300013100 Bacteria 5703
51 Ga0157371_10000363 3300013102 Bacteria 57446
52 Ga0157371_10479479 3300013102 Bacteria 917
53 Ga0157370_10037788 3300013104 Bacteria 4676
54 Ga0163162_10001715 3300013306 Bacteria 20533
55 Ga0157372_10001149 3300013307 Bacteria 28728
56 Ga0157372_10144212 3300013307 Unclassified 2746
57 Ga0157372_10394222 3300013307 Bacteria 1613
58 Ga0157375_10016634 3300013308 Bacteria 6614
59 Ga0163163_10129692 3300014325 Unclassified 2561
60 Ga0182006_1000001 3300015261 Bacteria 1091090
61 Ga0207427_100090 3300025231 Bacteria 133759
62 Ga0209437_100034 3300025233 Bacteria 494007
63 Ga0209258_100036 3300025242 Bacteria 428859
64 Ga0209148_1000139 3300025254 Bacteria 167011
65 Ga0209233_1000038 3300025261 Bacteria 548972
66 Ga0209564_1042842 3300025295 Bacteria 1195
67 Ga0209257_1000008 3300025304 Bacteria 1294570
68 Ga0207647_10000082 3300025904 Bacteria 71437
69 Ga0207643_10083171 3300025908 Bacteria 1857
70 Ga0207654_10023024 3300025911 Bacteria 3332
71 Ga0207654_10803631 3300025911 Bacteria 679
72 Ga0207695_10000021 3300025913 Bacteria 679399
73 Ga0207695_10001344 3300025913 Bacteria 41706
74 Ga0207695_10009077 3300025913 Bacteria 12349
75 Ga0207695_10432428 3300025913 Bacteria 1200
76 Ga0207671_10013534 3300025914 Bacteria 6497
77 Ga0207671_10391503 3300025914 Bacteria 1105
78 Ga0207694_10119136 3300025924 Unclassified 2106
79 Ga0207690_10015841 3300025932 Bacteria 4576
80 Ga0207641_10079187 3300026088 Bacteria 2848
81 Ga0207674_10076297 3300026116 Bacteria 3360
82 Ga0207698_10590837 3300026142 Unclassified 1093
83 Ga0268266_10000014 3300028379 Bacteria 644033
84 Ga0268264_10000327 3300028381 Bacteria 75326
85 Ga0307517_10008094 3300028786 Bacteria 15147
86 Ga0307515_10000001 3300028794 Bacteria 4259510
87 Ga0307511_10000304 3300030521 Bacteria 52160
88 Ga0265327_10000055 3300031251 Bacteria 247188
89 Ga0265327_10010559 3300031251 Bacteria 6471
90 Ga0307513_10460279 3300031456 Bacteria 995
91 Ga0307408_100000572 3300031548 Bacteria 31757
92 Ga0307408_100024349 3300031548 Bacteria 4133
93 Ga0307413_10096262 3300031824 Bacteria 1943
94 Ga0307410_10001059 3300031852 Bacteria 11970
95 Ga0307406_10000003 3300031901 Bacteria 251998
96 Ga0307406_10151019 3300031901 Unclassified 1657
97 Ga0307412_10000027 3300031911 Bacteria 214663
98 Ga0307412_10000209 3300031911 Bacteria 39820
99 Ga0307412_10005314 3300031911 Bacteria 7229
100 Ga0307412_10012189 3300031911 Bacteria 5000
101 Ga0307412_10017154 3300031911 Bacteria 4330
102 Ga0307412_10182235 3300031911 Bacteria 1581
103 Ga0307416_100000006 3300032002 Bacteria 466074
104 Ga0307414_10000001 3300032004 Bacteria 1352954
105 Ga0307414_10024147 3300032004 Bacteria 3871
106 Ga0307414_10059718 3300032004 Bacteria 2694
107 Ga0307414_10071141 3300032004 Bacteria 2508
108 Ga0307414_10107819 3300032004 Bacteria 2111
109 Ga0307414_10976884 3300032004 Bacteria 779
110 Ga0307510_10000905 3300033180 Bacteria 31345
111 Ga0395901_0279683 3300038443 Bacteria 1734
112 Ga0439465_0000197 3300041413 Bacteria 15843
113 Ga0439465_0017766 3300041413 Bacteria 2222
114 Ga0451789_0811400 3300041443 Bacteria 633
115 Ga0451853_2316429 3300041512 Bacteria 831
116 Ga0439445_0000039 3300042004 Bacteria 17900
117 Ga0439445_0000934 3300042004 Bacteria 6205
118 Ga0450905_005961 3300042142 Bacteria 1640
119 Ga0466972_0057307 3300044658 Unclassified 1871
120 Ga0466970_0185674 3300044765 Bacteria 1154
121 Ga0466959_0002393 3300045049 Bacteria 11965
122 Ga0466958_0078297 3300045836 Bacteria 2031
123 Ga0495627_000022 3300046453 Bacteria 254672
124 Ga0495627_027544 3300046453 Bacteria 1822
125 Ga0495590_0006342 3300046457 Bacteria 4624
126 Ga0495638_0066114 3300046460 Bacteria 2223
127 Ga0495638_0070365 3300046460 Bacteria 2142
128 Ga0495585_0082040 3300046492 Bacteria 1746
129 Ga0495606_0003669 3300046507 Bacteria 16084
130 Ga0495610_0000005 3300046512 Bacteria 924111
131 Ga0495631_0003663 3300046518 Bacteria 8390
132 Ga0495632_0001483 3300046519 Bacteria 19470
133 Ga0495643_0009481 3300046522 Bacteria 6048
134 Ga0495643_0087237 3300046522 Bacteria 1615
135 Ga0495644_0032078 3300046523 Bacteria 1985
136 Ga0495648_0011846 3300046524 Bacteria 6541
137 Ga0495663_0005854 3300046525 Bacteria 3404
138 Ga0495654_0000003 3300046530 Bacteria 863485
139 Ga0495633_0004041 3300046558 Bacteria 9490
140 Ga0495668_0000720 3300046616 Bacteria 39763
141 Ga0495668_0001044 3300046616 Bacteria 29358
142 Ga0495625_0000040 3300046660 Bacteria 207320
143 Ga0495625_0295850 3300046660 Bacteria 1037
144 Ga0495661_0001366 3300046665 Bacteria 20602
145 Ga0495588_0439784 3300046674 Bacteria 684
146 Ga0495670_0187586 3300046691 Bacteria 1093
147 Ga0495649_0315892 3300046694 Unclassified 793
148 Ga0495660_0060650 3300046810 Bacteria 2031
149 Ga0495672_0058422 3300047320 Bacteria 2236
150 Ga0495672_0168576 3300047320 Bacteria 1119
151 Ga0495683_0085637 3300047323 Bacteria 1532
152 Ga0495687_000144 3300047443 Bacteria 108217
153 Ga0495685_028626 3300047447 Bacteria 1916
154 Ga0495686_0000069 3300047472 Bacteria 217778
155 Ga0495686_0000118 3300047472 Bacteria 165897
156 Ga0495686_0000271 3300047472 Bacteria 92137
157 Ga0495686_0001760 3300047472 Bacteria 22201
158 Ga0495686_0003358 3300047472 Bacteria 13948
159 Ga0496101_0523392 3300048904 Bacteria 937
160 Ga0496117_0109459 3300048920 Bacteria 1725
161 Ga0496122_0003792 3300048925 Bacteria 19471
162 Ga0496126_0022098 3300048929 Bacteria 6196
163 Ga0496126_0032144 3300048929 Bacteria 4948
164 Ga0501319_006998 3300049535 Unclassified 845
165 Ga0501238_000733 3300049671 Bacteria 3676
166 Ga0501241_000013 3300049758 Bacteria 104728
167 Ga0501241_000066 3300049758 Bacteria 25673
168 Ga0501241_000127 3300049758 Bacteria 16544
169 Ga0501241_000366 3300049758 Bacteria 9933
170 Ga0501266_024943 3300049763 Bacteria 832
171 Ga0501269_004319 3300049766 Bacteria 1708
172 Ga0501280_002424 3300049776 Bacteria 3113
173 Ga0500644_0000332 3300053088 Bacteria 24138
174 Ga0500581_200283 3300053089 Unclassified 887
175 Ga0500583_0109410 3300053092 Bacteria 1360
176 Ga0500641_0152169 3300053096 Bacteria 998
177 Ga0500556_0002414 3300053104 Bacteria 6011
178 Ga0500569_000231 3300053109 Bacteria 8896
179 Ga0500658_0001473 3300053134 Bacteria 9403
180 Ga0500559_0016333 3300053136 Unclassified 3133
181 Ga0500577_0001383 3300053142 Bacteria 6199
182 Ga0500588_0041366 3300053146 Unclassified 1390
183 Ga0500590_110769 3300053148 Unclassified 1303
184 Ga0500616_0001214 3300053153 Bacteria 26021
185 Ga0500616_0037243 3300053153 Bacteria 2634
186 Ga0500622_0000090 3300053156 Bacteria 96270
187 Ga0500622_0000305 3300053156 Bacteria 50294
188 Ga0500622_0003237 3300053156 Bacteria 11063
189 Ga0500633_0130037 3300053160 Bacteria 939
190 Ga0500634_0004315 3300053161 Bacteria 6550
191 Ga0500645_051949 3300053730 Bacteria 1195
192 Ga0466962_0037290 3300061719 Bacteria 2327

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049766 Ga0501269_004319 Ga0501269_004319_75_662 161
2 3300041443 Ga0451789_0811400 Ga0451789_0811400_93_584 162
3 3300003323 rootH1_10297423 rootH1_102974231 167
4 3300042142 Ga0450905_005961 Ga0450905_005961_1056_1589 170
5 3300046522 Ga0495643_0087237 Ga0495643_0087237_839_1417 176
6 3300003323 rootH1_10003192 rootH1_100031927 180
7 3300003322 rootL2_10134307 rootL2_101343072 181
8 3300053153 Ga0500616_0001214 Ga0500616_0001214_23710_24297 182
9 3300010375 Ga0105239_10047135 Ga0105239_100471355 183
10 3300049535 Ga0501319_006998 Ga0501319_006998_226_813 183
11 3300046616 Ga0495668_0000720 Ga0495668_0000720_25648_26235 184
12 3300047472 Ga0495686_0000118 Ga0495686_0000118_61581_62159 184
13 3300053104 Ga0500556_0002414 Ga0500556_0002414_4312_4899 184
14 3300031251 Ga0265327_10010559 Ga0265327_100105597 187
15 iso_pu_bacteria 2857613821 2857614690 188
16 iso_pu_bacteria 2904419702 2904419977 188
17 iso_pu_bacteria 2929239360 2929244159 189
18 iso_pu_bacteria 2585428060 2587746467 190
19 iso_pu_bacteria 2588253712 2588447330 190
20 iso_pu_bacteria 2588254257 2590609972 190
21 iso_pu_bacteria 2728369107 2729201033 190
22 iso_pu_bacteria 2739367874 2740060203 190
23 iso_pu_bacteria 2842083920 2842087153 190
24 iso_pu_bacteria 2905999023 2905999218 190
25 iso_pu_bacteria 2993372514 2993375291 190
26 iso_pu_bacteria 2993480792 2993482159 190
27 iso_pu_bacteria 2585428187 2588230798 191
28 iso_pu_bacteria 2775506739 2775674526 191
29 iso_pu_bacteria 2852623160 2852624980 191
30 iso_pu_bacteria 2884933994 2884935994 191
31 iso_pu_bacteria 2919097161 2919098142 191
32 iso_pu_bacteria 2945924605 2945924974 191
33 3300003316 rootH1_10011283 rootH1_100112833 192
34 3300003322 rootL2_10060051 rootL2_100600514 192
35 3300005539 Ga0068853_100145061 Ga0068853_1001450613 192
36 3300005539 Ga0068853_100375364 Ga0068853_1003753643 192
37 3300005548 Ga0070665_100000041 Ga0070665_100000041108 192
38 3300005843 Ga0068860_100000491 Ga0068860_10000049132 192
39 3300005844 Ga0068862_100399196 Ga0068862_1003991962 192
40 3300009093 Ga0105240_10000998 Ga0105240_100009985 192
41 3300009093 Ga0105240_10552788 Ga0105240_105527882 192
42 3300009174 Ga0105241_10017894 Ga0105241_100178945 192
43 3300009545 Ga0105237_10301136 Ga0105237_103011362 192
44 3300009551 Ga0105238_10015542 Ga0105238_100155425 192
45 3300010375 Ga0105239_10677384 Ga0105239_106773842 192
46 3300013306 Ga0163162_10001715 Ga0163162_100017152 192
47 3300013307 Ga0157372_10144212 Ga0157372_101442123 192
48 3300025911 Ga0207654_10023024 Ga0207654_100230242 192
49 3300025913 Ga0207695_10001344 Ga0207695_100013445 192
50 3300025913 Ga0207695_10432428 Ga0207695_104324282 192
51 3300025914 Ga0207671_10013534 Ga0207671_100135342 192
52 3300025924 Ga0207694_10119136 Ga0207694_101191362 192
53 3300026142 Ga0207698_10590837 Ga0207698_105908372 192
54 3300028379 Ga0268266_10000014 Ga0268266_1000001487 192
55 3300028381 Ga0268264_10000327 Ga0268264_1000032751 192
56 3300031548 Ga0307408_100024349 Ga0307408_1000243494 192
57 3300031824 Ga0307413_10096262 Ga0307413_100962622 192
58 3300031852 Ga0307410_10001059 Ga0307410_100010599 192
59 3300031901 Ga0307406_10000003 Ga0307406_10000003124 192
60 3300031911 Ga0307412_10012189 Ga0307412_100121894 192
61 3300031911 Ga0307412_10017154 Ga0307412_100171543 192
62 3300032004 Ga0307414_10000001 Ga0307414_10000001931 192
63 3300032004 Ga0307414_10024147 Ga0307414_100241475 192
64 3300042004 Ga0439445_0000039 Ga0439445_0000039_12234_12812 192
65 3300044658 Ga0466972_0057307 Ga0466972_0057307_642_1319 192
66 3300044765 Ga0466970_0185674 Ga0466970_0185674_159_737 192
67 3300045049 Ga0466959_0002393 Ga0466959_0002393_8412_8990 192
68 3300045836 Ga0466958_0078297 Ga0466958_0078297_835_1413 192
69 3300046460 Ga0495638_0066114 Ga0495638_0066114_1481_2059 192
70 3300046524 Ga0495648_0011846 Ga0495648_0011846_1764_2345 192
71 3300047443 Ga0495687_000144 Ga0495687_000144_82854_83435 192
72 3300049671 Ga0501238_000733 Ga0501238_000733_2754_3350 192
73 3300049758 Ga0501241_000013 Ga0501241_000013_7581_8159 192
74 3300049763 Ga0501266_024943 Ga0501266_024943_51_647 192
75 3300049776 Ga0501280_002424 Ga0501280_002424_2001_2597 192
76 3300053156 Ga0500622_0003237 Ga0500622_0003237_4062_4643 192
77 3300061719 Ga0466962_0037290 Ga0466962_0037290_939_1517 192
78 3300003316 rootH1_10004262 rootH1_100042627 193
79 3300003322 rootL2_10010279 rootL2_100102792 193
80 3300003322 rootL2_10012284 rootL2_100122841 193
81 3300003322 rootL2_10042918 rootL2_100429183 193
82 3300003322 rootL2_10206348 rootL2_102063484 193
83 3300003323 rootH1_10063751 rootH1_100637512 193
84 3300003761 Ga0055535_1002452 Ga0055535_10024526 193
85 3300003762 Ga0055542_1015362 Ga0055542_10153622 193
86 3300003794 Ga0055531_10000036 Ga0055531_1000003684 193
87 3300005367 Ga0070667_100342497 Ga0070667_1003424972 193
88 3300010375 Ga0105239_10995644 Ga0105239_109956442 193
89 3300013102 Ga0157371_10479479 Ga0157371_104794792 193
90 3300025242 Ga0209258_100036 Ga0209258_100036264 193
91 3300025254 Ga0209148_1000139 Ga0209148_100013933 193
92 3300025304 Ga0209257_1000008 Ga0209257_100000849 193
93 3300031251 Ga0265327_10000055 Ga0265327_1000005535 193
94 3300031548 Ga0307408_100000572 Ga0307408_10000057217 193
95 3300047320 Ga0495672_0058422 Ga0495672_0058422_20_607 193
96 3300047472 Ga0495686_0000271 Ga0495686_0000271_1225_1812 193
97 3300048929 Ga0496126_0022098 Ga0496126_0022098_3944_4528 193
98 3300049758 Ga0501241_000127 Ga0501241_000127_2804_3388 193
99 3300053088 Ga0500644_0000332 Ga0500644_0000332_23223_23807 193
100 3300053089 Ga0500581_200283 Ga0500581_200283_96_692 193
101 3300053092 Ga0500583_0109410 Ga0500583_0109410_101_685 193
102 3300053096 Ga0500641_0152169 Ga0500641_0152169_75_662 193
103 3300053109 Ga0500569_000231 Ga0500569_000231_6748_7332 193
104 3300053134 Ga0500658_0001473 Ga0500658_0001473_2103_2687 193
105 3300053136 Ga0500559_0016333 Ga0500559_0016333_1287_1871 193
106 3300053142 Ga0500577_0001383 Ga0500577_0001383_1957_2541 193
107 3300053148 Ga0500590_110769 Ga0500590_110769_79_663 193
108 3300053153 Ga0500616_0037243 Ga0500616_0037243_1892_2476 193
109 3300053156 Ga0500622_0000305 Ga0500622_0000305_2599_3183 193
110 3300053160 Ga0500633_0130037 Ga0500633_0130037_278_862 193
111 3300053161 Ga0500634_0004315 Ga0500634_0004315_1809_2393 193
112 3300003322 rootL2_10174136 rootL2_101741362 194
113 3300013308 Ga0157375_10016634 Ga0157375_100166343 194
114 3300015261 Ga0182006_1000001 Ga0182006_1000001620 194
115 3300025295 Ga0209564_1042842 Ga0209564_10428421 194
116 3300031911 Ga0307412_10000027 Ga0307412_10000027160 194
117 3300031911 Ga0307412_10000209 Ga0307412_1000020931 194
118 3300031911 Ga0307412_10005314 Ga0307412_100053143 194
119 3300032002 Ga0307416_100000006 Ga0307416_100000006330 194
120 3300032004 Ga0307414_10059718 Ga0307414_100597182 194
121 3300032004 Ga0307414_10071141 Ga0307414_100711412 194
122 3300032004 Ga0307414_10107819 Ga0307414_101078191 194
123 3300032004 Ga0307414_10976884 Ga0307414_109768842 194
124 3300041413 Ga0439465_0000197 Ga0439465_0000197_9173_9781 194
125 3300042004 Ga0439445_0000934 Ga0439445_0000934_1940_2548 194
126 3300046453 Ga0495627_000022 Ga0495627_000022_9158_9763 194
127 3300046453 Ga0495627_027544 Ga0495627_027544_817_1425 194
128 3300046460 Ga0495638_0070365 Ga0495638_0070365_872_1480 194
129 3300046507 Ga0495606_0003669 Ga0495606_0003669_4650_5255 194
130 3300046512 Ga0495610_0000005 Ga0495610_0000005_451556_452161 194
131 3300046519 Ga0495632_0001483 Ga0495632_0001483_9563_10171 194
132 3300046522 Ga0495643_0009481 Ga0495643_0009481_3203_3811 194
133 3300046525 Ga0495663_0005854 Ga0495663_0005854_2517_3128 194
134 3300046530 Ga0495654_0000003 Ga0495654_0000003_504928_505533 194
135 3300046558 Ga0495633_0004041 Ga0495633_0004041_3092_3700 194
136 3300046660 Ga0495625_0000040 Ga0495625_0000040_107785_108393 194
137 3300046810 Ga0495660_0060650 Ga0495660_0060650_422_1030 194
138 3300047472 Ga0495686_0000069 Ga0495686_0000069_205053_205661 194
139 3300047472 Ga0495686_0003358 Ga0495686_0003358_4371_4976 194
140 3300048920 Ga0496117_0109459 Ga0496117_0109459_641_1246 194
141 3300048925 Ga0496122_0003792 Ga0496122_0003792_8480_9085 194
142 3300049758 Ga0501241_000066 Ga0501241_000066_16038_16643 194
143 3300001904 JGI24736J21556_1005292 JGI24736J21556_10052923 195
144 3300001979 JGI24740J21852_10059970 JGI24740J21852_100599701 195
145 3300002067 JGI24735J21928_10004992 JGI24735J21928_100049922 195
146 3300002737 JGI25162J39368_1004702 JGI25162J39368_10047024 195
147 3300003214 JGI25165J46597_1009744 JGI25165J46597_10097442 195
148 3300003320 rootH2_10004606 rootH2_1000460685 195
149 3300003320 rootH2_10021724 rootH2_100217243 195
150 3300003322 rootL2_10164923 rootL2_101649231 195
151 3300003322 rootL2_10292058 rootL2_102920584 195
152 3300003323 rootH1_10139599 rootH1_101395992 195
153 3300003794 Ga0055531_10000225 Ga0055531_100002253 195
154 3300005366 Ga0070659_100001172 Ga0070659_10000117216 195
155 3300005577 Ga0068857_100060637 Ga0068857_1000606372 195
156 3300005617 Ga0068859_100010988 Ga0068859_1000109888 195
157 3300005840 Ga0068870_10074833 Ga0068870_100748334 195
158 3300005843 Ga0068860_100000034 Ga0068860_10000003493 195
159 3300006931 Ga0097620_100010990 Ga0097620_1000109908 195
160 3300009093 Ga0105240_10000008 Ga0105240_10000008268 195
161 3300009093 Ga0105240_10001686 Ga0105240_100016866 195
162 3300009176 Ga0105242_10751250 Ga0105242_107512501 195
163 3300013100 Ga0157373_10014855 Ga0157373_100148552 195
164 3300013102 Ga0157371_10000363 Ga0157371_1000036314 195
165 3300013104 Ga0157370_10037788 Ga0157370_100377882 195
166 3300013307 Ga0157372_10001149 Ga0157372_1000114922 195
167 3300013307 Ga0157372_10394222 Ga0157372_103942222 195
168 3300014325 Ga0163163_10129692 Ga0163163_101296922 195
169 3300025231 Ga0207427_100090 Ga0207427_1000903 195
170 3300025233 Ga0209437_100034 Ga0209437_100034212 195
171 3300025261 Ga0209233_1000038 Ga0209233_1000038212 195
172 3300025304 Ga0209257_1000008 Ga0209257_1000008594 195
173 3300025904 Ga0207647_10000082 Ga0207647_1000008212 195
174 3300025908 Ga0207643_10083171 Ga0207643_100831713 195
175 3300025911 Ga0207654_10803631 Ga0207654_108036311 195
176 3300025913 Ga0207695_10000021 Ga0207695_10000021132 195
177 3300025913 Ga0207695_10009077 Ga0207695_100090773 195
178 3300025914 Ga0207671_10391503 Ga0207671_103915032 195
179 3300025932 Ga0207690_10015841 Ga0207690_100158414 195
180 3300026088 Ga0207641_10079187 Ga0207641_100791873 195
181 3300026116 Ga0207674_10076297 Ga0207674_100762972 195
182 3300028786 Ga0307517_10008094 Ga0307517_100080948 195
183 3300028794 Ga0307515_10000001 Ga0307515_100000011463 195
184 3300030521 Ga0307511_10000304 Ga0307511_100003042 195
185 3300031456 Ga0307513_10460279 Ga0307513_104602792 195
186 3300031901 Ga0307406_10151019 Ga0307406_101510192 195
187 3300031911 Ga0307412_10182235 Ga0307412_101822352 195
188 3300033180 Ga0307510_10000905 Ga0307510_1000090518 195
189 3300038443 Ga0395901_0279683 Ga0395901_0279683_992_1579 195
190 3300041413 Ga0439465_0017766 Ga0439465_0017766_880_1479 195
191 3300041512 Ga0451853_2316429 Ga0451853_2316429_40_627 195
192 3300046457 Ga0495590_0006342 Ga0495590_0006342_3433_4026 195
193 3300046492 Ga0495585_0082040 Ga0495585_0082040_185_772 195
194 3300046518 Ga0495631_0003663 Ga0495631_0003663_590_1177 195
195 3300046523 Ga0495644_0032078 Ga0495644_0032078_772_1359 195
196 3300046616 Ga0495668_0001044 Ga0495668_0001044_2986_3582 195
197 3300046660 Ga0495625_0295850 Ga0495625_0295850_111_707 195
198 3300046665 Ga0495661_0001366 Ga0495661_0001366_10651_11238 195
199 3300046674 Ga0495588_0439784 Ga0495588_0439784_38_625 195
200 3300046691 Ga0495670_0187586 Ga0495670_0187586_19_606 195
201 3300046694 Ga0495649_0315892 Ga0495649_0315892_140_727 195
202 3300047320 Ga0495672_0168576 Ga0495672_0168576_24_632 195
203 3300047323 Ga0495683_0085637 Ga0495683_0085637_107_694 195
204 3300047447 Ga0495685_028626 Ga0495685_028626_654_1241 195
205 3300047472 Ga0495686_0001760 Ga0495686_0001760_19925_20512 195
206 3300048904 Ga0496101_0523392 Ga0496101_0523392_74_667 195
207 3300048929 Ga0496126_0032144 Ga0496126_0032144_449_1042 195
208 3300049758 Ga0501241_000366 Ga0501241_000366_6246_6839 195
209 3300053146 Ga0500588_0041366 Ga0500588_0041366_703_1299 195
210 3300053156 Ga0500622_0000090 Ga0500622_0000090_92525_93112 195
211 3300053730 Ga0500645_051949 Ga0500645_051949_526_1122 195

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

49

95

0.93

PF16925

TetR_C_13

Tetracyclin repressor-like, C-terminal domain

117

224

0.91

PF21993

TetR_C_13_2

Transcriptional regulator LmrA/YxaF-like, C-terminal domain

118

222

0.82

PF08360

TetR_C_5

QacR-like protein, C-terminal region

99

233

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qbm-assembly1.cif.gz_B crystal structure of a tetr transcriptional regulator (caur_2221) from chloroflexus aurantiacus j-10-fl at 1.80 a resolution 0.9488 1 194
3qbm-assembly1.cif.gz_B crystal structure of a tetr transcriptional regulator (caur_2221) from chloroflexus aurantiacus j-10-fl at 1.80 a resolution 0.9395 1 194
3eup-assembly1.cif.gz_B the crystal structure of the transcriptional regulator, tetr family from cytophaga hutchinsonii 0.9303 1 195
3eup-assembly1.cif.gz_B the crystal structure of the transcriptional regulator, tetr family from cytophaga hutchinsonii 0.9258 1 195
3knw-assembly1.cif.gz_B crystal structure of a putative transcriptional regulator (tetr/acrr family member) from putative transcriptional regulator (tetr/acrr family) 0.9134 8 188
ID Description Score Start End Superfamily
3qbmB00 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;Tetracycline Repressor, domain 2 0.9416 2 194 1.10.357.10
4x1eB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9352 10 56 1.10.10.60
3eupB00 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;Tetracycline Repressor, domain 2 0.9303 1 195 1.10.357.10
2eh3A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9265 7 53 1.10.10.60
3eupB00 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;Tetracycline Repressor, domain 2 0.9258 1 195 1.10.357.10
ID Description Score Start End GO Terms
AF-A0A419VUE3-F1-model_v4 TetR family transcriptional regulator 0.9819 1 191 GO:0003677
GO:0006355
AF-A0A2M8XVU2-F1-model_v4 TetR family transcriptional regulator 0.978 1 195 GO:0003677
GO:0006355
AF-A0A7Y9HZ28-F1-model_v4 AcrR family transcriptional regulator 0.977 1 195 GO:0003677
GO:0006355
AF-A0A1I0S954-F1-model_v4 DNA-binding transcriptional regulator, AcrR family 0.9766 1 195 GO:0003677
GO:0006355
AF-A0A6N7P1I5-F1-model_v4 TetR family transcriptional regulator 0.9762 4 195 GO:0003677
GO:0006355

Feature Viewer

pLDDT pTM Quality
90.68 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map