F321576

General Info

Members Datasets Scaffolds Average Seq Length
211 150 422 112

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_11388947|Ga0105248_113889472
Length 130
Sequence MSPSSPGPDDSAGQTSDNLAMANRFRTYADFWPFYLREHAKPSTRAVHYFGTIASALVLVWAIATQSWWWLLAVPLFGYGPAWFGHFFIEKNKPATFEAPFWSLISDYRMCGLFLTGRMGHELMKYQIRD

Samples

Sample ID Description Type Environment
1 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
2 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
16 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
30 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
31 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
32 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
54 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
56 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
58 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
80 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
82 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
83 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
84 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
85 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
86 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
87 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
88 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
89 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
90 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
91 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
92 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
93 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
94 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
95 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
96 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
97 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
98 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
99 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
100 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
101 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
102 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
103 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
104 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
105 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
106 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
107 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
108 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
109 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
110 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
111 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
112 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
113 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
114 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
115 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
123 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
124 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
125 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
126 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
127 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
129 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
130 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
131 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
132 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
133 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
134 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
135 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
136 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
137 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
138 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
139 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
140 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
141 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
142 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
143 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
144 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
145 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
146 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
147 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
148 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
149 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
150 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.1
Metatranscriptomes 0.95
Isolates 0.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.91
Nodule 0
Rhizoplane 1.9
Rhizosphere 73.46
Stem 0
Stem Tuber 0
Unclassified 6.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105248_11388947 3300009177 Bacteria 794
2 Ga0065165_1051101 3300005262 Bacteria 1174
3 Ga0070658_10180715 3300005327 Bacteria 1775
4 Ga0070666_10775850 3300005335 Unclassified 705
5 Ga0068868_100713942 3300005338 Bacteria 898
6 Ga0070692_10670710 3300005345 Bacteria 694
7 Ga0070671_100393090 3300005355 Bacteria 1186
8 Ga0070674_100808955 3300005356 Bacteria 810
9 Ga0070659_100028279 3300005366 Bacteria 4328
10 Ga0070659_100511343 3300005366 Bacteria 1025
11 Ga0070678_100020383 3300005456 Bacteria 4349
12 Ga0070678_100665491 3300005456 Bacteria 935
13 Ga0070681_10250817 3300005458 Bacteria 1683
14 Ga0070681_11273499 3300005458 Bacteria 658
15 Ga0070679_100066544 3300005530 Bacteria 3591
16 Ga0070679_100144943 3300005530 Bacteria 2353
17 Ga0070684_100213251 3300005535 Bacteria 1760
18 Ga0068853_100641936 3300005539 Bacteria 1010
19 Ga0070695_101034059 3300005545 Unclassified 669
20 Ga0070704_101641499 3300005549 Bacteria 593
21 Ga0068855_100067235 3300005563 Bacteria 4176
22 Ga0068855_100805627 3300005563 Bacteria 998
23 Ga0070664_100105934 3300005564 Bacteria 2449
24 Ga0068857_100050134 3300005577 Bacteria 3704
25 Ga0068854_100089572 3300005578 Bacteria 2287
26 Ga0068854_100390504 3300005578 Bacteria 1149
27 Ga0068856_100142444 3300005614 Bacteria 2404
28 Ga0068856_100504191 3300005614 Unclassified 1231
29 Ga0068852_100022129 3300005616 Bacteria 5092
30 Ga0068852_101123287 3300005616 Unclassified 806
31 Ga0068859_101105558 3300005617 Bacteria 872
32 Ga0068859_101234255 3300005617 Bacteria 823
33 Ga0068861_100703990 3300005719 Bacteria 939
34 Ga0068858_100000651 3300005842 Bacteria 36230
35 Ga0068860_100756015 3300005843 Unclassified 984
36 Ga0068862_100792107 3300005844 Bacteria 925
37 Ga0075365_10201040 3300006038 Bacteria 1396
38 Ga0075365_10493240 3300006038 Bacteria 865
39 Ga0075368_10302837 3300006042 Bacteria 690
40 Ga0075362_10040917 3300006177 Bacteria 2042
41 Ga0075366_10490466 3300006195 Bacteria 759
42 Ga0075370_10055174 3300006353 Bacteria 2257
43 Ga0075370_10059655 3300006353 Bacteria 2172
44 Ga0075370_10313519 3300006353 Bacteria 934
45 Ga0068871_101119197 3300006358 Bacteria 737
46 Ga0068871_101941567 3300006358 Bacteria 560
47 Ga0097620_101105703 3300006931 Bacteria 872
48 Ga0097620_101234394 3300006931 Bacteria 823
49 Ga0099794_10155501 3300007265 Bacteria 1162
50 Ga0099794_10557940 3300007265 Bacteria 605
51 Ga0105240_10094356 3300009093 Bacteria 3650
52 Ga0111539_10384215 3300009094 Bacteria 1635
53 Ga0105245_10005111 3300009098 Bacteria 11533
54 Ga0105245_10285174 3300009098 Bacteria 1616
55 Ga0105241_10137384 3300009174 Bacteria 1986
56 Ga0105242_10063587 3300009176 Bacteria 3039
57 Ga0105237_10020390 3300009545 Bacteria 6835
58 Ga0105238_10082874 3300009551 Bacteria 3197
59 Ga0105238_10092471 3300009551 Bacteria 3013
60 Ga0105238_10148158 3300009551 Bacteria 2323
61 Ga0105238_10413714 3300009551 Bacteria 1342
62 Ga0105249_13175528 3300009553 Bacteria 528
63 Ga0105035_119841 3300009988 Bacteria 637
64 Ga0105239_10005216 3300010375 Bacteria 15293
65 Ga0105239_10021951 3300010375 Bacteria 7036
66 Ga0105239_10719968 3300010375 Bacteria 1141
67 Ga0105239_11732636 3300010375 Bacteria 723
68 Ga0157373_10320411 3300013100 Bacteria 1103
69 Ga0157371_10264972 3300013102 Bacteria 1239
70 Ga0157370_10023993 3300013104 Bacteria 6047
71 Ga0157370_10180528 3300013104 Bacteria 1961
72 Ga0157370_10269466 3300013104 Bacteria 1573
73 Ga0157369_10007178 3300013105 Bacteria 12837
74 Ga0157369_10034599 3300013105 Bacteria 5542
75 Ga0157369_10358227 3300013105 Bacteria 1515
76 Ga0157374_10198305 3300013296 Bacteria 1965
77 Ga0157374_10394662 3300013296 Bacteria 1380
78 Ga0157378_10062535 3300013297 Bacteria 3324
79 Ga0157378_10314488 3300013297 Bacteria 1520
80 Ga0163162_10392156 3300013306 Bacteria 1521
81 Ga0182008_10380822 3300014497 Bacteria 754
82 Ga0206350_11253420 3300020080 Unclassified 1097
83 Ga0213872_10000944 3300021361 Bacteria 20385
84 Ga0209050_1056819 3300025298 Bacteria 950
85 Ga0209050_1097926 3300025298 Bacteria 586
86 Ga0207426_1012361 3300025302 Bacteria 3210
87 Ga0207656_10123822 3300025321 Bacteria 1206
88 Ga0207705_10219116 3300025909 Bacteria 1445
89 Ga0207705_10284220 3300025909 Bacteria 1267
90 Ga0207707_10056909 3300025912 Bacteria 3403
91 Ga0207707_10089894 3300025912 Bacteria 2684
92 Ga0207707_10151635 3300025912 Bacteria 2026
93 Ga0207707_10622687 3300025912 Bacteria 912
94 Ga0207671_10041651 3300025914 Bacteria 3399
95 Ga0207660_10226189 3300025917 Unclassified 1470
96 Ga0207652_10020441 3300025921 Bacteria 5451
97 Ga0207652_10167558 3300025921 Bacteria 1970
98 Ga0207652_10571037 3300025921 Bacteria 1016
99 Ga0207652_11775599 3300025921 Bacteria 522
100 Ga0207694_10010310 3300025924 Bacteria 7045
101 Ga0207694_10288400 3300025924 Bacteria 1349
102 Ga0207694_10580403 3300025924 Bacteria 942
103 Ga0207644_10688930 3300025931 Bacteria 852
104 Ga0207690_10100885 3300025932 Bacteria 2061
105 Ga0207690_10183260 3300025932 Bacteria 1578
106 Ga0207686_10142502 3300025934 Bacteria 1659
107 Ga0207679_10087586 3300025945 Bacteria 2398
108 Ga0207640_10543977 3300025981 Bacteria 974
109 Ga0207703_10001324 3300026035 Bacteria 22730
110 Ga0207639_11066836 3300026041 Bacteria 757
111 Ga0207702_10565644 3300026078 Unclassified 1113
112 Ga0207674_10031375 3300026116 Bacteria 5584
113 Ga0207675_100719186 3300026118 Bacteria 1008
114 Ga0207683_10083750 3300026121 Bacteria 2834
115 Ga0207698_10067137 3300026142 Bacteria 2827
116 Ga0207698_11190385 3300026142 Unclassified 776
117 Ga0268266_10580320 3300028379 Bacteria 1076
118 Ga0268264_10077093 3300028381 Unclassified 2838
119 Ga0265334_10011632 3300028573 Bacteria 3700
120 Ga0265762_1001406 3300030760 Bacteria 4365
121 Ga0265339_10564952 3300031249 Unclassified 523
122 Ga0307513_10275833 3300031456 Bacteria 1462
123 Ga0307508_10003747 3300031616 Bacteria 15194
124 Ga0265314_10005318 3300031711 Bacteria 11650
125 Ga0307407_10982000 3300031903 Bacteria 652
126 Ga0307409_101456854 3300031995 Bacteria 712
127 Ga0307416_102993757 3300032002 Bacteria 565
128 Ga0373931_0152771 3300035691 Bacteria 1347
129 Ga0373925_0995951 3300037068 Bacteria 690
130 Ga0436360_1285909 3300039438 Bacteria 1132
131 Ga0436361_0464788 3300039447 Bacteria 45703
132 Ga0436363_0255887 3300039450 Unclassified 731
133 Ga0451789_0438780 3300041443 Bacteria 730
134 Ga0466963_0020860 3300044694 Bacteria 4126
135 Ga0466964_0049208 3300044706 Bacteria 1725
136 Ga0466957_0244538 3300044842 Bacteria 1191
137 Ga0466958_0108111 3300045836 Bacteria 1735
138 Ga0466967_0030947 3300045976 Bacteria 4498
139 Ga0495638_0000561 3300046460 Bacteria 42325
140 Ga0495639_0366310 3300046475 Bacteria 725
141 Ga0495643_0116827 3300046522 Bacteria 1351
142 Ga0495663_0061415 3300046525 Bacteria 1182
143 Ga0495663_0290410 3300046525 Bacteria 587
144 Ga0495652_0423359 3300046529 Bacteria 938
145 Ga0495625_0125115 3300046660 Bacteria 1746
146 Ga0495670_0000005 3300046691 Bacteria 289725
147 Ga0495649_0102929 3300046694 Bacteria 1517
148 Ga0495686_0030303 3300047472 Bacteria 3514
149 Ga0495686_0071580 3300047472 Bacteria 2134
150 Ga0496101_0896140 3300048904 Bacteria 698
151 Ga0496107_0827499 3300048910 Bacteria 677
152 Ga0496115_0572951 3300048918 Bacteria 900
153 Ga0496118_0444123 3300048921 Bacteria 660
154 Ga0496121_0067715 3300048924 Bacteria 2892
155 Ga0496121_0112268 3300048924 Bacteria 2076
156 Ga0496123_0124844 3300048926 Bacteria 1439
157 Ga0496126_1182908 3300048929 Bacteria 563
158 Ga0501033_0364590 3300049570 Bacteria 1011
159 Ga0501034_0031491 3300049571 Bacteria 5386
160 Ga0501034_0264146 3300049571 Bacteria 1663
161 Ga0501034_0872764 3300049571 Bacteria 789
162 Ga0501037_0165366 3300049573 Bacteria 1575
163 Ga0501038_0120141 3300049574 Unclassified 2168
164 Ga0501043_0056781 3300049579 Bacteria 3075
165 Ga0501046_0079104 3300049580 Bacteria 2542
166 Ga0501047_0077810 3300049581 Bacteria 3190
167 Ga0501047_0272535 3300049581 Bacteria 1538
168 Ga0501047_1307358 3300049581 Unclassified 539
169 Ga0501070_0000025 3300049586 Bacteria 152175
170 Ga0501072_0587926 3300049588 Bacteria 878
171 Ga0501075_1042871 3300049591 Bacteria 621
172 Ga0501079_0475258 3300049741 Bacteria 982
173 Ga0501080_0000396 3300049742 Bacteria 33578
174 Ga0501080_0639364 3300049742 Bacteria 942
175 Ga0501080_1548334 3300049742 Bacteria 562
176 Ga0501035_0002955 3300049822 Bacteria 16347
177 Ga0501035_0538437 3300049822 Bacteria 958
178 Ga0501044_0001482 3300049823 Bacteria 27521
179 Ga0501044_0004262 3300049823 Bacteria 16046
180 nmdc:mga03683_41430_c1 3300050489 Bacteria 1891
181 nmdc:mga03n38_387273_c1 3300050490 Bacteria 767
182 nmdc:mga0yw44_181363_c1 3300050492 Bacteria 1386
183 nmdc:mga0yw44_494549_c1 3300050492 Bacteria 830
184 nmdc:mga0yw44_662638_c1 3300050492 Bacteria 709
185 nmdc:mga0k408_442801_c1 3300050493 Bacteria 772
186 nmdc:mga06z11_281193_c1 3300050494 Bacteria 986
187 nmdc:mga06z11_615396_c1 3300050494 Bacteria 661
188 nmdc:mga07m45_14322_c1 3300050496 Bacteria 4222
189 nmdc:mga07m45_271793_c1 3300050496 Bacteria 986
190 nmdc:mga0sz30_107323_c1 3300050516 Bacteria 1222
191 nmdc:mga0sz30_186694_c1 3300050516 Bacteria 578
192 Ga0500566_0000728 3300053094 Bacteria 18489
193 Ga0500641_0051024 3300053096 Bacteria 1701
194 Ga0500562_004464 3300053108 Bacteria 3537
195 Ga0500562_032598 3300053108 Bacteria 1375
196 Ga0500595_099836 3300053119 Bacteria 832
197 Ga0500658_0000669 3300053134 Bacteria 14134
198 Ga0500559_0011804 3300053136 Bacteria 3724
199 Ga0500559_0243515 3300053136 Bacteria 847
200 Ga0500568_0024203 3300053139 Bacteria 2574
201 Ga0500568_0044855 3300053139 Bacteria 1761
202 Ga0500577_0050537 3300053142 Bacteria 1559
203 Ga0500604_0091360 3300053151 Bacteria 995
204 Ga0500616_0017439 3300053153 Bacteria 4073
205 Ga0500616_0023476 3300053153 Bacteria 3435
206 Ga0500616_0056927 3300053153 Bacteria 2039
207 Ga0500620_146402 3300053155 Bacteria 824
208 Ga0500645_119371 3300053730 Bacteria 736
209 Ga0500552_000302 3300053733 Bacteria 4474
210 2929202415 2929199973 Bacteria 7260745
211 8055915816 8055909800 Bacteria 7278581
212 Ga0105248_11388947
213 Ga0065165_1051101
214 Ga0070658_10180715
215 Ga0070666_10775850
216 Ga0068868_100713942
217 Ga0070692_10670710
218 Ga0070671_100393090
219 Ga0070674_100808955
220 Ga0070659_100028279
221 Ga0070659_100511343
222 Ga0070678_100020383
223 Ga0070678_100665491
224 Ga0070681_10250817
225 Ga0070681_11273499
226 Ga0070679_100066544
227 Ga0070679_100144943
228 Ga0070684_100213251
229 Ga0068853_100641936
230 Ga0070695_101034059
231 Ga0070704_101641499
232 Ga0068855_100067235
233 Ga0068855_100805627
234 Ga0070664_100105934
235 Ga0068857_100050134
236 Ga0068854_100089572
237 Ga0068854_100390504
238 Ga0068856_100142444
239 Ga0068856_100504191
240 Ga0068852_100022129
241 Ga0068852_101123287
242 Ga0068859_101105558
243 Ga0068859_101234255
244 Ga0068861_100703990
245 Ga0068858_100000651
246 Ga0068860_100756015
247 Ga0068862_100792107
248 Ga0075365_10201040
249 Ga0075365_10493240
250 Ga0075368_10302837
251 Ga0075362_10040917
252 Ga0075366_10490466
253 Ga0075370_10055174
254 Ga0075370_10059655
255 Ga0075370_10313519
256 Ga0068871_101119197
257 Ga0068871_101941567
258 Ga0097620_101105703
259 Ga0097620_101234394
260 Ga0099794_10155501
261 Ga0099794_10557940
262 Ga0105240_10094356
263 Ga0111539_10384215
264 Ga0105245_10005111
265 Ga0105245_10285174
266 Ga0105241_10137384
267 Ga0105242_10063587
268 Ga0105237_10020390
269 Ga0105238_10082874
270 Ga0105238_10092471
271 Ga0105238_10148158
272 Ga0105238_10413714
273 Ga0105249_13175528
274 Ga0105035_119841
275 Ga0105239_10005216
276 Ga0105239_10021951
277 Ga0105239_10719968
278 Ga0105239_11732636
279 Ga0157373_10320411
280 Ga0157371_10264972
281 Ga0157370_10023993
282 Ga0157370_10180528
283 Ga0157370_10269466
284 Ga0157369_10007178
285 Ga0157369_10034599
286 Ga0157369_10358227
287 Ga0157374_10198305
288 Ga0157374_10394662
289 Ga0157378_10062535
290 Ga0157378_10314488
291 Ga0163162_10392156
292 Ga0182008_10380822
293 Ga0206350_11253420
294 Ga0213872_10000944
295 Ga0209050_1056819
296 Ga0209050_1097926
297 Ga0207426_1012361
298 Ga0207656_10123822
299 Ga0207705_10219116
300 Ga0207705_10284220
301 Ga0207707_10056909
302 Ga0207707_10089894
303 Ga0207707_10151635
304 Ga0207707_10622687
305 Ga0207671_10041651
306 Ga0207660_10226189
307 Ga0207652_10020441
308 Ga0207652_10167558
309 Ga0207652_10571037
310 Ga0207652_11775599
311 Ga0207694_10010310
312 Ga0207694_10288400
313 Ga0207694_10580403
314 Ga0207644_10688930
315 Ga0207690_10100885
316 Ga0207690_10183260
317 Ga0207686_10142502
318 Ga0207679_10087586
319 Ga0207640_10543977
320 Ga0207703_10001324
321 Ga0207639_11066836
322 Ga0207702_10565644
323 Ga0207674_10031375
324 Ga0207675_100719186
325 Ga0207683_10083750
326 Ga0207698_10067137
327 Ga0207698_11190385
328 Ga0268266_10580320
329 Ga0268264_10077093
330 Ga0265334_10011632
331 Ga0265762_1001406
332 Ga0265339_10564952
333 Ga0307513_10275833
334 Ga0307508_10003747
335 Ga0265314_10005318
336 Ga0307407_10982000
337 Ga0307409_101456854
338 Ga0307416_102993757
339 Ga0373931_0152771
340 Ga0373925_0995951
341 Ga0436360_1285909
342 Ga0436361_0464788
343 Ga0436363_0255887
344 Ga0451789_0438780
345 Ga0466963_0020860
346 Ga0466964_0049208
347 Ga0466957_0244538
348 Ga0466958_0108111
349 Ga0466967_0030947
350 Ga0495638_0000561
351 Ga0495639_0366310
352 Ga0495643_0116827
353 Ga0495663_0061415
354 Ga0495663_0290410
355 Ga0495652_0423359
356 Ga0495625_0125115
357 Ga0495670_0000005
358 Ga0495649_0102929
359 Ga0495686_0030303
360 Ga0495686_0071580
361 Ga0496101_0896140
362 Ga0496107_0827499
363 Ga0496115_0572951
364 Ga0496118_0444123
365 Ga0496121_0067715
366 Ga0496121_0112268
367 Ga0496123_0124844
368 Ga0496126_1182908
369 Ga0501033_0364590
370 Ga0501034_0031491
371 Ga0501034_0264146
372 Ga0501034_0872764
373 Ga0501037_0165366
374 Ga0501038_0120141
375 Ga0501043_0056781
376 Ga0501046_0079104
377 Ga0501047_0077810
378 Ga0501047_0272535
379 Ga0501047_1307358
380 Ga0501070_0000025
381 Ga0501072_0587926
382 Ga0501075_1042871
383 Ga0501079_0475258
384 Ga0501080_0000396
385 Ga0501080_0639364
386 Ga0501080_1548334
387 Ga0501035_0002955
388 Ga0501035_0538437
389 Ga0501044_0001482
390 Ga0501044_0004262
391 nmdc:mga03683_41430_c1
392 nmdc:mga03n38_387273_c1
393 nmdc:mga0yw44_181363_c1
394 nmdc:mga0yw44_494549_c1
395 nmdc:mga0yw44_662638_c1
396 nmdc:mga0k408_442801_c1
397 nmdc:mga06z11_281193_c1
398 nmdc:mga06z11_615396_c1
399 nmdc:mga07m45_14322_c1
400 nmdc:mga07m45_271793_c1
401 nmdc:mga0sz30_107323_c1
402 nmdc:mga0sz30_186694_c1
403 Ga0500566_0000728
404 Ga0500641_0051024
405 Ga0500562_004464
406 Ga0500562_032598
407 Ga0500595_099836
408 Ga0500658_0000669
409 Ga0500559_0011804
410 Ga0500559_0243515
411 Ga0500568_0024203
412 Ga0500568_0044855
413 Ga0500577_0050537
414 Ga0500604_0091360
415 Ga0500616_0017439
416 Ga0500616_0023476
417 Ga0500616_0056927
418 Ga0500620_146402
419 Ga0500645_119371
420 Ga0500552_000302
421 2929202415
422 8055915816

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06127

Mpo1-like

2-hydroxy-palmitic acid dioxygenase Mpo1-like

25

119

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lqk-assembly2.cif.gz_A structure of the vaccinia virus nf- b antagonist a46 0.2679 7 100
4lqk-assembly2.cif.gz_A structure of the vaccinia virus nf- b antagonist a46 0.2552 7 100
ID Description Score Start End Superfamily
2nlaA01 Mainly Alpha;Orthogonal Bundle;Apoptosis Regulator Bcl-x;Blc2-like 0.2541 10 101 1.10.437.10
af_M0RB44_648_833_1.10.287.1490 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.2428 6 100 1.10.287.1490
2nlaA01 Mainly Alpha;Orthogonal Bundle;Apoptosis Regulator Bcl-x;Blc2-like 0.2353 10 101 1.10.437.10
af_Q5JYT7_723_1052_1.20.58.60 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.2312 8 99 1.20.58.60
af_M0RB44_648_833_1.10.287.1490 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.2211 6 100 1.10.287.1490
ID Description Score Start End GO Terms
AF-A0A6M8VYM9-F1-model_v4 DUF962 domain-containing protein 0.8166 1 103 GO:0016020
AF-A0A1Y5RZ05-F1-model_v4 DUF962 domain-containing protein 0.8111 1 102 GO:0016020
AF-A0A6L8W4G9-F1-model_v4 DUF962 domain-containing protein 0.8093 1 103 GO:0016020
AF-A0A6M8VYM9-F1-model_v4 DUF962 domain-containing protein 0.8093 1 103 GO:0016020
AF-A0A6L8W4G9-F1-model_v4 DUF962 domain-containing protein 0.8017 1 103 GO:0016020

Map