F321286

General Info

Members Datasets Scaffolds Average Seq Length
211 121 211 74

Family's Representative Sequence

Representative Sequence 3300005366|Ga0070659_101147667|Ga0070659_1011476672
Length 82
Sequence MTGPIWTGPNLTGLCPDATQDAMRRLKLLLAAWLVFPAAGCVQVSAPDKPIEINLNINIRQEVVVRLQQDVKQLIDKNPGVF

Samples

Sample ID Description Type Environment
1 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
45 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
46 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
55 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
56 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
57 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
82 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
83 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
84 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
85 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
86 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
87 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
88 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
89 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
90 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
91 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
94 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
95 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
96 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
97 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
98 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
99 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
100 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
101 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
102 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
103 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
104 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
105 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
106 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
107 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
112 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
113 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
114 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
115 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
116 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
117 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
118 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
119 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
120 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
121 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.1
Metatranscriptomes 1.9
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.47
Nodule 0
Rhizoplane 0.47
Rhizosphere 92.89
Stem 0
Stem Tuber 0
Unclassified 6.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24034J26672_10111664 3300002239 Bacteria 523
2 Ga0065715_10860504 3300005293 Bacteria 588
3 Ga0065707_10449240 3300005295 Bacteria 802
4 Ga0070658_10000001 3300005327 Bacteria 856789
5 Ga0070658_10000927 3300005327 Bacteria 25076
6 Ga0070658_10008525 3300005327 Bacteria 8242
7 Ga0070658_10010412 3300005327 Bacteria 7456
8 Ga0070658_10080396 3300005327 Bacteria 2677
9 Ga0070658_11313890 3300005327 Bacteria 628
10 Ga0070670_100013439 3300005331 Bacteria 7011
11 Ga0070680_100006586 3300005336 Bacteria 8831
12 Ga0070660_100000184 3300005339 Bacteria 41526
13 Ga0070660_100008354 3300005339 Bacteria 7239
14 Ga0070660_100014525 3300005339 Bacteria 5676
15 Ga0070660_100021488 3300005339 Bacteria 4761
16 Ga0070660_100031061 3300005339 Bacteria 4010
17 Ga0070661_100000189 3300005344 Bacteria 51018
18 Ga0070661_100131522 3300005344 Bacteria 1880
19 Ga0070692_10008415 3300005345 Bacteria 4603
20 Ga0070692_10018436 3300005345 Bacteria 3357
21 Ga0070668_100000240 3300005347 Bacteria 36015
22 Ga0070668_101365197 3300005347 Unclassified 645
23 Ga0070669_100559511 3300005353 Unclassified 954
24 Ga0070671_100044108 3300005355 Bacteria 3705
25 Ga0070674_101556067 3300005356 Unclassified 595
26 Ga0070673_102122199 3300005364 Bacteria 534
27 Ga0070659_100001271 3300005366 Bacteria 18307
28 Ga0070659_100016435 3300005366 Bacteria 5557
29 Ga0070659_100653502 3300005366 Bacteria 907
30 Ga0070659_100828101 3300005366 Bacteria 806
31 Ga0070659_100989169 3300005366 Bacteria 738
32 Ga0070659_101147667 3300005366 Bacteria 686
33 Ga0070705_100790888 3300005440 Bacteria 754
34 Ga0070663_100005406 3300005455 Bacteria 7588
35 Ga0070681_10258021 3300005458 Bacteria 1655
36 Ga0070706_101576889 3300005467 Bacteria 599
37 Ga0070679_100000019 3300005530 Bacteria 127108
38 Ga0070679_100117216 3300005530 Bacteria 2648
39 Ga0070679_100318890 3300005530 Bacteria 1503
40 Ga0070684_100441893 3300005535 Bacteria 1202
41 Ga0070697_101467498 3300005536 Bacteria 609
42 Ga0068853_100442995 3300005539 Bacteria 1221
43 Ga0068853_100682442 3300005539 Bacteria 979
44 Ga0070672_100240614 3300005543 Bacteria 1522
45 Ga0070672_101534145 3300005543 Unclassified 597
46 Ga0070696_100506858 3300005546 Bacteria 961
47 Ga0070696_101758196 3300005546 Bacteria 535
48 Ga0070693_100452494 3300005547 Bacteria 901
49 Ga0070693_100649738 3300005547 Bacteria 767
50 Ga0070693_100699408 3300005547 Bacteria 742
51 Ga0070704_101764764 3300005549 Unclassified 572
52 Ga0068855_100000907 3300005563 Bacteria 36754
53 Ga0068855_100115314 3300005563 Bacteria 3080
54 Ga0068855_101782781 3300005563 Bacteria 626
55 Ga0068854_100073465 3300005578 Bacteria 2506
56 Ga0068852_102760587 3300005616 Bacteria 510
57 Ga0068859_100318952 3300005617 Bacteria 1648
58 Ga0068859_102747298 3300005617 Bacteria 541
59 Ga0068861_100166436 3300005719 Bacteria 1823
60 Ga0068858_102149767 3300005842 Unclassified 552
61 Ga0068860_100011188 3300005843 Bacteria 8843
62 Ga0068860_100062505 3300005843 Unclassified 3538
63 Ga0068860_101420368 3300005843 Bacteria 715
64 Ga0068862_100035124 3300005844 Bacteria 4243
65 Ga0068862_102449049 3300005844 Unclassified 534
66 Ga0081455_10058023 3300005937 Bacteria 3278
67 Ga0097620_100318939 3300006931 Bacteria 1648
68 Ga0097620_102747364 3300006931 Bacteria 541
69 Ga0105245_12469283 3300009098 Unclassified 573
70 Ga0105243_12128614 3300009148 Unclassified 597
71 Ga0105242_10085032 3300009176 Bacteria 2652
72 Ga0105248_12313984 3300009177 Bacteria 612
73 Ga0105238_11663781 3300009551 Bacteria 669
74 Ga0105249_10006062 3300009553 Bacteria 10476
75 Ga0105249_10212172 3300009553 Unclassified 1900
76 Ga0105249_10427126 3300009553 Unclassified 1360
77 Ga0105246_12602426 3300011119 Unclassified 500
78 Ga0157373_10828593 3300013100 Bacteria 683
79 Ga0157373_10866553 3300013100 Bacteria 669
80 Ga0157371_10000705 3300013102 Bacteria 39219
81 Ga0157371_10052051 3300013102 Bacteria 2909
82 Ga0157371_10188636 3300013102 Bacteria 1476
83 Ga0157370_10350840 3300013104 Bacteria 1360
84 Ga0157370_10939576 3300013104 Bacteria 784
85 Ga0157369_10002167 3300013105 Bacteria 23665
86 Ga0163162_12658591 3300013306 Unclassified 576
87 Ga0157372_10678129 3300013307 Bacteria 1200
88 Ga0157372_11919570 3300013307 Bacteria 681
89 Ga0157375_10980455 3300013308 Bacteria 986
90 Ga0206354_10296133 3300020081 Bacteria 2582
91 Ga0206353_10722480 3300020082 Bacteria 4942
92 Ga0206353_11736747 3300020082 Bacteria 919
93 Ga0213873_10000007 3300021358 Bacteria 309961
94 Ga0213874_10042390 3300021377 Bacteria 1367
95 Ga0213876_10000005 3300021384 Bacteria 727326
96 Ga0207647_10024944 3300025904 Bacteria 3937
97 Ga0207647_10227428 3300025904 Bacteria 1074
98 Ga0207647_10346260 3300025904 Bacteria 842
99 Ga0207705_10000002 3300025909 Bacteria 2046852
100 Ga0207705_10000050 3300025909 Bacteria 170078
101 Ga0207705_10001324 3300025909 Bacteria 19811
102 Ga0207705_10006958 3300025909 Bacteria 8355
103 Ga0207705_10018413 3300025909 Bacteria 4995
104 Ga0207705_10030441 3300025909 Bacteria 3851
105 Ga0207705_10117612 3300025909 Bacteria 1969
106 Ga0207707_10084967 3300025912 Bacteria 2765
107 Ga0207695_10038191 3300025913 Bacteria 5173
108 Ga0207695_10114741 3300025913 Bacteria 2668
109 Ga0207671_10001752 3300025914 Bacteria 24394
110 Ga0207660_10000211 3300025917 Bacteria 37354
111 Ga0207657_10000210 3300025919 Bacteria 60425
112 Ga0207657_10000301 3300025919 Bacteria 52361
113 Ga0207657_10002347 3300025919 Bacteria 20519
114 Ga0207657_10003599 3300025919 Bacteria 16510
115 Ga0207657_10007540 3300025919 Bacteria 11152
116 Ga0207657_10649208 3300025919 Bacteria 821
117 Ga0207649_10000055 3300025920 Bacteria 103054
118 Ga0207649_10262693 3300025920 Bacteria 1248
119 Ga0207652_10000004 3300025921 Bacteria 436303
120 Ga0207652_10045902 3300025921 Bacteria 3726
121 Ga0207652_10681304 3300025921 Bacteria 918
122 Ga0207681_10525930 3300025923 Bacteria 971
123 Ga0207694_10996845 3300025924 Bacteria 709
124 Ga0207690_10001330 3300025932 Bacteria 15545
125 Ga0207690_10015080 3300025932 Bacteria 4678
126 Ga0207690_10191096 3300025932 Bacteria 1549
127 Ga0207690_10242143 3300025932 Bacteria 1390
128 Ga0207690_11619540 3300025932 Bacteria 541
129 Ga0207686_10045192 3300025934 Bacteria 2709
130 Ga0207709_11703362 3300025935 Bacteria 524
131 Ga0207691_10446709 3300025940 Bacteria 1100
132 Ga0207679_10172105 3300025945 Bacteria 1784
133 Ga0207667_10000327 3300025949 Bacteria 66205
134 Ga0207712_10786370 3300025961 Unclassified 836
135 Ga0207640_10059816 3300025981 Bacteria 2516
136 Ga0207639_10786760 3300026041 Bacteria 886
137 Ga0207678_10002367 3300026067 Bacteria 17102
138 Ga0207675_100483905 3300026118 Bacteria 1230
139 Ga0268265_10033659 3300028380 Bacteria 3728
140 Ga0268264_10928992 3300028381 Bacteria 874
141 Ga0268264_11032454 3300028381 Unclassified 829
142 Ga0268264_11127968 3300028381 Bacteria 793
143 Ga0307513_10572686 3300031456 Bacteria 840
144 Ga0307413_10072189 3300031824 Bacteria 2178
145 Ga0307413_10877489 3300031824 Bacteria 760
146 Ga0307413_11124964 3300031824 Unclassified 679
147 Ga0307413_11522447 3300031824 Bacteria 592
148 Ga0307413_12031578 3300031824 Bacteria 519
149 Ga0307410_11859068 3300031852 Bacteria 536
150 Ga0307412_10500885 3300031911 Bacteria 1011
151 Ga0307416_100199314 3300032002 Bacteria 1898
152 Ga0307416_100905568 3300032002 Bacteria 982
153 Ga0307416_101084220 3300032002 Bacteria 905
154 Ga0307416_101921848 3300032002 Bacteria 695
155 Ga0307414_10777474 3300032004 Bacteria 872
156 Ga0307411_10481917 3300032005 Bacteria 1045
157 Ga0307411_10814665 3300032005 Unclassified 823
158 Ga0307411_11756396 3300032005 Unclassified 575
159 Ga0395899_0000258 3300037312 Bacteria 69644
160 Ga0395899_0005982 3300037312 Bacteria 9447
161 Ga0395900_0000254 3300037418 Bacteria 83296
162 Ga0395900_0190173 3300037418 Bacteria 2082
163 Ga0395900_0541737 3300037418 Bacteria 1109
164 Ga0395900_1255211 3300037418 Bacteria 655
165 Ga0395898_0089702 3300037466 Bacteria 2959
166 Ga0395898_0112419 3300037466 Bacteria 2610
167 Ga0395898_0690414 3300037466 Bacteria 963
168 Ga0395898_0703341 3300037466 Bacteria 952
169 Ga0395898_1073391 3300037466 Bacteria 739
170 Ga0395905_0009843 3300037471 Bacteria 9318
171 Ga0395905_0307178 3300037471 Bacteria 1474
172 Ga0395905_0340676 3300037471 Bacteria 1390
173 Ga0395901_0000030 3300038443 Bacteria 241916
174 Ga0395901_0191992 3300038443 Bacteria 2141
175 Ga0395901_0254086 3300038443 Bacteria 1830
176 Ga0395901_0928277 3300038443 Bacteria 850
177 Ga0436365_0051649 3300039437 Bacteria 4174
178 Ga0436365_0352550 3300039437 Bacteria 74350
179 Ga0436365_1728108 3300039437 Bacteria 56121
180 Ga0436363_0518267 3300039450 Bacteria 812
181 Ga0436363_1295282 3300039450 Bacteria 1751
182 Ga0436362_0976836 3300039453 Bacteria 135942
183 Ga0439465_0306802 3300041413 Unclassified 595
184 Ga0451795_1026177 3300041456 Bacteria 716
185 Ga0466967_1082203 3300045976 Bacteria 799
186 Ga0495594_0434872 3300046499 Bacteria 746
187 Ga0495620_0235060 3300046515 Bacteria 700
188 Ga0495633_0273213 3300046558 Unclassified 769
189 Ga0495670_0087065 3300046691 Unclassified 1596
190 Ga0496118_0021191 3300048921 Bacteria 5731
191 Ga0496121_0092886 3300048924 Bacteria 2351
192 Ga0496122_0017354 3300048925 Bacteria 6736
193 Ga0496124_0776461 3300048927 Bacteria 597
194 Ga0496124_0956189 3300048927 Bacteria 514
195 Ga0501305_074757 3300049161 Bacteria 601
196 Ga0501032_0832711 3300049569 Unclassified 582
197 Ga0501034_0357429 3300049571 Bacteria 1388
198 Ga0501047_0709735 3300049581 Bacteria 823
199 Ga0501047_0773851 3300049581 Bacteria 775
200 Ga0501067_0346984 3300049583 Bacteria 827
201 Ga0501072_0882060 3300049588 Bacteria 699
202 Ga0501073_1200299 3300049589 Bacteria 521
203 Ga0501075_0938421 3300049591 Unclassified 658
204 Ga0501079_0207356 3300049741 Bacteria 1531
205 Ga0501080_0011336 3300049742 Bacteria 8161
206 Ga0501083_0004456 3300049744 Bacteria 9889
207 Ga0501083_0846272 3300049744 Bacteria 595
208 Ga0501267_022035 3300049764 Bacteria 708
209 nmdc:mga0qj67_90903_c1 3300050509 Bacteria 2453
210 Ga0500559_0081846 3300053136 Bacteria 1468
211 Ga0501082_0008591 3300060353 Bacteria 8811

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005440 Ga0070705_100790888 Ga0070705_1007908881 58
2 3300005546 Ga0070696_100506858 Ga0070696_1005068581 58
3 3300005547 Ga0070693_100649738 Ga0070693_1006497381 58
4 3300005549 Ga0070704_101764764 Ga0070704_1017647641 58
5 3300005617 Ga0068859_100318952 Ga0068859_1003189522 58
6 3300005842 Ga0068858_102149767 Ga0068858_1021497672 58
7 3300005843 Ga0068860_100011188 Ga0068860_1000111885 58
8 3300005843 Ga0068860_100062505 Ga0068860_1000625052 58
9 3300005843 Ga0068860_101420368 Ga0068860_1014203682 58
10 3300005844 Ga0068862_102449049 Ga0068862_1024490492 58
11 3300005937 Ga0081455_10058023 Ga0081455_100580232 58
12 3300006931 Ga0097620_100318939 Ga0097620_1003189392 58
13 3300009098 Ga0105245_12469283 Ga0105245_124692831 58
14 3300009148 Ga0105243_12128614 Ga0105243_121286141 58
15 3300009176 Ga0105242_10085032 Ga0105242_100850324 58
16 3300009553 Ga0105249_10212172 Ga0105249_102121723 58
17 3300011119 Ga0105246_12602426 Ga0105246_126024262 58
18 3300013306 Ga0163162_12658591 Ga0163162_126585912 58
19 3300025934 Ga0207686_10045192 Ga0207686_100451922 58
20 3300025961 Ga0207712_10786370 Ga0207712_107863701 58
21 3300028381 Ga0268264_10928992 Ga0268264_109289923 58
22 3300028381 Ga0268264_11032454 Ga0268264_110324542 58
23 3300028381 Ga0268264_11127968 Ga0268264_111279682 58
24 3300046499 Ga0495594_0434872 Ga0495594_0434872_494_682 58
25 3300005295 Ga0065707_10449240 Ga0065707_104492402 59
26 3300005844 Ga0068862_100035124 Ga0068862_1000351244 59
27 3300028380 Ga0268265_10033659 Ga0268265_100336595 59
28 3300032002 Ga0307416_100905568 Ga0307416_1009055682 59
29 3300032002 Ga0307416_101084220 Ga0307416_1010842202 59
30 3300049161 Ga0501305_074757 Ga0501305_074757_10_210 59
31 3300049581 Ga0501047_0773851 Ga0501047_0773851_275_466 59
32 3300049583 Ga0501067_0346984 Ga0501067_0346984_338_529 59
33 3300049588 Ga0501072_0882060 Ga0501072_0882060_406_597 59
34 3300049591 Ga0501075_0938421 Ga0501075_0938421_134_340 59
35 3300049741 Ga0501079_0207356 Ga0501079_0207356_324_530 59
36 3300049742 Ga0501080_0011336 Ga0501080_0011336_5059_5250 59
37 3300049744 Ga0501083_0004456 Ga0501083_0004456_5759_5950 59
38 3300049744 Ga0501083_0846272 Ga0501083_0846272_345_545 59
39 3300060353 Ga0501082_0008591 Ga0501082_0008591_2670_2861 59
40 3300049589 Ga0501073_1200299 Ga0501073_1200299_83_280 63
41 3300005327 Ga0070658_10000927 Ga0070658_100009278 66
42 3300005327 Ga0070658_10008525 Ga0070658_100085252 66
43 3300005327 Ga0070658_10010412 Ga0070658_100104125 66
44 3300005327 Ga0070658_10080396 Ga0070658_100803962 66
45 3300005339 Ga0070660_100000184 Ga0070660_10000018434 66
46 3300005339 Ga0070660_100008354 Ga0070660_1000083545 66
47 3300005339 Ga0070660_100021488 Ga0070660_1000214882 66
48 3300005344 Ga0070661_100131522 Ga0070661_1001315224 66
49 3300005345 Ga0070692_10008415 Ga0070692_100084152 66
50 3300005345 Ga0070692_10018436 Ga0070692_100184362 66
51 3300005366 Ga0070659_100653502 Ga0070659_1006535022 66
52 3300005366 Ga0070659_100828101 Ga0070659_1008281012 66
53 3300005366 Ga0070659_100989169 Ga0070659_1009891692 66
54 3300005455 Ga0070663_100005406 Ga0070663_1000054069 66
55 3300005530 Ga0070679_100117216 Ga0070679_1001172162 66
56 3300005530 Ga0070679_100318890 Ga0070679_1003188904 66
57 3300005535 Ga0070684_100441893 Ga0070684_1004418932 66
58 3300005563 Ga0068855_100000907 Ga0068855_10000090722 66
59 3300005563 Ga0068855_100115314 Ga0068855_1001153141 66
60 3300013100 Ga0157373_10866553 Ga0157373_108665532 66
61 3300013102 Ga0157371_10000705 Ga0157371_1000070544 66
62 3300013102 Ga0157371_10052051 Ga0157371_100520512 66
63 3300013102 Ga0157371_10188636 Ga0157371_101886363 66
64 3300013104 Ga0157370_10350840 Ga0157370_103508403 66
65 3300013104 Ga0157370_10939576 Ga0157370_109395762 66
66 3300013307 Ga0157372_11919570 Ga0157372_119195702 66
67 3300020082 Ga0206353_11736747 Ga0206353_117367472 66
68 3300025904 Ga0207647_10024944 Ga0207647_100249442 66
69 3300025904 Ga0207647_10346260 Ga0207647_103462602 66
70 3300025909 Ga0207705_10000050 Ga0207705_1000005025 66
71 3300025909 Ga0207705_10001324 Ga0207705_100013248 66
72 3300025909 Ga0207705_10006958 Ga0207705_100069585 66
73 3300025909 Ga0207705_10018413 Ga0207705_100184132 66
74 3300025909 Ga0207705_10030441 Ga0207705_100304412 66
75 3300025909 Ga0207705_10117612 Ga0207705_101176122 66
76 3300025919 Ga0207657_10000210 Ga0207657_1000021026 66
77 3300025919 Ga0207657_10000301 Ga0207657_100003019 66
78 3300025919 Ga0207657_10007540 Ga0207657_100075409 66
79 3300025919 Ga0207657_10649208 Ga0207657_106492082 66
80 3300025920 Ga0207649_10262693 Ga0207649_102626933 66
81 3300025921 Ga0207652_10045902 Ga0207652_100459022 66
82 3300025921 Ga0207652_10681304 Ga0207652_106813042 66
83 3300025932 Ga0207690_10191096 Ga0207690_101910962 66
84 3300025932 Ga0207690_10242143 Ga0207690_102421432 66
85 3300025932 Ga0207690_11619540 Ga0207690_116195402 66
86 3300025949 Ga0207667_10000327 Ga0207667_1000032723 66
87 3300026067 Ga0207678_10002367 Ga0207678_100023679 66
88 3300037312 Ga0395899_0000258 Ga0395899_0000258_43562_43789 66
89 3300037312 Ga0395899_0005982 Ga0395899_0005982_8532_8759 66
90 3300037418 Ga0395900_0000254 Ga0395900_0000254_23494_23721 66
91 3300037418 Ga0395900_0190173 Ga0395900_0190173_1236_1463 66
92 3300037418 Ga0395900_0541737 Ga0395900_0541737_555_782 66
93 3300037418 Ga0395900_1255211 Ga0395900_1255211_363_590 66
94 3300037466 Ga0395898_0089702 Ga0395898_0089702_1593_1820 66
95 3300037466 Ga0395898_0112419 Ga0395898_0112419_1704_1931 66
96 3300037466 Ga0395898_0690414 Ga0395898_0690414_594_821 66
97 3300037466 Ga0395898_0703341 Ga0395898_0703341_143_370 66
98 3300037466 Ga0395898_1073391 Ga0395898_1073391_402_629 66
99 3300037471 Ga0395905_0009843 Ga0395905_0009843_8724_8951 66
100 3300037471 Ga0395905_0307178 Ga0395905_0307178_573_800 66
101 3300037471 Ga0395905_0340676 Ga0395905_0340676_1105_1332 66
102 3300038443 Ga0395901_0000030 Ga0395901_0000030_59576_59803 66
103 3300038443 Ga0395901_0191992 Ga0395901_0191992_1818_2045 66
104 3300038443 Ga0395901_0254086 Ga0395901_0254086_1236_1463 66
105 3300038443 Ga0395901_0928277 Ga0395901_0928277_23_250 66
106 3300026041 Ga0207639_10786760 Ga0207639_107867602 69
107 3300039437 Ga0436365_1728108 Ga0436365_1728108_19646_19864 72
108 3300039450 Ga0436363_1295282 Ga0436363_1295282_364_582 72
109 3300025904 Ga0207647_10227428 Ga0207647_102274282 73
110 3300031824 Ga0307413_11522447 Ga0307413_115224472 73
111 3300032002 Ga0307416_101921848 Ga0307416_1019218482 73
112 3300032005 Ga0307411_10481917 Ga0307411_104819171 73
113 3300005293 Ga0065715_10860504 Ga0065715_108605042 74
114 3300041456 Ga0451795_1026177 Ga0451795_1026177_279_506 74
115 3300005327 Ga0070658_10000001 Ga0070658_10000001794 75
116 3300005327 Ga0070658_11313890 Ga0070658_113138902 75
117 3300005339 Ga0070660_100014525 Ga0070660_1000145255 75
118 3300005366 Ga0070659_100001271 Ga0070659_10000127113 75
119 3300005366 Ga0070659_100016435 Ga0070659_1000164354 75
120 3300005547 Ga0070693_100452494 Ga0070693_1004524942 75
121 3300005563 Ga0068855_101782781 Ga0068855_1017827812 75
122 3300005578 Ga0068854_100073465 Ga0068854_1000734652 75
123 3300021377 Ga0213874_10042390 Ga0213874_100423902 75
124 3300025909 Ga0207705_10000002 Ga0207705_100000021087 75
125 3300025913 Ga0207695_10038191 Ga0207695_100381917 75
126 3300025913 Ga0207695_10114741 Ga0207695_101147412 75
127 3300025914 Ga0207671_10001752 Ga0207671_1000175218 75
128 3300025919 Ga0207657_10002347 Ga0207657_100023478 75
129 3300025924 Ga0207694_10996845 Ga0207694_109968452 75
130 3300025932 Ga0207690_10001330 Ga0207690_1000133014 75
131 3300025932 Ga0207690_10015080 Ga0207690_100150804 75
132 3300025981 Ga0207640_10059816 Ga0207640_100598162 75
133 3300031911 Ga0307412_10500885 Ga0307412_105008852 75
134 3300039450 Ga0436363_0518267 Ga0436363_0518267_359_586 75
135 3300048921 Ga0496118_0021191 Ga0496118_0021191_4000_4233 75
136 3300048924 Ga0496121_0092886 Ga0496121_0092886_1108_1341 75
137 3300048925 Ga0496122_0017354 Ga0496122_0017354_1576_1809 75
138 3300048927 Ga0496124_0776461 Ga0496124_0776461_294_527 75
139 3300049764 Ga0501267_022035 Ga0501267_022035_106_333 75
140 3300053136 Ga0500559_0081846 Ga0500559_0081846_332_568 75
141 3300005347 Ga0070668_101365197 Ga0070668_1013651971 76
142 3300005353 Ga0070669_100559511 Ga0070669_1005595112 76
143 3300005356 Ga0070674_101556067 Ga0070674_1015560672 76
144 3300005543 Ga0070672_101534145 Ga0070672_1015341452 76
145 3300005719 Ga0068861_100166436 Ga0068861_1001664363 76
146 3300009553 Ga0105249_10427126 Ga0105249_104271262 76
147 3300013100 Ga0157373_10828593 Ga0157373_108285932 76
148 3300013105 Ga0157369_10002167 Ga0157369_1000216712 76
149 3300013308 Ga0157375_10980455 Ga0157375_109804553 76
150 3300025923 Ga0207681_10525930 Ga0207681_105259302 76
151 3300026118 Ga0207675_100483905 Ga0207675_1004839052 76
152 3300031824 Ga0307413_10877489 Ga0307413_108774891 76
153 3300046558 Ga0495633_0273213 Ga0495633_0273213_476_706 76
154 3300046691 Ga0495670_0087065 Ga0495670_0087065_805_1035 76
155 3300049581 Ga0501047_0709735 Ga0501047_0709735_343_573 76
156 3300002239 JGI24034J26672_10111664 JGI24034J26672_101116641 77
157 3300005331 Ga0070670_100013439 Ga0070670_10001343911 77
158 3300005336 Ga0070680_100006586 Ga0070680_1000065867 77
159 3300005339 Ga0070660_100031061 Ga0070660_1000310617 77
160 3300005344 Ga0070661_100000189 Ga0070661_10000018937 77
161 3300005347 Ga0070668_100000240 Ga0070668_10000024019 77
162 3300005355 Ga0070671_100044108 Ga0070671_1000441082 77
163 3300005364 Ga0070673_102122199 Ga0070673_1021221992 77
164 3300005366 Ga0070659_101147667 Ga0070659_1011476672 77
165 3300005458 Ga0070681_10258021 Ga0070681_102580212 77
166 3300005467 Ga0070706_101576889 Ga0070706_1015768892 77
167 3300005530 Ga0070679_100000019 Ga0070679_10000001962 77
168 3300005536 Ga0070697_101467498 Ga0070697_1014674981 77
169 3300005539 Ga0068853_100442995 Ga0068853_1004429952 77
170 3300005539 Ga0068853_100682442 Ga0068853_1006824422 77
171 3300005543 Ga0070672_100240614 Ga0070672_1002406143 77
172 3300005546 Ga0070696_101758196 Ga0070696_1017581961 77
173 3300005547 Ga0070693_100699408 Ga0070693_1006994081 77
174 3300005616 Ga0068852_102760587 Ga0068852_1027605872 77
175 3300005617 Ga0068859_102747298 Ga0068859_1027472982 77
176 3300006931 Ga0097620_102747364 Ga0097620_1027473642 77
177 3300009177 Ga0105248_12313984 Ga0105248_123139841 77
178 3300009551 Ga0105238_11663781 Ga0105238_116637812 77
179 3300009553 Ga0105249_10006062 Ga0105249_100060627 77
180 3300013307 Ga0157372_10678129 Ga0157372_106781292 77
181 3300020081 Ga0206354_10296133 Ga0206354_102961333 77
182 3300020082 Ga0206353_10722480 Ga0206353_107224803 77
183 3300021358 Ga0213873_10000007 Ga0213873_10000007177 77
184 3300021384 Ga0213876_10000005 Ga0213876_10000005213 77
185 3300025912 Ga0207707_10084967 Ga0207707_100849672 77
186 3300025917 Ga0207660_10000211 Ga0207660_100002114 77
187 3300025919 Ga0207657_10003599 Ga0207657_100035999 77
188 3300025920 Ga0207649_10000055 Ga0207649_1000005537 77
189 3300025921 Ga0207652_10000004 Ga0207652_10000004347 77
190 3300025935 Ga0207709_11703362 Ga0207709_117033622 77
191 3300025940 Ga0207691_10446709 Ga0207691_104467092 77
192 3300025945 Ga0207679_10172105 Ga0207679_101721053 77
193 3300031456 Ga0307513_10572686 Ga0307513_105726861 77
194 3300031824 Ga0307413_10072189 Ga0307413_100721894 77
195 3300031824 Ga0307413_11124964 Ga0307413_111249641 77
196 3300031824 Ga0307413_12031578 Ga0307413_120315782 77
197 3300031852 Ga0307410_11859068 Ga0307410_118590682 77
198 3300032002 Ga0307416_100199314 Ga0307416_1001993142 77
199 3300032004 Ga0307414_10777474 Ga0307414_107774742 77
200 3300032005 Ga0307411_10814665 Ga0307411_108146652 77
201 3300032005 Ga0307411_11756396 Ga0307411_117563962 77
202 3300039437 Ga0436365_0051649 Ga0436365_0051649_2287_2520 77
203 3300039437 Ga0436365_0352550 Ga0436365_0352550_42351_42584 77
204 3300039453 Ga0436362_0976836 Ga0436362_0976836_9814_10047 77
205 3300041413 Ga0439465_0306802 Ga0439465_0306802_14_250 77
206 3300045976 Ga0466967_1082203 Ga0466967_1082203_475_708 77
207 3300046515 Ga0495620_0235060 Ga0495620_0235060_421_654 77
208 3300048927 Ga0496124_0956189 Ga0496124_0956189_156_443 77
209 3300049569 Ga0501032_0832711 Ga0501032_0832711_320_553 77
210 3300049571 Ga0501034_0357429 Ga0501034_0357429_525_758 77
211 3300050509 nmdc:mga0qj67_90903_c1 nmdc:mga0qj67_90903_c1_246_479 77

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13617

Lipoprotein_19

YnbE-like lipoprotein

47

80

0.99

Feature Viewer

pLDDT pTM Quality
60.57 0.21 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map