F321174

General Info

Members Datasets Scaffolds Average Seq Length
211 150 207 253

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100018973|Ga0070683_1000189732
Length 300
Sequence MKAFMAEHYVLAVKLRRDKVASFDEYPFSLPVVRQLDALELHPSVTFLVGENGSGKSTLLEAIAVAWGFNPEGGSKNFRFGTRASHSALHEYLRLVKGVHRPRGGFFLRAESLFNVASEIEHLDEDPTAGPPIIDAYGSRSLHEQSHGESFFAVMVHRFRGGGFYVLDEPEAALSPSRQLAMISRIHQLVSARSQFVIATHSPILMAYPNAWIYQIGAGGLERVTLEETEHYVVAKRFLNDPHRQIEKILASDPEDPRNGELFLRPHAVPKMMRFIEISCEAGRNGAHAPLRKLRSLGVD

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
3 2734482264 Dyella sp. AD052 Isolate Unclassified
4 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
5 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
84 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
85 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
86 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
87 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
88 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
89 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
90 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
91 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
92 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
93 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
94 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
95 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
96 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
97 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
98 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
99 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
100 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
101 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
102 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
103 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
104 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
105 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
106 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
107 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
108 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
109 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
110 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
111 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
112 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
113 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
114 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
115 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
116 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
117 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
118 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
119 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
120 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
121 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
122 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
123 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
124 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
125 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
126 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
127 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
128 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
129 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
130 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
131 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
132 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
133 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
134 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
135 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
136 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
137 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
138 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
139 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
140 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
141 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
142 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
143 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
144 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
145 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
146 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
147 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
148 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
149 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
150 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.1
Metatranscriptomes 0
Isolates 1.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.27
Nodule 0
Rhizoplane 4.27
Rhizosphere 73.93
Stem 0
Stem Tuber 0
Unclassified 17.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_118982 2162886007 Bacteria 7586
2 JGI25406J46586_10032198 3300003203 Bacteria 1950
3 Ga0055531_10018705 3300003794 Bacteria 2845
4 Ga0065704_10073025 3300005289 Bacteria 7669
5 Ga0065712_10005985 3300005290 Bacteria 5304
6 Ga0070683_100018973 3300005329 Bacteria 6102
7 Ga0070683_100264617 3300005329 Bacteria 1636
8 Ga0070670_100000203 3300005331 Bacteria 55342
9 Ga0070670_100062138 3300005331 Bacteria 3206
10 Ga0070666_10090868 3300005335 Bacteria 2097
11 Ga0070666_10307060 3300005335 Bacteria 1130
12 Ga0070680_100009629 3300005336 Bacteria 7429
13 Ga0070682_100000022 3300005337 Bacteria 209117
14 Ga0070682_100009992 3300005337 Bacteria 5374
15 Ga0070682_100094466 3300005337 Bacteria 1962
16 Ga0070689_100000400 3300005340 Bacteria 25443
17 Ga0070668_100407995 3300005347 Bacteria 1161
18 Ga0070675_100275840 3300005354 Bacteria 1476
19 Ga0070674_100685388 3300005356 Bacteria 875
20 Ga0070667_100050339 3300005367 Bacteria 3511
21 Ga0070667_100507815 3300005367 Bacteria 1105
22 Ga0070703_10052936 3300005406 Bacteria 1304
23 Ga0070706_100182848 3300005467 Bacteria 1958
24 Ga0070684_100019669 3300005535 Bacteria 5588
25 Ga0070697_100053526 3300005536 Unclassified 3280
26 Ga0070672_100004987 3300005543 Bacteria 8749
27 Ga0070665_100002015 3300005548 Bacteria 22843
28 Ga0070665_100002533 3300005548 Bacteria 20075
29 Ga0070665_100132267 3300005548 Bacteria 2497
30 Ga0070665_100141449 3300005548 Bacteria 2409
31 Ga0068855_100173724 3300005563 Bacteria 2439
32 Ga0068852_100231545 3300005616 Bacteria 1761
33 Ga0068859_100143922 3300005617 Bacteria 2458
34 Ga0068864_100694449 3300005618 Bacteria 994
35 Ga0068858_100000015 3300005842 Bacteria 214504
36 Ga0068858_100134170 3300005842 Bacteria 2322
37 Ga0068860_100268792 3300005843 Bacteria 1663
38 Ga0081455_10202389 3300005937 Bacteria 1486
39 Ga0081539_10000045 3300005985 Bacteria 277027
40 Ga0075367_10119518 3300006178 Bacteria 1623
41 Ga0075428_100124049 3300006844 Bacteria 2811
42 Ga0075431_100474488 3300006847 Bacteria 1244
43 Ga0075433_10091598 3300006852 Bacteria 2688
44 Ga0075434_100025230 3300006871 Bacteria 5816
45 Ga0075434_100341843 3300006871 Bacteria 1517
46 Ga0075429_100392324 3300006880 Bacteria 1215
47 Ga0075436_100007709 3300006914 Bacteria 7356
48 Ga0097620_100143924 3300006931 Bacteria 2458
49 Ga0075435_100017613 3300007076 Bacteria 5412
50 Ga0105251_10000314 3300009011 Bacteria 48563
51 Ga0105240_10000169 3300009093 Bacteria 133189
52 Ga0105240_10001551 3300009093 Bacteria 38976
53 Ga0105240_10034277 3300009093 Bacteria 6550
54 Ga0105240_10117520 3300009093 Bacteria 3206
55 Ga0105245_10001031 3300009098 Bacteria 25294
56 Ga0105247_10042445 3300009101 Bacteria 2786
57 Ga0114129_10213727 3300009147 Bacteria 2606
58 Ga0105241_10205276 3300009174 Bacteria 1648
59 Ga0105241_10334240 3300009174 Bacteria 1310
60 Ga0105242_10064886 3300009176 Bacteria 3011
61 Ga0105242_10757919 3300009176 Bacteria 956
62 Ga0105237_10323148 3300009545 Bacteria 1547
63 Ga0105237_10465923 3300009545 Bacteria 1270
64 Ga0105238_10005161 3300009551 Bacteria 12912
65 Ga0105239_10003053 3300010375 Bacteria 20805
66 Ga0105239_10022939 3300010375 Bacteria 6881
67 Ga0105239_10057579 3300010375 Bacteria 4263
68 Ga0105239_10283050 3300010375 Bacteria 1867
69 Ga0157374_10004009 3300013296 Bacteria 12378
70 Ga0157374_10216000 3300013296 Bacteria 1881
71 Ga0157378_10245230 3300013297 Bacteria 1713
72 Ga0157375_10000001 3300013308 Bacteria 696576
73 Ga0157380_10050979 3300014326 Bacteria 3270
74 Ga0157379_10099964 3300014968 Bacteria 2604
75 Ga0157379_10522654 3300014968 Bacteria 1102
76 Ga0163161_10009526 3300017792 Bacteria 6718
77 Ga0163161_10051844 3300017792 Bacteria 2974
78 Ga0209257_1000078 3300025304 Bacteria 317483
79 Ga0207713_1000206 3300025735 Bacteria 80103
80 Ga0207710_10004128 3300025900 Bacteria 6376
81 Ga0207680_10068811 3300025903 Bacteria 2185
82 Ga0207699_10138908 3300025906 Bacteria 1595
83 Ga0207643_10363830 3300025908 Bacteria 909
84 Ga0207654_10550928 3300025911 Unclassified 819
85 Ga0207695_10001267 3300025913 Bacteria 42955
86 Ga0207695_10020829 3300025913 Bacteria 7497
87 Ga0207695_10039660 3300025913 Bacteria 5059
88 Ga0207695_10058948 3300025913 Bacteria 3984
89 Ga0207671_10218465 3300025914 Unclassified 1493
90 Ga0207660_10090123 3300025917 Bacteria 2271
91 Ga0207694_10026356 3300025924 Bacteria 4422
92 Ga0207650_10003936 3300025925 Bacteria 10164
93 Ga0207650_10075014 3300025925 Bacteria 2551
94 Ga0207687_10007185 3300025927 Bacteria 7342
95 Ga0207686_10033424 3300025934 Bacteria 3071
96 Ga0207670_10001150 3300025936 Bacteria 13916
97 Ga0207670_10147230 3300025936 Bacteria 1743
98 Ga0207667_10342381 3300025949 Bacteria 1526
99 Ga0207658_10037861 3300025986 Bacteria 3470
100 Ga0207658_10596200 3300025986 Bacteria 992
101 Ga0207703_10000022 3300026035 Bacteria 245723
102 Ga0207703_10107699 3300026035 Bacteria 2373
103 Ga0207708_10265641 3300026075 Bacteria 1386
104 Ga0207676_10125138 3300026095 Unclassified 2176
105 Ga0207683_10081311 3300026121 Bacteria 2875
106 Ga0207698_10689165 3300026142 Unclassified 1016
107 Ga0268266_10000309 3300028379 Bacteria 77336
108 Ga0268266_10001723 3300028379 Bacteria 25047
109 Ga0268266_10162178 3300028379 Bacteria 2023
110 Ga0268266_10178901 3300028379 Bacteria 1930
111 Ga0268264_10004072 3300028381 Bacteria 12516
112 Ga0307515_10167033 3300028794 Bacteria 2213
113 Ga0307513_10007478 3300031456 Bacteria 14151
114 Ga0307513_10287189 3300031456 Bacteria 1419
115 Ga0307408_100220349 3300031548 Bacteria 1548
116 Ga0307412_10113090 3300031911 Bacteria 1942
117 Ga0307416_100059789 3300032002 Bacteria 3099
118 Ga0307510_10000010 3300033180 Bacteria 377457
119 Ga0307510_10002666 3300033180 Bacteria 20416
120 Ga0373950_0000003 3300034818 Bacteria 541085
121 Ga0439436_0019597 3300041404 Bacteria 2019
122 Ga0439465_0000739 3300041413 Bacteria 10118
123 Ga0451791_1434459 3300041451 Bacteria 1622
124 Ga0451797_0881122 3300041453 Bacteria 1664
125 Ga0451795_1599796 3300041456 Bacteria 986
126 Ga0451843_1000031 3300041509 Bacteria 1919
127 Ga0451853_2506917 3300041512 Bacteria 1188
128 Ga0439449_0020559 3300042007 Bacteria 2473
129 Ga0439446_0016950 3300042156 Bacteria 2033
130 Ga0495638_0081993 3300046460 Bacteria 1957
131 Ga0495650_0015608 3300046471 Bacteria 3887
132 Ga0495607_0050551 3300046501 Bacteria 2419
133 Ga0495606_0004403 3300046507 Bacteria 14087
134 Ga0495606_0015270 3300046507 Bacteria 5926
135 Ga0495616_0014828 3300046513 Bacteria 4350
136 Ga0495620_0002353 3300046515 Bacteria 10950
137 Ga0495631_0000522 3300046518 Bacteria 25801
138 Ga0495622_0203770 3300046557 Bacteria 881
139 Ga0495668_0005420 3300046616 Bacteria 8668
140 Ga0495625_0008164 3300046660 Bacteria 8968
141 Ga0495625_0023474 3300046660 Bacteria 4712
142 Ga0495625_0051389 3300046660 Bacteria 2955
143 Ga0495625_0112163 3300046660 Unclassified 1863
144 Ga0495589_0030232 3300046794 Bacteria 2728
145 Ga0495673_0008729 3300047469 Bacteria 5664
146 Ga0495681_0033852 3300047470 Bacteria 2553
147 Ga0495686_0002360 3300047472 Bacteria 18009
148 Ga0495686_0004941 3300047472 Bacteria 10738
149 Ga0496101_0106064 3300048904 Bacteria 2109
150 Ga0496102_0749783 3300048905 Bacteria 899
151 Ga0496106_0064668 3300048909 Bacteria 2783
152 Ga0496106_0363286 3300048909 Bacteria 1163
153 Ga0496107_0035176 3300048910 Bacteria 3591
154 Ga0496115_0058596 3300048918 Bacteria 3099
155 Ga0496116_0011571 3300048919 Bacteria 7286
156 Ga0496117_0000303 3300048920 Bacteria 85952
157 Ga0496117_0002008 3300048920 Bacteria 26964
158 Ga0496117_0018924 3300048920 Bacteria 5681
159 Ga0496118_0000300 3300048921 Bacteria 85952
160 Ga0496118_0002794 3300048921 Bacteria 22849
161 Ga0496118_0061051 3300048921 Bacteria 2794
162 Ga0496118_0084364 3300048921 Bacteria 2216
163 Ga0496119_0001009 3300048922 Bacteria 36000
164 Ga0496119_0001460 3300048922 Bacteria 28322
165 Ga0496119_0003796 3300048922 Bacteria 15448
166 Ga0496120_0001455 3300048923 Bacteria 28321
167 Ga0496120_0002890 3300048923 Bacteria 16454
168 Ga0496121_0001097 3300048924 Bacteria 47772
169 Ga0496121_0002419 3300048924 Bacteria 28592
170 Ga0496121_0003907 3300048924 Bacteria 20678
171 Ga0496121_0014715 3300048924 Bacteria 8269
172 Ga0496121_0019681 3300048924 Bacteria 6736
173 Ga0496121_0020759 3300048924 Bacteria 6476
174 Ga0496121_0120925 3300048924 Bacteria 1978
175 Ga0496122_0000671 3300048925 Bacteria 68810
176 Ga0496122_0021625 3300048925 Bacteria 5750
177 Ga0496123_0000489 3300048926 Bacteria 68892
178 Ga0496123_0010218 3300048926 Bacteria 8328
179 Ga0496124_0000345 3300048927 Bacteria 85004
180 Ga0496124_0210452 3300048927 Unclassified 1472
181 Ga0496126_0001954 3300048929 Bacteria 29233
182 Ga0496126_0056836 3300048929 Bacteria 3535
183 Ga0501067_0000369 3300049583 Bacteria 24624
184 Ga0501072_0407021 3300049588 Bacteria 1079
185 Ga0501073_0005859 3300049589 Bacteria 9170
186 Ga0501076_0136936 3300049592 Bacteria 1988
187 Ga0501077_0087362 3300049593 Bacteria 1976
188 Ga0501079_0067594 3300049741 Bacteria 2758
189 Ga0501081_0041620 3300049743 Bacteria 3147
190 Ga0501083_0111398 3300049744 Bacteria 1799
191 nmdc:mga06z11_95728_c1 3300050494 Bacteria 1620
192 nmdc:mga05p37_124440_c1 3300050507 Unclassified 3167
193 nmdc:mga09592_23028_c1 3300050508 Bacteria 5140
194 nmdc:mga06r32_417026_c1 3300050510 Bacteria 1324
195 nmdc:mga06r32_571116_c1 3300050510 Bacteria 1104
196 nmdc:mga08y16_437497_c1 3300050511 Bacteria 1335
197 nmdc:mga0n895_41116_c1 3300050512 Bacteria 4494
198 nmdc:mga0n895_469239_c1 3300050512 Bacteria 1270
199 nmdc:mga0rr50_21994_c1 3300050513 Bacteria 4367
200 nmdc:mga08x19_105392_c1 3300050514 Bacteria 1875
201 nmdc:mga0a205_56981_c1 3300050515 Bacteria 3773
202 Ga0500651_0000693 3300053093 Bacteria 16717
203 Ga0500595_023524 3300053119 Bacteria 2164
204 Ga0500588_0001500 3300053146 Bacteria 4461
205 Ga0500616_0000193 3300053153 Bacteria 100119
206 Ga0500622_0003136 3300053156 Bacteria 11336
207 Ga0501084_0138353 3300054114 Bacteria 2050

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013297 Ga0157378_10245230 Ga0157378_102452303 235
2 3300050510 nmdc:mga06r32_417026_c1 nmdc:mga06r32_417026_c1_538_1284 235
3 3300005337 Ga0070682_100000022 Ga0070682_100000022100 238
4 3300005340 Ga0070689_100000400 Ga0070689_10000040012 238
5 3300005406 Ga0070703_10052936 Ga0070703_100529362 238
6 3300005543 Ga0070672_100004987 Ga0070672_1000049877 238
7 3300005618 Ga0068864_100694449 Ga0068864_1006944491 238
8 3300005842 Ga0068858_100000015 Ga0068858_10000001594 238
9 3300009098 Ga0105245_10001031 Ga0105245_1000103124 238
10 3300009176 Ga0105242_10757919 Ga0105242_107579192 238
11 3300013308 Ga0157375_10000001 Ga0157375_10000001445 238
12 3300014326 Ga0157380_10050979 Ga0157380_100509793 238
13 3300025927 Ga0207687_10007185 Ga0207687_100071854 238
14 3300025936 Ga0207670_10001150 Ga0207670_100011506 238
15 3300026035 Ga0207703_10000022 Ga0207703_1000002284 238
16 3300026095 Ga0207676_10125138 Ga0207676_101251383 238
17 3300042156 Ga0439446_0016950 Ga0439446_0016950_960_1685 238
18 3300003203 JGI25406J46586_10032198 JGI25406J46586_100321982 240
19 3300005985 Ga0081539_10000045 Ga0081539_10000045133 240
20 3300006178 Ga0075367_10119518 Ga0075367_101195182 240
21 3300050494 nmdc:mga06z11_95728_c1 nmdc:mga06z11_95728_c1_248_1063 240
22 3300046471 Ga0495650_0015608 Ga0495650_0015608_742_1473 243
23 3300046518 Ga0495631_0000522 Ga0495631_0000522_5854_6585 243
24 3300046557 Ga0495622_0203770 Ga0495622_0203770_110_841 243
25 3300046660 Ga0495625_0051389 Ga0495625_0051389_116_847 243
26 3300047469 Ga0495673_0008729 Ga0495673_0008729_4328_5059 243
27 3300047472 Ga0495686_0002360 Ga0495686_0002360_8992_9723 243
28 3300048905 Ga0496102_0749783 Ga0496102_0749783_93_824 243
29 3300048909 Ga0496106_0064668 Ga0496106_0064668_1813_2544 243
30 3300048924 Ga0496121_0002419 Ga0496121_0002419_1914_2645 243
31 3300005335 Ga0070666_10090868 Ga0070666_100908682 245
32 3300005563 Ga0068855_100173724 Ga0068855_1001737242 245
33 3300009093 Ga0105240_10001551 Ga0105240_1000155138 245
34 3300009174 Ga0105241_10334240 Ga0105241_103342402 245
35 3300010375 Ga0105239_10057579 Ga0105239_100575794 245
36 3300013296 Ga0157374_10216000 Ga0157374_102160002 245
37 3300014968 Ga0157379_10099964 Ga0157379_100999643 245
38 3300025903 Ga0207680_10068811 Ga0207680_100688113 245
39 3300025913 Ga0207695_10020829 Ga0207695_100208296 245
40 3300053146 Ga0500588_0001500 Ga0500588_0001500_1998_2750 245
41 iso_pu_bacteria 2919425241 2919431778 245
42 iso_pu_bacteria 2980182181 2980189129 245
43 iso_pu_bacteria 2718218334 2721028424 246
44 3300005616 Ga0068852_100231545 Ga0068852_1002315452 247
45 3300009174 Ga0105241_10205276 Ga0105241_102052761 247
46 3300009545 Ga0105237_10323148 Ga0105237_103231482 247
47 3300013296 Ga0157374_10004009 Ga0157374_100040091 247
48 3300025911 Ga0207654_10550928 Ga0207654_105509281 247
49 3300025914 Ga0207671_10218465 Ga0207671_102184652 247
50 3300026121 Ga0207683_10081311 Ga0207683_100813112 247
51 3300026142 Ga0207698_10689165 Ga0207698_106891652 247
52 iso_pu_bacteria 2734482264 2735835996 247
53 3300033180 Ga0307510_10000010 Ga0307510_10000010237 248
54 3300034818 Ga0373950_0000003 Ga0373950_0000003_181986_182738 248
55 3300049583 Ga0501067_0000369 Ga0501067_0000369_13449_14201 248
56 3300049589 Ga0501073_0005859 Ga0501073_0005859_1007_1759 248
57 3300005842 Ga0068858_100134170 Ga0068858_1001341702 249
58 3300006852 Ga0075433_10091598 Ga0075433_100915982 249
59 3300006871 Ga0075434_100025230 Ga0075434_1000252304 249
60 3300006914 Ga0075436_100007709 Ga0075436_1000077092 249
61 3300007076 Ga0075435_100017613 Ga0075435_1000176135 249
62 3300010375 Ga0105239_10283050 Ga0105239_102830502 249
63 3300014968 Ga0157379_10522654 Ga0157379_105226541 249
64 3300025908 Ga0207643_10363830 Ga0207643_103638301 249
65 3300025936 Ga0207670_10147230 Ga0207670_101472302 249
66 3300026035 Ga0207703_10107699 Ga0207703_101076993 249
67 3300050512 nmdc:mga0n895_41116_c1 nmdc:mga0n895_41116_c1_1221_1976 249
68 3300050513 nmdc:mga0rr50_21994_c1 nmdc:mga0rr50_21994_c1_2658_3413 249
69 3300050514 nmdc:mga08x19_105392_c1 nmdc:mga08x19_105392_c1_523_1278 249
70 3300050515 nmdc:mga0a205_56981_c1 nmdc:mga0a205_56981_c1_890_1645 249
71 3300003794 Ga0055531_10018705 Ga0055531_100187053 250
72 3300005347 Ga0070668_100407995 Ga0070668_1004079952 250
73 3300005367 Ga0070667_100507815 Ga0070667_1005078151 250
74 3300005548 Ga0070665_100141449 Ga0070665_1001414493 250
75 3300005937 Ga0081455_10202389 Ga0081455_102023892 250
76 3300009093 Ga0105240_10000169 Ga0105240_1000016943 250
77 3300009551 Ga0105238_10005161 Ga0105238_100051614 250
78 3300010375 Ga0105239_10003053 Ga0105239_100030538 250
79 3300017792 Ga0163161_10009526 Ga0163161_100095261 250
80 3300017792 Ga0163161_10051844 Ga0163161_100518443 250
81 3300025304 Ga0209257_1000078 Ga0209257_1000078116 250
82 3300025913 Ga0207695_10001267 Ga0207695_100012672 250
83 3300025924 Ga0207694_10026356 Ga0207694_100263564 250
84 3300025949 Ga0207667_10342381 Ga0207667_103423812 250
85 3300028379 Ga0268266_10162178 Ga0268266_101621783 250
86 3300031456 Ga0307513_10007478 Ga0307513_100074784 250
87 3300041404 Ga0439436_0019597 Ga0439436_0019597_1036_1788 250
88 3300041413 Ga0439465_0000739 Ga0439465_0000739_141_893 250
89 3300041451 Ga0451791_1434459 Ga0451791_1434459_23_775 250
90 3300041453 Ga0451797_0881122 Ga0451797_0881122_123_875 250
91 3300041509 Ga0451843_1000031 Ga0451843_1000031_341_1093 250
92 3300041512 Ga0451853_2506917 Ga0451853_2506917_313_1065 250
93 3300042007 Ga0439449_0020559 Ga0439449_0020559_1577_2329 250
94 3300046507 Ga0495606_0004403 Ga0495606_0004403_6984_7736 250
95 3300046660 Ga0495625_0023474 Ga0495625_0023474_3121_3873 250
96 3300047472 Ga0495686_0004941 Ga0495686_0004941_6752_7504 250
97 3300048920 Ga0496117_0018924 Ga0496117_0018924_4118_4870 250
98 3300048921 Ga0496118_0061051 Ga0496118_0061051_1361_2113 250
99 3300048925 Ga0496122_0021625 Ga0496122_0021625_2894_3658 250
100 3300048926 Ga0496123_0010218 Ga0496123_0010218_1841_2593 250
101 3300053093 Ga0500651_0000693 Ga0500651_0000693_13309_14100 250
102 3300005329 Ga0070683_100264617 Ga0070683_1002646171 251
103 3300005337 Ga0070682_100009992 Ga0070682_1000099927 251
104 3300005367 Ga0070667_100050339 Ga0070667_1000503394 251
105 3300005548 Ga0070665_100002015 Ga0070665_10000201511 251
106 3300005617 Ga0068859_100143922 Ga0068859_1001439221 251
107 3300006844 Ga0075428_100124049 Ga0075428_1001240493 251
108 3300006847 Ga0075431_100474488 Ga0075431_1004744882 251
109 3300006880 Ga0075429_100392324 Ga0075429_1003923242 251
110 3300006931 Ga0097620_100143924 Ga0097620_1001439241 251
111 3300009101 Ga0105247_10042445 Ga0105247_100424455 251
112 3300009147 Ga0114129_10213727 Ga0114129_102137272 251
113 3300009176 Ga0105242_10064886 Ga0105242_100648861 251
114 3300025900 Ga0207710_10004128 Ga0207710_100041284 251
115 3300025934 Ga0207686_10033424 Ga0207686_100334242 251
116 3300025986 Ga0207658_10037861 Ga0207658_100378614 251
117 3300025986 Ga0207658_10596200 Ga0207658_105962001 251
118 3300028379 Ga0268266_10001723 Ga0268266_1000172310 251
119 3300028381 Ga0268264_10004072 Ga0268264_100040726 251
120 3300031548 Ga0307408_100220349 Ga0307408_1002203492 251
121 3300031911 Ga0307412_10113090 Ga0307412_101130902 251
122 3300032002 Ga0307416_100059789 Ga0307416_1000597894 251
123 3300033180 Ga0307510_10002666 Ga0307510_100026667 251
124 3300041456 Ga0451795_1599796 Ga0451795_1599796_56_811 251
125 3300046616 Ga0495668_0005420 Ga0495668_0005420_3688_4473 251
126 3300046660 Ga0495625_0112163 Ga0495625_0112163_465_1250 251
127 3300046794 Ga0495589_0030232 Ga0495589_0030232_1268_2023 251
128 3300048904 Ga0496101_0106064 Ga0496101_0106064_159_914 251
129 3300048909 Ga0496106_0363286 Ga0496106_0363286_342_1097 251
130 3300048910 Ga0496107_0035176 Ga0496107_0035176_1536_2291 251
131 3300048918 Ga0496115_0058596 Ga0496115_0058596_163_918 251
132 3300048919 Ga0496116_0011571 Ga0496116_0011571_1939_2781 251
133 3300048920 Ga0496117_0000303 Ga0496117_0000303_7140_7982 251
134 3300048921 Ga0496118_0000300 Ga0496118_0000300_77971_78813 251
135 3300048921 Ga0496118_0002794 Ga0496118_0002794_12110_12865 251
136 3300048922 Ga0496119_0001009 Ga0496119_0001009_33377_34144 251
137 3300048922 Ga0496119_0003796 Ga0496119_0003796_10992_11747 251
138 3300048923 Ga0496120_0002890 Ga0496120_0002890_11856_12611 251
139 3300048924 Ga0496121_0001097 Ga0496121_0001097_6838_7593 251
140 3300048924 Ga0496121_0003907 Ga0496121_0003907_7672_8427 251
141 3300048924 Ga0496121_0014715 Ga0496121_0014715_5399_6154 251
142 3300048924 Ga0496121_0019681 Ga0496121_0019681_715_1470 251
143 3300048924 Ga0496121_0020759 Ga0496121_0020759_5023_5790 251
144 3300048924 Ga0496121_0120925 Ga0496121_0120925_322_1077 251
145 3300048929 Ga0496126_0001954 Ga0496126_0001954_16404_17159 251
146 3300048929 Ga0496126_0056836 Ga0496126_0056836_1303_2070 251
147 3300050507 nmdc:mga05p37_124440_c1 nmdc:mga05p37_124440_c1_880_1716 251
148 3300050508 nmdc:mga09592_23028_c1 nmdc:mga09592_23028_c1_898_1734 251
149 3300050510 nmdc:mga06r32_571116_c1 nmdc:mga06r32_571116_c1_233_1069 251
150 3300053156 Ga0500622_0003136 Ga0500622_0003136_6426_7181 251
151 3300005354 Ga0070675_100275840 Ga0070675_1002758402 252
152 3300006871 Ga0075434_100341843 Ga0075434_1003418432 252
153 3300026075 Ga0207708_10265641 Ga0207708_102656411 252
154 3300028794 Ga0307515_10167033 Ga0307515_101670332 252
155 3300031456 Ga0307513_10287189 Ga0307513_102871892 252
156 3300049588 Ga0501072_0407021 Ga0501072_0407021_265_1026 252
157 3300049592 Ga0501076_0136936 Ga0501076_0136936_671_1432 252
158 3300049593 Ga0501077_0087362 Ga0501077_0087362_754_1515 252
159 3300049741 Ga0501079_0067594 Ga0501079_0067594_881_1642 252
160 3300049744 Ga0501083_0111398 Ga0501083_0111398_848_1609 252
161 3300050511 nmdc:mga08y16_437497_c1 nmdc:mga08y16_437497_c1_119_880 252
162 3300050512 nmdc:mga0n895_469239_c1 nmdc:mga0n895_469239_c1_215_976 252
163 3300054114 Ga0501084_0138353 Ga0501084_0138353_378_1139 252
164 3300005290 Ga0065712_10005985 Ga0065712_100059854 253
165 3300005331 Ga0070670_100062138 Ga0070670_1000621382 253
166 3300005335 Ga0070666_10307060 Ga0070666_103070602 253
167 3300005843 Ga0068860_100268792 Ga0068860_1002687921 253
168 3300009093 Ga0105240_10034277 Ga0105240_100342776 253
169 3300025917 Ga0207660_10090123 Ga0207660_100901232 253
170 3300025925 Ga0207650_10075014 Ga0207650_100750142 253
171 3300046515 Ga0495620_0002353 Ga0495620_0002353_4966_5727 253
172 3300048927 Ga0496124_0210452 Ga0496124_0210452_511_1272 253
173 2162886007 SwRhRL2b_contig_118982 SwRhRL2b_0381.00006610 254
174 3300005289 Ga0065704_10073025 Ga0065704_100730255 254
175 3300005329 Ga0070683_100018973 Ga0070683_1000189732 254
176 3300005331 Ga0070670_100000203 Ga0070670_10000020332 254
177 3300005336 Ga0070680_100009629 Ga0070680_1000096298 254
178 3300005337 Ga0070682_100094466 Ga0070682_1000944662 254
179 3300005356 Ga0070674_100685388 Ga0070674_1006853881 254
180 3300005467 Ga0070706_100182848 Ga0070706_1001828484 254
181 3300005535 Ga0070684_100019669 Ga0070684_1000196696 254
182 3300005536 Ga0070697_100053526 Ga0070697_1000535262 254
183 3300005548 Ga0070665_100002533 Ga0070665_10000253315 254
184 3300005548 Ga0070665_100132267 Ga0070665_1001322672 254
185 3300009011 Ga0105251_10000314 Ga0105251_1000031416 254
186 3300009093 Ga0105240_10117520 Ga0105240_101175202 254
187 3300009545 Ga0105237_10465923 Ga0105237_104659232 254
188 3300010375 Ga0105239_10022939 Ga0105239_100229394 254
189 3300025735 Ga0207713_1000206 Ga0207713_100020632 254
190 3300025906 Ga0207699_10138908 Ga0207699_101389082 254
191 3300025913 Ga0207695_10039660 Ga0207695_100396603 254
192 3300025913 Ga0207695_10058948 Ga0207695_100589482 254
193 3300025925 Ga0207650_10003936 Ga0207650_100039365 254
194 3300028379 Ga0268266_10000309 Ga0268266_1000030941 254
195 3300028379 Ga0268266_10178901 Ga0268266_101789012 254
196 3300046460 Ga0495638_0081993 Ga0495638_0081993_1110_1883 254
197 3300046501 Ga0495607_0050551 Ga0495607_0050551_337_1116 254
198 3300046507 Ga0495606_0015270 Ga0495606_0015270_835_1614 254
199 3300046513 Ga0495616_0014828 Ga0495616_0014828_2139_2912 254
200 3300046660 Ga0495625_0008164 Ga0495625_0008164_4635_5414 254
201 3300047470 Ga0495681_0033852 Ga0495681_0033852_160_933 254
202 3300048920 Ga0496117_0002008 Ga0496117_0002008_616_1380 254
203 3300048921 Ga0496118_0084364 Ga0496118_0084364_965_1729 254
204 3300048922 Ga0496119_0001460 Ga0496119_0001460_26943_27707 254
205 3300048923 Ga0496120_0001455 Ga0496120_0001455_616_1380 254
206 3300048925 Ga0496122_0000671 Ga0496122_0000671_31924_32688 254
207 3300048926 Ga0496123_0000489 Ga0496123_0000489_32006_32770 254
208 3300048927 Ga0496124_0000345 Ga0496124_0000345_52192_52956 254
209 3300049743 Ga0501081_0041620 Ga0501081_0041620_1644_2417 254
210 3300053119 Ga0500595_023524 Ga0500595_023524_1337_2128 254
211 3300053153 Ga0500616_0000193 Ga0500616_0000193_27152_27928 254

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13476

AAA_23

AAA domain

20

101

0.81

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

45

95

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
6zz6-assembly1.cif.gz_B cryo-em structure of s.cerevisiae cohesin-scc2-dna complex 0.7403 143 228
5grb-assembly1.cif.gz_F crystal structure of 2c helicase from enterovirus 71 (ev71) bound with atpgammas 0.7003 40 68
6qpw-assembly1.cif.gz_C structural basis of cohesin ring opening 0.6736 140 228
3kta-assembly1.cif.gz_B structural basis for adenylate kinase activity in abc atpases 0.6716 140 243
4ux3-assembly1.cif.gz_A cohesin smc3-hd:scc1-n complex from yeast 0.6654 149 224
ID Description Score Start End Superfamily
af_O01789_1056_1245_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7253 140 210 3.40.50.300
af_A0A1D8PSI8_961_1228_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7003 140 224 3.40.50.300
af_A4HZD1_1304_1480_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6969 140 224 3.40.50.300
af_Q552D9_986_1194_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6946 140 228 3.40.50.300
af_Q54E85_1145_1339_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.687 140 224 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A150MED9-F1-model_v4 Uncharacterized protein 0.9901 168 250 GO:0005886
GO:0006811
AF-A0A7K0F5U7-F1-model_v4 deleted 0.9875 103 205
AF-A0A561CF16-F1-model_v4 deleted 0.9854 6 250
AF-A0A8B1AX41-F1-model_v4 deleted 0.9834 8 250
AF-A0A1I5SQT2-F1-model_v4 AAA ATPase domain-containing protein 0.9833 164 250 GO:0005886
GO:0006811

Feature Viewer

pLDDT pTM Quality
89.51 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map