F320929

General Info

Members Datasets Scaffolds Average Seq Length
210 157 420 347

Family's Representative Sequence

Representative Sequence 3300050511|nmdc:mga08y16_165680_c1|nmdc:mga08y16_165680_c1_1093_2214
Length 373
Sequence MSLAFTMKKSASRAESPLQHTPRGPGATGEPLERTIAAGEQGDDSRFDRLFRPTSLDEYIGQEQHKNNLRVFIEAARRRKEPLDHILFCGPPGLGKTTLAYIIAREMGVNVHVTSGPAVEHKGALAGLLTKLQPNDVLFIDEIHRLSPTVEESLYPAIEDFKIDITTGDGPYAATYELPIPAFTLVGATTRTGLLTAPLLSRFGYVMRLDFYPVEDLAKIIHRSARMLTTPIDEAGAMELAQRSRGTPRVANRLLRRARDFADIEGSGKIDPAIARLTSERLEIDAAGLDEMDRRLLRTIIDTYEGGPVGVETLAAALSEPRDTIEDVYEPYLLQIGMLGRTPRGRVATRKAYLHLGRQPNDTGTKDSQGSLF

Samples

Sample ID Description Type Environment
1 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
39 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
82 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
87 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
88 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
89 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
90 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
91 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
92 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
93 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
94 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
95 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
96 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
97 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
98 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
99 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
100 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
101 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
102 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
103 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
104 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
105 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
106 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
107 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
108 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
109 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
110 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
111 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
112 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
113 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
114 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
115 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
116 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
117 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
118 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
119 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
120 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
121 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
122 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
123 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
124 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
125 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
126 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
127 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
128 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
129 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
130 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
133 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
134 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
135 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
136 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
137 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
138 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
139 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
140 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
141 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
142 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
143 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
144 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
145 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
146 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
147 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
148 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
149 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
150 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
151 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
152 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
153 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
154 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
155 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
156 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
157 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.05
Nodule 0
Rhizoplane 1.43
Rhizosphere 84.76
Stem 0
Stem Tuber 0
Unclassified 0.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga08y16_165680_c1 3300050511 Bacteria 2296
2 rootH1_10063971 3300003323 Bacteria 7391
3 rootH1_10098451 3300003323 Bacteria 4963
4 Ga0070658_10186640 3300005327 Bacteria 1746
5 Ga0068869_100083916 3300005334 Bacteria 2384
6 Ga0070680_100051924 3300005336 Bacteria 3347
7 Ga0070682_100000310 3300005337 Bacteria 33698
8 Ga0070682_100002619 3300005337 Bacteria 9941
9 Ga0070682_100015140 3300005337 Bacteria 4465
10 Ga0068868_100037135 3300005338 Bacteria 3775
11 Ga0070689_100004541 3300005340 Bacteria 9399
12 Ga0070675_100066314 3300005354 Bacteria 2985
13 Ga0070688_100008861 3300005365 Bacteria 5475
14 Ga0070667_100016099 3300005367 Bacteria 6186
15 Ga0070701_10007342 3300005438 Bacteria 4700
16 Ga0070694_100007431 3300005444 Bacteria 6681
17 Ga0070663_100030448 3300005455 Bacteria 3699
18 Ga0070663_100136978 3300005455 Bacteria 1865
19 Ga0070678_100011423 3300005456 Bacteria 5477
20 Ga0070681_10018239 3300005458 Bacteria 7014
21 Ga0070681_10202390 3300005458 Bacteria 1903
22 Ga0068867_100092881 3300005459 Bacteria 2292
23 Ga0070706_100036214 3300005467 Bacteria 4557
24 Ga0070707_100054121 3300005468 Bacteria 3847
25 Ga0070698_100018824 3300005471 Bacteria 7265
26 Ga0070699_100042118 3300005518 Bacteria 3950
27 Ga0070679_100043702 3300005530 Bacteria 4462
28 Ga0070679_100092075 3300005530 Bacteria 3019
29 Ga0070697_100063467 3300005536 Bacteria 3016
30 Ga0070672_100003366 3300005543 Bacteria 10357
31 Ga0070686_100062398 3300005544 Bacteria 2411
32 Ga0070696_100067556 3300005546 Bacteria 2509
33 Ga0070704_100014874 3300005549 Bacteria 4870
34 Ga0068855_100000554 3300005563 Bacteria 45980
35 Ga0068855_100041856 3300005563 Bacteria 5429
36 Ga0068856_100098690 3300005614 Bacteria 2911
37 Ga0068856_100304331 3300005614 Bacteria 1612
38 Ga0070702_100065953 3300005615 Bacteria 2122
39 Ga0068859_100068902 3300005617 Bacteria 3572
40 Ga0068859_100133254 3300005617 Bacteria 2557
41 Ga0068861_100017261 3300005719 Bacteria 5119
42 Ga0068861_100077293 3300005719 Bacteria 2596
43 Ga0068858_100006110 3300005842 Bacteria 11748
44 Ga0068862_100225704 3300005844 Bacteria 1697
45 Ga0075365_10008081 3300006038 Bacteria 5942
46 Ga0075368_10010468 3300006042 Bacteria 3352
47 Ga0070716_100065736 3300006173 Bacteria 2113
48 Ga0075362_10024807 3300006177 Bacteria 2546
49 Ga0075366_10000427 3300006195 Bacteria 19720
50 Ga0075366_10031723 3300006195 Bacteria 3111
51 Ga0075366_10059419 3300006195 Bacteria 2271
52 Ga0075428_100003840 3300006844 Bacteria 16498
53 Ga0075428_100007219 3300006844 Bacteria 12306
54 Ga0075428_100093170 3300006844 Bacteria 3284
55 Ga0075428_100117383 3300006844 Bacteria 2899
56 Ga0075428_100188563 3300006844 Bacteria 2231
57 Ga0075430_100056014 3300006846 Bacteria 3315
58 Ga0075430_100163649 3300006846 Bacteria 1852
59 Ga0075431_100005275 3300006847 Bacteria 12734
60 Ga0075431_100123920 3300006847 Bacteria 2666
61 Ga0075431_100183046 3300006847 Bacteria 2150
62 Ga0075433_10285128 3300006852 Bacteria 1463
63 Ga0075429_100055844 3300006880 Bacteria 3436
64 Ga0068865_100009287 3300006881 Bacteria 6092
65 Ga0068865_100226578 3300006881 Bacteria 1464
66 Ga0097620_100068897 3300006931 Bacteria 3572
67 Ga0097620_100133247 3300006931 Bacteria 2557
68 Ga0075435_100027077 3300007076 Bacteria 4481
69 Ga0075435_100126267 3300007076 Bacteria 2138
70 Ga0111539_10002445 3300009094 Bacteria 24692
71 Ga0111539_10005494 3300009094 Bacteria 16398
72 Ga0105245_10001985 3300009098 Bacteria 18589
73 Ga0105245_10094608 3300009098 Bacteria 2754
74 Ga0105245_10128015 3300009098 Bacteria 2379
75 Ga0105247_10016872 3300009101 Bacteria 4378
76 Ga0105243_10004026 3300009148 Bacteria 11701
77 Ga0105241_10011687 3300009174 Bacteria 6445
78 Ga0105248_10058909 3300009177 Bacteria 4313
79 Ga0105249_10076050 3300009553 Bacteria 3111
80 Ga0105249_10252364 3300009553 Bacteria 1749
81 Ga0105239_10142184 3300010375 Bacteria 2675
82 Ga0105239_10190848 3300010375 Bacteria 2293
83 Ga0163162_10096988 3300013306 Bacteria 3036
84 Ga0163162_10276466 3300013306 Bacteria 1811
85 Ga0163163_10549261 3300014325 Bacteria 1218
86 Ga0207645_10004256 3300025907 Bacteria 10628
87 Ga0207684_10125950 3300025910 Bacteria 2198
88 Ga0207654_10008583 3300025911 Bacteria 5173
89 Ga0207707_10035362 3300025912 Bacteria 4369
90 Ga0207707_10304709 3300025912 Bacteria 1377
91 Ga0207660_10078205 3300025917 Bacteria 2424
92 Ga0207652_10003163 3300025921 Bacteria 13715
93 Ga0207652_10053055 3300025921 Bacteria 3482
94 Ga0207646_10020426 3300025922 Bacteria 6135
95 Ga0207646_10045382 3300025922 Bacteria 3945
96 Ga0207659_10116024 3300025926 Bacteria 2043
97 Ga0207687_10003125 3300025927 Bacteria 11226
98 Ga0207687_10053835 3300025927 Bacteria 2813
99 Ga0207706_10024617 3300025933 Bacteria 5396
100 Ga0207709_10034308 3300025935 Bacteria 2990
101 Ga0207670_10006669 3300025936 Bacteria 6424
102 Ga0207704_10249789 3300025938 Bacteria 1331
103 Ga0207665_10077083 3300025939 Bacteria 2287
104 Ga0207691_10001307 3300025940 Bacteria 24842
105 Ga0207691_10001436 3300025940 Bacteria 23782
106 Ga0207689_10005329 3300025942 Bacteria 11529
107 Ga0207667_10000744 3300025949 Bacteria 42375
108 Ga0207667_10020358 3300025949 Bacteria 7383
109 Ga0207678_10019114 3300026067 Bacteria 6015
110 Ga0207708_10016470 3300026075 Bacteria 5558
111 Ga0207702_10105426 3300026078 Bacteria 2497
112 Ga0207648_10009024 3300026089 Bacteria 9590
113 Ga0207675_100006982 3300026118 Bacteria 10681
114 Ga0207675_100128449 3300026118 Bacteria 2402
115 Ga0207683_10033782 3300026121 Bacteria 4445
116 Ga0207683_10079104 3300026121 Bacteria 2914
117 Ga0209813_10014095 3300027866 Bacteria 2146
118 Ga0207428_10000741 3300027907 Bacteria 37332
119 Ga0268266_10397200 3300028379 Bacteria 1303
120 Ga0268265_10038595 3300028380 Bacteria 3513
121 Ga0268264_10046998 3300028381 Bacteria 3587
122 Ga0265332_10005481 3300031238 Bacteria 5850
123 Ga0265340_10001807 3300031247 Bacteria 12213
124 Ga0265339_10000200 3300031249 Bacteria 49204
125 Ga0265331_10012674 3300031250 Bacteria 4559
126 Ga0265316_10000279 3300031344 Bacteria 57458
127 Ga0307513_10008890 3300031456 Bacteria 12774
128 Ga0307508_10002385 3300031616 Bacteria 19865
129 Ga0316579_10031122 3300031691 Bacteria 2441
130 Ga0265314_10000001 3300031711 Bacteria 3792860
131 Ga0316576_10010568 3300031727 Bacteria 6006
132 Ga0316576_10039401 3300031727 Bacteria 3392
133 Ga0316576_10068968 3300031727 Bacteria 2607
134 Ga0316576_10083670 3300031727 Bacteria 2371
135 Ga0316578_10005055 3300031728 Bacteria 6340
136 Ga0307516_10005003 3300031730 Bacteria 16080
137 Ga0307406_10082896 3300031901 Bacteria 2137
138 Ga0307409_100079479 3300031995 Bacteria 2643
139 Ga0307414_10084775 3300032004 Bacteria 2332
140 Ga0307411_10001506 3300032005 Bacteria 9584
141 Ga0307411_10068548 3300032005 Bacteria 2392
142 Ga0316583_10015415 3300032133 Bacteria 2750
143 Ga0316583_10022408 3300032133 Bacteria 2261
144 Ga0307507_10082061 3300033179 Bacteria 2830
145 Ga0373927_0006184 3300035695 Bacteria 8180
146 Ga0373933_0028140 3300035724 Bacteria 3241
147 Ga0373937_0401148 3300036401 Bacteria 1301
148 Ga0316584_0111003 3300036712 Bacteria 2052
149 Ga0316584_0215804 3300036712 Bacteria 1411
150 Ga0400489_54868 3300039093 Bacteria 3805
151 Ga0436361_0845906 3300039447 Bacteria 2586
152 Ga0451791_1540632 3300041451 Bacteria 1947
153 Ga0451797_0343014 3300041453 Bacteria 2931
154 Ga0451851_0170619 3300041507 Bacteria 2599
155 Ga0451843_0681365 3300041509 Bacteria 1502
156 Ga0451853_0865388 3300041512 Bacteria 10798
157 Ga0439445_0016137 3300042004 Bacteria 1835
158 Ga0439435_0035099 3300042436 Bacteria 1381
159 Ga0453683_0059774 3300044673 Bacteria 2382
160 Ga0466959_0256230 3300045049 Bacteria 1206
161 Ga0451576_0089625 3300045051 Bacteria 3199
162 Ga0451576_0436017 3300045051 Bacteria 1375
163 Ga0495629_0097791 3300046459 Bacteria 2048
164 Ga0495651_0121537 3300046462 Bacteria 1918
165 Ga0495628_0226705 3300046516 Bacteria 1402
166 Ga0495669_0026484 3300046684 Bacteria 2534
167 Ga0495613_0042180 3300046689 Bacteria 3377
168 Ga0495604_0076148 3300047317 Bacteria 2524
169 Ga0495674_0134796 3300047319 Bacteria 2079
170 Ga0495672_0114319 3300047320 Bacteria 1444
171 Ga0495602_0047269 3300048088 Bacteria 3879
172 Ga0496112_0028645 3300048915 Bacteria 5378
173 Ga0501034_0281921 3300049571 Bacteria 1601
174 Ga0501047_0229428 3300049581 Bacteria 1711
175 Ga0501067_0002772 3300049583 Bacteria 9646
176 Ga0501068_0309065 3300049584 Bacteria 1012
177 Ga0501071_0117375 3300049587 Bacteria 1970
178 Ga0501071_0236804 3300049587 Bacteria 1376
179 Ga0501073_0011309 3300049589 Bacteria 6530
180 Ga0501073_0165519 3300049589 Bacteria 1531
181 Ga0501074_0012817 3300049590 Bacteria 6095
182 Ga0501076_0009009 3300049592 Bacteria 7349
183 Ga0501080_0141859 3300049742 Bacteria 2221
184 Ga0501083_0008782 3300049744 Bacteria 7132
185 Ga0501083_0061661 3300049744 Unclassified 2503
186 Ga0501083_0289108 3300049744 Bacteria 1066
187 Ga0501035_0063276 3300049822 Bacteria 3291
188 nmdc:mga03683_41545_c1 3300050489 Bacteria 1889
189 nmdc:mga0yw44_2125_c1 3300050492 Unclassified 8308
190 nmdc:mga0yw44_41141_c1 3300050492 Bacteria 2749
191 nmdc:mga0yw44_5675_c1 3300050492 Bacteria 5940
192 nmdc:mga0k408_218_c1 3300050493 Bacteria 30681
193 nmdc:mga0k408_85043_c1 3300050493 Bacteria 1856
194 nmdc:mga06z11_8388_c1 3300050494 Bacteria 4306
195 nmdc:mga04h51_5503_c1 3300050495 Bacteria 3232
196 nmdc:mga09592_36065_c1 3300050508 Bacteria 4142
197 nmdc:mga0qj67_68912_c1 3300050509 Bacteria 2820
198 nmdc:mga06r32_120382_c1 3300050510 Bacteria 2589
199 nmdc:mga06r32_4917_c1 3300050510 Bacteria 12037
200 nmdc:mga08y16_1365_c1 3300050511 Bacteria 24387
201 nmdc:mga08y16_2339_c1 3300050511 Bacteria 19433
202 nmdc:mga0n895_251239_c1 3300050512 Bacteria 1794
203 nmdc:mga0rr50_80619_c1 3300050513 Bacteria 2510
204 nmdc:mga0a205_157403_c1 3300050515 Bacteria 2170
205 nmdc:mga0sz30_12705_c1 3300050516 Bacteria 3280
206 Ga0495619_0131854 3300053085 Bacteria 1718
207 Ga0500556_0000141 3300053104 Bacteria 59919
208 Ga0500562_000480 3300053108 Bacteria 9674
209 Ga0500559_0000786 3300053136 Bacteria 20757
210 Ga0590071_010144 3300059421 Bacteria 2206
211 nmdc:mga08y16_165680_c1
212 rootH1_10063971
213 rootH1_10098451
214 Ga0070658_10186640
215 Ga0068869_100083916
216 Ga0070680_100051924
217 Ga0070682_100000310
218 Ga0070682_100002619
219 Ga0070682_100015140
220 Ga0068868_100037135
221 Ga0070689_100004541
222 Ga0070675_100066314
223 Ga0070688_100008861
224 Ga0070667_100016099
225 Ga0070701_10007342
226 Ga0070694_100007431
227 Ga0070663_100030448
228 Ga0070663_100136978
229 Ga0070678_100011423
230 Ga0070681_10018239
231 Ga0070681_10202390
232 Ga0068867_100092881
233 Ga0070706_100036214
234 Ga0070707_100054121
235 Ga0070698_100018824
236 Ga0070699_100042118
237 Ga0070679_100043702
238 Ga0070679_100092075
239 Ga0070697_100063467
240 Ga0070672_100003366
241 Ga0070686_100062398
242 Ga0070696_100067556
243 Ga0070704_100014874
244 Ga0068855_100000554
245 Ga0068855_100041856
246 Ga0068856_100098690
247 Ga0068856_100304331
248 Ga0070702_100065953
249 Ga0068859_100068902
250 Ga0068859_100133254
251 Ga0068861_100017261
252 Ga0068861_100077293
253 Ga0068858_100006110
254 Ga0068862_100225704
255 Ga0075365_10008081
256 Ga0075368_10010468
257 Ga0070716_100065736
258 Ga0075362_10024807
259 Ga0075366_10000427
260 Ga0075366_10031723
261 Ga0075366_10059419
262 Ga0075428_100003840
263 Ga0075428_100007219
264 Ga0075428_100093170
265 Ga0075428_100117383
266 Ga0075428_100188563
267 Ga0075430_100056014
268 Ga0075430_100163649
269 Ga0075431_100005275
270 Ga0075431_100123920
271 Ga0075431_100183046
272 Ga0075433_10285128
273 Ga0075429_100055844
274 Ga0068865_100009287
275 Ga0068865_100226578
276 Ga0097620_100068897
277 Ga0097620_100133247
278 Ga0075435_100027077
279 Ga0075435_100126267
280 Ga0111539_10002445
281 Ga0111539_10005494
282 Ga0105245_10001985
283 Ga0105245_10094608
284 Ga0105245_10128015
285 Ga0105247_10016872
286 Ga0105243_10004026
287 Ga0105241_10011687
288 Ga0105248_10058909
289 Ga0105249_10076050
290 Ga0105249_10252364
291 Ga0105239_10142184
292 Ga0105239_10190848
293 Ga0163162_10096988
294 Ga0163162_10276466
295 Ga0163163_10549261
296 Ga0207645_10004256
297 Ga0207684_10125950
298 Ga0207654_10008583
299 Ga0207707_10035362
300 Ga0207707_10304709
301 Ga0207660_10078205
302 Ga0207652_10003163
303 Ga0207652_10053055
304 Ga0207646_10020426
305 Ga0207646_10045382
306 Ga0207659_10116024
307 Ga0207687_10003125
308 Ga0207687_10053835
309 Ga0207706_10024617
310 Ga0207709_10034308
311 Ga0207670_10006669
312 Ga0207704_10249789
313 Ga0207665_10077083
314 Ga0207691_10001307
315 Ga0207691_10001436
316 Ga0207689_10005329
317 Ga0207667_10000744
318 Ga0207667_10020358
319 Ga0207678_10019114
320 Ga0207708_10016470
321 Ga0207702_10105426
322 Ga0207648_10009024
323 Ga0207675_100006982
324 Ga0207675_100128449
325 Ga0207683_10033782
326 Ga0207683_10079104
327 Ga0209813_10014095
328 Ga0207428_10000741
329 Ga0268266_10397200
330 Ga0268265_10038595
331 Ga0268264_10046998
332 Ga0265332_10005481
333 Ga0265340_10001807
334 Ga0265339_10000200
335 Ga0265331_10012674
336 Ga0265316_10000279
337 Ga0307513_10008890
338 Ga0307508_10002385
339 Ga0316579_10031122
340 Ga0265314_10000001
341 Ga0316576_10010568
342 Ga0316576_10039401
343 Ga0316576_10068968
344 Ga0316576_10083670
345 Ga0316578_10005055
346 Ga0307516_10005003
347 Ga0307406_10082896
348 Ga0307409_100079479
349 Ga0307414_10084775
350 Ga0307411_10001506
351 Ga0307411_10068548
352 Ga0316583_10015415
353 Ga0316583_10022408
354 Ga0307507_10082061
355 Ga0373927_0006184
356 Ga0373933_0028140
357 Ga0373937_0401148
358 Ga0316584_0111003
359 Ga0316584_0215804
360 Ga0400489_54868
361 Ga0436361_0845906
362 Ga0451791_1540632
363 Ga0451797_0343014
364 Ga0451851_0170619
365 Ga0451843_0681365
366 Ga0451853_0865388
367 Ga0439445_0016137
368 Ga0439435_0035099
369 Ga0453683_0059774
370 Ga0466959_0256230
371 Ga0451576_0089625
372 Ga0451576_0436017
373 Ga0495629_0097791
374 Ga0495651_0121537
375 Ga0495628_0226705
376 Ga0495669_0026484
377 Ga0495613_0042180
378 Ga0495604_0076148
379 Ga0495674_0134796
380 Ga0495672_0114319
381 Ga0495602_0047269
382 Ga0496112_0028645
383 Ga0501034_0281921
384 Ga0501047_0229428
385 Ga0501067_0002772
386 Ga0501068_0309065
387 Ga0501071_0117375
388 Ga0501071_0236804
389 Ga0501073_0011309
390 Ga0501073_0165519
391 Ga0501074_0012817
392 Ga0501076_0009009
393 Ga0501080_0141859
394 Ga0501083_0008782
395 Ga0501083_0061661
396 Ga0501083_0289108
397 Ga0501035_0063276
398 nmdc:mga03683_41545_c1
399 nmdc:mga0yw44_2125_c1
400 nmdc:mga0yw44_41141_c1
401 nmdc:mga0yw44_5675_c1
402 nmdc:mga0k408_218_c1
403 nmdc:mga0k408_85043_c1
404 nmdc:mga06z11_8388_c1
405 nmdc:mga04h51_5503_c1
406 nmdc:mga09592_36065_c1
407 nmdc:mga0qj67_68912_c1
408 nmdc:mga06r32_120382_c1
409 nmdc:mga06r32_4917_c1
410 nmdc:mga08y16_1365_c1
411 nmdc:mga08y16_2339_c1
412 nmdc:mga0n895_251239_c1
413 nmdc:mga0rr50_80619_c1
414 nmdc:mga0a205_157403_c1
415 nmdc:mga0sz30_12705_c1
416 Ga0495619_0131854
417 Ga0500556_0000141
418 Ga0500562_000480
419 Ga0500559_0000786
420 Ga0590071_010144

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05496

RuvB_N

Holliday junction DNA helicase RuvB P-loop domain

51

209

0.99

PF17864

AAA_lid_4

RuvB AAA lid domain

212

285

0.99

PF05491

RuvB_C

RuvB C-terminal winged helix domain

286

357

0.98

PF00004

AAA

ATPase family associated with various cellular activities (AAA)

86

211

0.94

PF07728

AAA_5

AAA domain (dynein-related subfamily)

85

203

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1in6-assembly1.cif.gz_A thermotoga maritima ruvb k64r mutant 0.9857 43 340
7x5b-assembly1.cif.gz_A crystal structure of ruvb 0.982 43 344
1in7-assembly1.cif.gz_A thermotoga maritima ruvb r170a 0.9811 43 340
1in8-assembly1.cif.gz_A thermotoga maritima ruvb t158v 0.981 42 340
1in4-assembly1.cif.gz_A thermotoga maritima ruvb holliday junction branch migration motor 0.9808 42 340
ID Description Score Start End Superfamily
1in5A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1.004 267 338 1.10.10.10
6blbA02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9978 191 265 1.10.8.60
6blbA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9867 44 190 3.40.50.300
1in5A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.977 267 338 1.10.10.10
6blbA03 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9743 267 344 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A661LGM7-F1-model_v4 Holliday junction branch migration DNA helicase RuvB 1.001 261 338 GO:0003677
GO:0005524
GO:0006281
GO:0006310
GO:0009378
AF-K1U1E2-F1-model_v4 Holliday junction DNA helicase RuvB 0.9984 268 338 GO:0003677
GO:0005524
GO:0006281
GO:0006310
GO:0009378
AF-A0A382UN28-F1-model_v4 AAA+ ATPase domain-containing protein 0.9958 43 320 GO:0003677
GO:0005524
GO:0005737
GO:0006281
GO:0006310
GO:0009378
GO:0016887
AF-A0A351T2V6-F1-model_v4 Holliday junction branch migration DNA helicase RuvB 0.9955 43 155 GO:0003677
GO:0005524
GO:0006281
GO:0006310
GO:0009378
GO:0016887
AF-A0A382DYP5-F1-model_v4 AAA+ ATPase domain-containing protein 0.995 33 241 GO:0003677
GO:0005524
GO:0006281
GO:0006310
GO:0009378
GO:0016887

Map