F320333

General Info

Members Datasets Scaffolds Average Seq Length
210 173 420 224

Family's Representative Sequence

Representative Sequence 3300011119|Ga0105246_10258341|Ga0105246_102583412
Length 255
Sequence MSIRIWKMMVRQNKPAIRQPRGRPQIRPDEETRQLVIAAAHQEFLAKGYAGASMVGVAERAGVSTKTMYRLIPTKADLFRSVVSDRISRFMLDIDAEALDALPLDKALERMLAAYGTLTLDEESIAIQRLVFGESDRFPEIAASFYDLAIRGTSEAMQGWLRRQCDRGLIAIEDLAAATGMLRGMMIMEPQRAVMLGQRPAPDADEIETRARYCARIFLEGCRRRTERPLLGHYRQRMTNEPGESNGNKGAQVGR

Samples

Sample ID Description Type Environment
1 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
2 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
38 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
51 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
52 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
53 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
54 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
55 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
56 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
57 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
80 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
81 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
82 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
84 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
85 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
86 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
87 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
88 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
89 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
90 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
91 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
94 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
95 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
96 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
97 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
98 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
99 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
100 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
101 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
102 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
103 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
104 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
105 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
106 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
107 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
108 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
109 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
110 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
111 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
112 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
113 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
114 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
115 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
116 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
117 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
118 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
119 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
120 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
121 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
122 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
123 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
124 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
125 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
126 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
127 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
128 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
129 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
130 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
131 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
132 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
133 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
134 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
135 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
136 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
137 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
138 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
139 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
140 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
141 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
142 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
143 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
144 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
145 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
146 2904699407
147 2906610324
148 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
149 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
150 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
151 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
152 2909042592 Labrys sp. LIt4 Isolate Nodule
153 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
154 2922425934
155 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
156 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
157 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
158 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
159 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
160 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
161 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
162 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
163 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
164 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
165 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
166 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
167 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
168 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
169 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
170 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
171 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
172 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
173 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 78.26
Metatranscriptomes 1.45
Isolates 20.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.48
Nodule 20.95
Rhizoplane 4.29
Rhizosphere 55.24
Stem 0
Stem Tuber 0
Unclassified 5.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105246_10258341 3300011119 Bacteria 1386
2 Ga0006759J45824_1010861 3300003163 Bacteria 2218
3 Ga0007429J51699_1020345 3300003579 Bacteria 2064
4 Ga0032354_1020710 3300003693 Bacteria 2130
5 Ga0070683_100470291 3300005329 Bacteria 1200
6 Ga0070683_100498762 3300005329 Bacteria 1163
7 Ga0070680_100005136 3300005336 Bacteria 9892
8 Ga0070682_100005768 3300005337 Bacteria 6909
9 Ga0070660_100323127 3300005339 Bacteria 1268
10 Ga0070689_100098182 3300005340 Bacteria 2316
11 Ga0070668_100015590 3300005347 Bacteria 5680
12 Ga0070669_100566439 3300005353 Bacteria 949
13 Ga0070659_100004097 3300005366 Bacteria 10387
14 Ga0070713_100081733 3300005436 Bacteria 2757
15 Ga0070713_101153530 3300005436 Bacteria 749
16 Ga0070705_100016146 3300005440 Unclassified 3875
17 Ga0070700_100021391 3300005441 Bacteria 3760
18 Ga0070694_100469072 3300005444 Unclassified 997
19 Ga0070708_100313348 3300005445 Bacteria 1478
20 Ga0070663_100006206 3300005455 Bacteria 7164
21 Ga0070681_10058287 3300005458 Bacteria 3842
22 Ga0070707_100058236 3300005468 Bacteria 3706
23 Ga0070679_100010826 3300005530 Bacteria 8665
24 Ga0070679_100249554 3300005530 Bacteria 1731
25 Ga0068853_100049448 3300005539 Bacteria 3613
26 Ga0070696_100002950 3300005546 Bacteria 11305
27 Ga0070693_100058026 3300005547 Bacteria 2239
28 Ga0070665_100001790 3300005548 Bacteria 24438
29 Ga0070665_100197653 3300005548 Bacteria 2012
30 Ga0070665_100287922 3300005548 Bacteria 1645
31 Ga0070704_100201186 3300005549 Unclassified 1608
32 Ga0070664_100606400 3300005564 Bacteria 1015
33 Ga0068857_100052755 3300005577 Unclassified 3607
34 Ga0068859_100492776 3300005617 Bacteria 1321
35 Ga0068861_100419266 3300005719 Bacteria 1192
36 Ga0068870_10118452 3300005840 Bacteria 1522
37 Ga0068858_100248279 3300005842 Bacteria 1690
38 Ga0070717_10622038 3300006028 Bacteria 980
39 Ga0075365_10241086 3300006038 Bacteria 1270
40 Ga0097621_100422009 3300006237 Bacteria 1197
41 Ga0097620_100492825 3300006931 Bacteria 1321
42 Ga0099824_1006573 3300006942 Bacteria 15879
43 Ga0099822_1011838 3300006943 Bacteria 10559
44 Ga0105245_10476188 3300009098 Bacteria 1261
45 Ga0105245_10636819 3300009098 Bacteria 1095
46 Ga0105247_10147761 3300009101 Bacteria 1546
47 Ga0105243_10034088 3300009148 Bacteria 3939
48 Ga0105237_10406341 3300009545 Bacteria 1366
49 Ga0105238_10025959 3300009551 Bacteria 5972
50 Ga0105238_10028872 3300009551 Bacteria 5649
51 Ga0105238_10456003 3300009551 Unclassified 1276
52 Ga0105239_10653938 3300010375 Bacteria 1201
53 Ga0157370_10062906 3300013104 Bacteria 3518
54 Ga0157369_10324639 3300013105 Bacteria 1600
55 Ga0163162_10336974 3300013306 Bacteria 1641
56 Ga0157375_10172214 3300013308 Unclassified 2313
57 Ga0163163_10968909 3300014325 Bacteria 914
58 Ga0157379_10079493 3300014968 Bacteria 2936
59 Ga0157376_10112754 3300014969 Bacteria 2396
60 Ga0214542_1015864 3300021321 Bacteria 7610
61 Ga0214543_1001580 3300021327 Bacteria 44273
62 Ga0213872_10005488 3300021361 Bacteria 6518
63 Ga0213872_10007953 3300021361 Bacteria 5167
64 Ga0213872_10023718 3300021361 Bacteria 2822
65 Ga0213872_10046518 3300021361 Bacteria 1975
66 Ga0213872_10100563 3300021361 Bacteria 1290
67 Ga0213872_10177181 3300021361 Bacteria 922
68 Ga0213875_10146988 3300021388 Bacteria 1104
69 Ga0209233_1007781 3300025261 Bacteria 3367
70 Ga0207688_10025757 3300025901 Bacteria 3233
71 Ga0207699_10141065 3300025906 Bacteria 1584
72 Ga0207654_10054472 3300025911 Bacteria 2312
73 Ga0207707_10266736 3300025912 Bacteria 1484
74 Ga0207707_10624377 3300025912 Bacteria 910
75 Ga0207671_10195747 3300025914 Bacteria 1577
76 Ga0207660_10065849 3300025917 Bacteria 2619
77 Ga0207657_10287842 3300025919 Bacteria 1303
78 Ga0207652_10377182 3300025921 Unclassified 1280
79 Ga0207694_10251064 3300025924 Unclassified 1447
80 Ga0207687_10333963 3300025927 Bacteria 1230
81 Ga0207700_10050032 3300025928 Bacteria 3112
82 Ga0207690_10194448 3300025932 Bacteria 1536
83 Ga0207706_10153256 3300025933 Bacteria 2027
84 Ga0207670_10352630 3300025936 Bacteria 1166
85 Ga0207661_10421811 3300025944 Bacteria 1212
86 Ga0207679_10387120 3300025945 Bacteria 1227
87 Ga0207668_10051345 3300025972 Bacteria 2848
88 Ga0207668_10431444 3300025972 Bacteria 1121
89 Ga0207640_10296638 3300025981 Bacteria 1277
90 Ga0207678_10003899 3300026067 Bacteria 13416
91 Ga0207674_10038599 3300026116 Bacteria 4953
92 Ga0207675_100247052 3300026118 Bacteria 1726
93 Ga0207683_10019342 3300026121 Bacteria 5815
94 Ga0209589_1000001 3300027357 Bacteria 794224
95 Ga0209489_100001 3300027361 Bacteria 794224
96 Ga0209700_100001 3300027363 Bacteria 794224
97 Ga0268266_10002717 3300028379 Bacteria 18550
98 Ga0268266_10514114 3300028379 Bacteria 1144
99 Ga0265328_10057162 3300031239 Bacteria 1432
100 Ga0265314_10141099 3300031711 Bacteria 1489
101 Ga0315911_1000002 3300033442 Bacteria 926833
102 Ga0373936_0143103 3300035113 Bacteria 1033
103 Ga0373935_0502862 3300035692 Bacteria 880
104 Ga0373947_0355166 3300035725 Bacteria 984
105 Ga0373925_0045290 3300037068 Bacteria 3268
106 Ga0395900_0189660 3300037418 Bacteria 2086
107 Ga0436364_0341479 3300037853 Bacteria 1391
108 Ga0436364_0682029 3300037853 Bacteria 748
109 Ga0395901_0067346 3300038443 Bacteria 3729
110 Ga0436360_0325212 3300039438 Bacteria 1309
111 Ga0436360_0496785 3300039438 Unclassified 1931
112 Ga0436360_0578266 3300039438 Bacteria 1073
113 Ga0436360_0811146 3300039438 Bacteria 1023
114 Ga0436360_0880116 3300039438 Unclassified 910
115 Ga0436360_0889181 3300039438 Bacteria 961
116 Ga0436360_1086907 3300039438 Bacteria 4334
117 Ga0436361_0017635 3300039447 Bacteria 7676
118 Ga0436361_0091951 3300039447 Bacteria 10819
119 Ga0436361_0227086 3300039447 Bacteria 1521
120 Ga0436361_0442566 3300039447 Bacteria 3637
121 Ga0436361_0576316 3300039447 Bacteria 2968
122 Ga0436361_0725040 3300039447 Bacteria 5332
123 Ga0436361_0778615 3300039447 Bacteria 4878
124 Ga0436363_0026836 3300039450 Bacteria 1078
125 Ga0436363_0028663 3300039450 Bacteria 693
126 Ga0436363_0295063 3300039450 Bacteria 1239
127 Ga0436363_0404376 3300039450 Unclassified 4341
128 Ga0436363_0435627 3300039450 Bacteria 902
129 Ga0436363_1464877 3300039450 Bacteria 1058
130 Ga0436362_0716510 3300039453 Bacteria 4487
131 Ga0495664_0173771 3300046477 Bacteria 1307
132 Ga0495645_0220054 3300046543 Bacteria 1277
133 Ga0495675_0413407 3300047444 Bacteria 785
134 Ga0496101_0007657 3300048904 Bacteria 7012
135 Ga0496102_0769338 3300048905 Bacteria 885
136 Ga0496103_0092626 3300048906 Bacteria 1907
137 Ga0496104_0050247 3300048907 Bacteria 3935
138 Ga0496106_0002865 3300048909 Bacteria 12808
139 Ga0496106_0295813 3300048909 Bacteria 1298
140 Ga0496112_0101021 3300048915 Bacteria 2854
141 Ga0496115_0003860 3300048918 Bacteria 10805
142 Ga0496126_0027042 3300048929 Bacteria 5489
143 Ga0496126_0241226 3300048929 Bacteria 1510
144 nmdc:mga0yw44_46923_c1 3300050492 Bacteria 2597
145 Ga0495601_0117562 3300053077 Bacteria 1725
146 Ga0495612_0221394 3300053078 Bacteria 838
147 Ga0500647_0026516 3300053091 Bacteria 2733
148 Ga0500566_0000506 3300053094 Bacteria 21763
149 Ga0500640_001077 3300053095 Bacteria 7864
150 Ga0500556_0000034 3300053104 Bacteria 145623
151 Ga0500572_000407 3300053111 Bacteria 15119
152 Ga0500591_041929 3300053115 Bacteria 2174
153 Ga0500595_005902 3300053119 Bacteria 5273
154 Ga0500608_005371 3300053122 Bacteria 5085
155 Ga0500614_000663 3300053123 Bacteria 8777
156 Ga0500559_0027822 3300053136 Bacteria 2413
157 Ga0500590_135020 3300053148 Bacteria 1136
158 Ga0500603_000046 3300053150 Bacteria 30040
159 Ga0500616_0245920 3300053153 Bacteria 766
160 Ga0500627_0052671 3300053158 Bacteria 1777
161 Ga0500630_013737 3300053159 Bacteria 3987
162 Ga0500638_016522 3300053162 Bacteria 3408
163 Ga0500639_000085 3300053163 Bacteria 44045
164 Ga0500639_088218 3300053163 Bacteria 1550
165 Ga0500637_0106225 3300053178 Bacteria 1628
166 2513653782 2513237096 Bacteria 8722461
167 2513856219 2513237137 Bacteria 9558895
168 2513918122 2513237145 Bacteria 8979722
169 2517891641 2517572143 Bacteria 9484767
170 2524536759 2524023228 Bacteria 10118060
171 2671118589 2667528175 Bacteria 7532676
172 2728749398 2728368998 Bacteria 8720350
173 2793067005 2791355197 Bacteria 8420563
174 2838074842 2838074704 Bacteria 6785777
175 2871501113 2871495908 Bacteria 6935695
176 2878765115 2878760144 Bacteria 6823465
177 2878772297 2878767105 Bacteria 6898628
178 2885378546 2885374607 Bacteria 8927485
179 2888354444 2888350351 Bacteria 7372807
180 2903545927 2903540706 Bacteria 7062119
181 2903753223 2903748898 Bacteria 9972761
182 2904697835 2904690495 Bacteria 9412302
183 2904704629
184 2906616814
185 2906642853 2906635258 Bacteria 8601019
186 2906667142 2906660503 Bacteria 8595048
187 2908741992 2908739725 Bacteria 8628932
188 2908759659 2908756301 Bacteria 8864324
189 2909047677 2909042592 Bacteria 6499737
190 2922131697 2922130491 Bacteria 7173936
191 2922431124
192 2935633765 2935630451 Bacteria 8169952
193 2937999783 2937994558 Bacteria 7036190
194 2941510932 2941507105 Bacteria 8166816
195 2941518316 2941515067 Bacteria 8166720
196 2941526813 2941523033 Bacteria 8169134
197 2958170248 2958165035 Bacteria 6906348
198 2961168700 2961163497 Bacteria 6901077
199 2965023502 2965018300 Bacteria 6883036
200 2968177112 2968171901 Bacteria 6894245
201 2970559962 2970554993 Bacteria 6814252
202 2979745310 2979742915 Bacteria 7301278
203 2987664731 2987659509 Bacteria 6966464
204 3004193788 3004188549 Bacteria 6952365
205 3005480943 3005474847 Bacteria 9259049
206 8006939770 8006933436 Bacteria 10410654
207 8006979538 8006973647 Bacteria 10679141
208 8019565674 8019555841 Bacteria 9642137
209 8019575764 8019565922 Bacteria 9639779
210 8056692588 8056689827 Bacteria 6712655
211 Ga0105246_10258341
212 Ga0006759J45824_1010861
213 Ga0007429J51699_1020345
214 Ga0032354_1020710
215 Ga0070683_100470291
216 Ga0070683_100498762
217 Ga0070680_100005136
218 Ga0070682_100005768
219 Ga0070660_100323127
220 Ga0070689_100098182
221 Ga0070668_100015590
222 Ga0070669_100566439
223 Ga0070659_100004097
224 Ga0070713_100081733
225 Ga0070713_101153530
226 Ga0070705_100016146
227 Ga0070700_100021391
228 Ga0070694_100469072
229 Ga0070708_100313348
230 Ga0070663_100006206
231 Ga0070681_10058287
232 Ga0070707_100058236
233 Ga0070679_100010826
234 Ga0070679_100249554
235 Ga0068853_100049448
236 Ga0070696_100002950
237 Ga0070693_100058026
238 Ga0070665_100001790
239 Ga0070665_100197653
240 Ga0070665_100287922
241 Ga0070704_100201186
242 Ga0070664_100606400
243 Ga0068857_100052755
244 Ga0068859_100492776
245 Ga0068861_100419266
246 Ga0068870_10118452
247 Ga0068858_100248279
248 Ga0070717_10622038
249 Ga0075365_10241086
250 Ga0097621_100422009
251 Ga0097620_100492825
252 Ga0099824_1006573
253 Ga0099822_1011838
254 Ga0105245_10476188
255 Ga0105245_10636819
256 Ga0105247_10147761
257 Ga0105243_10034088
258 Ga0105237_10406341
259 Ga0105238_10025959
260 Ga0105238_10028872
261 Ga0105238_10456003
262 Ga0105239_10653938
263 Ga0157370_10062906
264 Ga0157369_10324639
265 Ga0163162_10336974
266 Ga0157375_10172214
267 Ga0163163_10968909
268 Ga0157379_10079493
269 Ga0157376_10112754
270 Ga0214542_1015864
271 Ga0214543_1001580
272 Ga0213872_10005488
273 Ga0213872_10007953
274 Ga0213872_10023718
275 Ga0213872_10046518
276 Ga0213872_10100563
277 Ga0213872_10177181
278 Ga0213875_10146988
279 Ga0209233_1007781
280 Ga0207688_10025757
281 Ga0207699_10141065
282 Ga0207654_10054472
283 Ga0207707_10266736
284 Ga0207707_10624377
285 Ga0207671_10195747
286 Ga0207660_10065849
287 Ga0207657_10287842
288 Ga0207652_10377182
289 Ga0207694_10251064
290 Ga0207687_10333963
291 Ga0207700_10050032
292 Ga0207690_10194448
293 Ga0207706_10153256
294 Ga0207670_10352630
295 Ga0207661_10421811
296 Ga0207679_10387120
297 Ga0207668_10051345
298 Ga0207668_10431444
299 Ga0207640_10296638
300 Ga0207678_10003899
301 Ga0207674_10038599
302 Ga0207675_100247052
303 Ga0207683_10019342
304 Ga0209589_1000001
305 Ga0209489_100001
306 Ga0209700_100001
307 Ga0268266_10002717
308 Ga0268266_10514114
309 Ga0265328_10057162
310 Ga0265314_10141099
311 Ga0315911_1000002
312 Ga0373936_0143103
313 Ga0373935_0502862
314 Ga0373947_0355166
315 Ga0373925_0045290
316 Ga0395900_0189660
317 Ga0436364_0341479
318 Ga0436364_0682029
319 Ga0395901_0067346
320 Ga0436360_0325212
321 Ga0436360_0496785
322 Ga0436360_0578266
323 Ga0436360_0811146
324 Ga0436360_0880116
325 Ga0436360_0889181
326 Ga0436360_1086907
327 Ga0436361_0017635
328 Ga0436361_0091951
329 Ga0436361_0227086
330 Ga0436361_0442566
331 Ga0436361_0576316
332 Ga0436361_0725040
333 Ga0436361_0778615
334 Ga0436363_0026836
335 Ga0436363_0028663
336 Ga0436363_0295063
337 Ga0436363_0404376
338 Ga0436363_0435627
339 Ga0436363_1464877
340 Ga0436362_0716510
341 Ga0495664_0173771
342 Ga0495645_0220054
343 Ga0495675_0413407
344 Ga0496101_0007657
345 Ga0496102_0769338
346 Ga0496103_0092626
347 Ga0496104_0050247
348 Ga0496106_0002865
349 Ga0496106_0295813
350 Ga0496112_0101021
351 Ga0496115_0003860
352 Ga0496126_0027042
353 Ga0496126_0241226
354 nmdc:mga0yw44_46923_c1
355 Ga0495601_0117562
356 Ga0495612_0221394
357 Ga0500647_0026516
358 Ga0500566_0000506
359 Ga0500640_001077
360 Ga0500556_0000034
361 Ga0500572_000407
362 Ga0500591_041929
363 Ga0500595_005902
364 Ga0500608_005371
365 Ga0500614_000663
366 Ga0500559_0027822
367 Ga0500590_135020
368 Ga0500603_000046
369 Ga0500616_0245920
370 Ga0500627_0052671
371 Ga0500630_013737
372 Ga0500638_016522
373 Ga0500639_000085
374 Ga0500639_088218
375 Ga0500637_0106225
376 2513653782
377 2513856219
378 2513918122
379 2517891641
380 2524536759
381 2671118589
382 2728749398
383 2793067005
384 2838074842
385 2871501113
386 2878765115
387 2878772297
388 2885378546
389 2888354444
390 2903545927
391 2903753223
392 2904697835
393 2904704629
394 2906616814
395 2906642853
396 2906667142
397 2908741992
398 2908759659
399 2909047677
400 2922131697
401 2922431124
402 2935633765
403 2937999783
404 2941510932
405 2941518316
406 2941526813
407 2958170248
408 2961168700
409 2965023502
410 2968177112
411 2970559962
412 2979745310
413 2987664731
414 3004193788
415 3005480943
416 8006939770
417 8006979538
418 8019565674
419 8019575764
420 8056692588

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14246

TetR_C_7

AefR-like transcriptional repressor, C-terminal domain

106

221

0.98

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

36

82

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cwr-assembly3.cif.gz_B crystal structure of transcriptional regulator of tetr family (yp_425770.1) from rhodospirillum rubrum atcc 11170 at 1.50 a resolution 0.8704 18 209
3bhq-assembly1.cif.gz_B crystal structure of a putative tetr-family transcriptional regulator (mlr_4833) from mesorhizobium loti maff303099 at 1.54 a resolution 0.8691 18 214
3cwr-assembly2.cif.gz_A crystal structure of transcriptional regulator of tetr family (yp_425770.1) from rhodospirillum rubrum atcc 11170 at 1.50 a resolution 0.8606 16 209
3cwr-assembly3.cif.gz_B crystal structure of transcriptional regulator of tetr family (yp_425770.1) from rhodospirillum rubrum atcc 11170 at 1.50 a resolution 0.8579 18 209
3cwr-assembly2.cif.gz_A crystal structure of transcriptional regulator of tetr family (yp_425770.1) from rhodospirillum rubrum atcc 11170 at 1.50 a resolution 0.8525 16 209
ID Description Score Start End Superfamily
4xk4B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9923 23 70 1.10.10.60
4xk4D01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9918 23 70 1.10.10.60
4xk4A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9911 23 70 1.10.10.60
4jykB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9878 23 70 1.10.10.60
4x1eB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9854 26 70 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A7W6MG06-F1-model_v4 AcrR family transcriptional regulator 0.991 27 214 GO:0000976
GO:0003700
AF-A0A7W6MG06-F1-model_v4 AcrR family transcriptional regulator 0.9756 27 214 GO:0000976
GO:0003700
AF-A0A7X6FEK2-F1-model_v4 AcrR family transcriptional regulator 0.9712 1 214 GO:0000976
GO:0003700
AF-A0A1G4SAA7-F1-model_v4 Transcriptional regulator, TetR family 0.9657 1 213 GO:0000976
GO:0003700
AF-A0A3S0TPT3-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9642 1 214 GO:0000976
GO:0003700

Map