F320149

General Info

Members Datasets Scaffolds Average Seq Length
210 149 420 94

Family's Representative Sequence

Representative Sequence 3300005718|Ga0068866_10481780|Ga0068866_104817802
Length 92
Sequence MANGLYMVIERFKGGDAVPVYRRFGTADGSHQRGSYVSSWVDTKFERCFQLMETDDPALFDQWLAPVEDLGDFDVYRVITSAEAFEQIAPRL

Samples

Sample ID Description Type Environment
1 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
74 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
75 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
76 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
77 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
99 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
100 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
101 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
102 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
103 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
104 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
105 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
106 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
107 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
108 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
109 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
110 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
111 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
112 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
113 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
114 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
115 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
116 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
117 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
118 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
119 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
124 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
125 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
126 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
127 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
128 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
129 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
130 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
131 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
132 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
133 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
134 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
135 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
136 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
137 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
138 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
139 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
140 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
141 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
142 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
143 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
144 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
145 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
146 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
147 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
148 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
149 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.95
Nodule 0
Rhizoplane 5.24
Rhizosphere 91.9
Stem 0
Stem Tuber 0
Unclassified 35.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068866_10481780 3300005718 Unclassified 817
2 Ga0065707_10827428 3300005295 Unclassified 590
3 Ga0070676_10651514 3300005328 Bacteria 764
4 Ga0070683_100286588 3300005329 Unclassified 1567
5 Ga0068869_100777589 3300005334 Bacteria 821
6 Ga0070666_10014739 3300005335 Unclassified 4980
7 Ga0070680_100832942 3300005336 Bacteria 795
8 Ga0070682_101233609 3300005337 Unclassified 632
9 Ga0068868_100030601 3300005338 Bacteria 4128
10 Ga0070689_100255056 3300005340 Bacteria 1448
11 Ga0070691_10059184 3300005341 Unclassified 1841
12 Ga0070691_10210501 3300005341 Bacteria 1026
13 Ga0070687_100470980 3300005343 Bacteria 840
14 Ga0070671_100310727 3300005355 Bacteria 1343
15 Ga0070667_100071785 3300005367 Bacteria 2949
16 Ga0070667_100075058 3300005367 Bacteria 2886
17 Ga0070711_100029136 3300005439 Unclassified 3640
18 Ga0070705_100001060 3300005440 Bacteria 15319
19 Ga0070694_100001368 3300005444 Bacteria 14258
20 Ga0070694_100190690 3300005444 Bacteria 1522
21 Ga0070708_100134005 3300005445 Bacteria 2294
22 Ga0070708_100710287 3300005445 Bacteria 946
23 Ga0070685_10290263 3300005466 Bacteria 1098
24 Ga0070706_100008000 3300005467 Bacteria 9864
25 Ga0070707_101906944 3300005468 Unclassified 562
26 Ga0070707_102089906 3300005468 Bacteria 534
27 Ga0070698_100000897 3300005471 Bacteria 32681
28 Ga0070698_101712103 3300005471 Unclassified 581
29 Ga0070699_100000024 3300005518 Bacteria 161189
30 Ga0070699_100140348 3300005518 Bacteria 2133
31 Ga0070699_100802689 3300005518 Bacteria 861
32 Ga0070699_100822431 3300005518 Bacteria 850
33 Ga0070697_100168318 3300005536 Bacteria 1854
34 Ga0070697_100481634 3300005536 Unclassified 1084
35 Ga0070686_100000026 3300005544 Bacteria 126656
36 Ga0070695_100000110 3300005545 Bacteria 36348
37 Ga0070695_100020689 3300005545 Unclassified 4019
38 Ga0070696_100029575 3300005546 Bacteria 3745
39 Ga0070696_100251434 3300005546 Bacteria 1337
40 Ga0070665_100018509 3300005548 Bacteria 6981
41 Ga0068855_100003583 3300005563 Bacteria 18970
42 Ga0070664_100783018 3300005564 Unclassified 891
43 Ga0068856_100014773 3300005614 Bacteria 7537
44 Ga0068856_100029347 3300005614 Bacteria 5373
45 Ga0070702_100005877 3300005615 Bacteria 5759
46 Ga0068852_100368206 3300005616 Bacteria 1407
47 Ga0068859_100090819 3300005617 Unclassified 3105
48 Ga0068864_100228720 3300005618 Bacteria 1719
49 Ga0068861_101405730 3300005719 Unclassified 682
50 Ga0068861_101566334 3300005719 Unclassified 648
51 Ga0068858_100036766 3300005842 Bacteria 4541
52 Ga0068860_100265766 3300005843 Bacteria 1673
53 Ga0081455_10063908 3300005937 Bacteria 3085
54 Ga0081455_10164067 3300005937 Bacteria 1699
55 Ga0075364_11093356 3300006051 Unclassified 541
56 Ga0075432_10100329 3300006058 Unclassified 1069
57 Ga0070712_100080734 3300006175 Unclassified 2355
58 Ga0068871_100191085 3300006358 Unclassified 1764
59 Ga0075428_100003767 3300006844 Bacteria 16615
60 Ga0075428_100756978 3300006844 Bacteria 1033
61 Ga0075428_101340981 3300006844 Unclassified 752
62 Ga0075430_100194041 3300006846 Bacteria 1687
63 Ga0075430_100239841 3300006846 Unclassified 1502
64 Ga0075430_100501081 3300006846 Bacteria 1002
65 Ga0075431_100029838 3300006847 Bacteria 5615
66 Ga0075431_100955649 3300006847 Bacteria 825
67 Ga0075431_101776252 3300006847 Unclassified 573
68 Ga0075433_10082445 3300006852 Unclassified 2836
69 Ga0075433_10085617 3300006852 Unclassified 2782
70 Ga0075434_100023676 3300006871 Bacteria 5989
71 Ga0075434_101361443 3300006871 Bacteria 720
72 Ga0075434_101527906 3300006871 Bacteria 677
73 Ga0075434_102342402 3300006871 Unclassified 536
74 Ga0075429_100285814 3300006880 Bacteria 1444
75 Ga0068865_100609874 3300006881 Bacteria 923
76 Ga0097620_100090818 3300006931 Unclassified 3105
77 Ga0099794_10071217 3300007265 Bacteria 1703
78 Ga0105240_10007560 3300009093 Bacteria 15749
79 Ga0111539_10135485 3300009094 Unclassified 2884
80 Ga0105245_10631247 3300009098 Bacteria 1100
81 Ga0105247_10558488 3300009101 Bacteria 843
82 Ga0114129_10007125 3300009147 Bacteria 15913
83 Ga0114129_10053369 3300009147 Bacteria 5669
84 Ga0114129_10073550 3300009147 Bacteria 4762
85 Ga0114129_10767792 3300009147 Bacteria 1233
86 Ga0114129_12904346 3300009147 Unclassified 566
87 Ga0105243_10149347 3300009148 Unclassified 2003
88 Ga0105243_11224103 3300009148 Bacteria 765
89 Ga0105242_10007497 3300009176 Bacteria 8394
90 Ga0105242_10192987 3300009176 Unclassified 1804
91 Ga0105242_10337702 3300009176 Bacteria 1387
92 Ga0105248_10062884 3300009177 Bacteria 4166
93 Ga0105248_10423986 3300009177 Bacteria 1498
94 Ga0105248_10874897 3300009177 Bacteria 1014
95 Ga0105237_10141175 3300009545 Unclassified 2403
96 Ga0105238_10532585 3300009551 Bacteria 1178
97 Ga0105249_10054117 3300009553 Bacteria 3669
98 Ga0105246_10660763 3300011119 Bacteria 911
99 Ga0157369_10070230 3300013105 Bacteria 3763
100 Ga0157374_10231780 3300013296 Unclassified 1814
101 Ga0163162_10099380 3300013306 Unclassified 3000
102 Ga0163162_10318883 3300013306 Bacteria 1687
103 Ga0157372_10057733 3300013307 Bacteria 4338
104 Ga0157375_10612457 3300013308 Bacteria 1247
105 Ga0163163_10566120 3300014325 Bacteria 1199
106 Ga0157379_10049215 3300014968 Bacteria 3763
107 Ga0157379_10064127 3300014968 Unclassified 3284
108 Ga0157379_11857450 3300014968 Unclassified 593
109 Ga0157376_11018300 3300014969 Bacteria 851
110 Ga0213873_10003776 3300021358 Bacteria 2766
111 Ga0213874_10015697 3300021377 Bacteria 2002
112 Ga0213876_10005108 3300021384 Bacteria 7237
113 Ga0213875_10170839 3300021388 Bacteria 1021
114 Ga0207642_10170170 3300025899 Bacteria 1178
115 Ga0207710_10358383 3300025900 Bacteria 744
116 Ga0207680_10097236 3300025903 Bacteria 1885
117 Ga0207684_10001066 3300025910 Bacteria 30744
118 Ga0207663_10042887 3300025916 Bacteria 2766
119 Ga0207687_10277608 3300025927 Bacteria 1342
120 Ga0207686_10020175 3300025934 Bacteria 3804
121 Ga0207686_10134783 3300025934 Unclassified 1699
122 Ga0207709_10016146 3300025935 Unclassified 4148
123 Ga0207709_11666412 3300025935 Unclassified 530
124 Ga0207704_10229501 3300025938 Bacteria 1379
125 Ga0207711_10037566 3300025941 Bacteria 4115
126 Ga0207689_10877798 3300025942 Unclassified 757
127 Ga0207661_10248822 3300025944 Bacteria 1579
128 Ga0207712_10905225 3300025961 Unclassified 780
129 Ga0207668_10204499 3300025972 Bacteria 1575
130 Ga0207658_10221520 3300025986 Bacteria 1592
131 Ga0207677_10006494 3300026023 Bacteria 6424
132 Ga0207703_10019020 3300026035 Bacteria 5366
133 Ga0207702_10010629 3300026078 Bacteria 7691
134 Ga0207675_101551343 3300026118 Unclassified 683
135 Ga0209588_1025843 3300027671 Bacteria 1861
136 Ga0209588_1064135 3300027671 Bacteria 1187
137 Ga0268266_10055171 3300028379 Bacteria 3415
138 Ga0265329_10070039 3300031242 Bacteria 1109
139 Ga0307408_100117791 3300031548 Bacteria 2052
140 Ga0307408_101211957 3300031548 Unclassified 704
141 Ga0307410_10322064 3300031852 Unclassified 1227
142 Ga0307416_100302699 3300032002 Bacteria 1590
143 Ga0307414_11234156 3300032004 Bacteria 693
144 Ga0307415_100804494 3300032126 Bacteria 858
145 Ga0373954_0607993 3300035118 Unclassified 542
146 Ga0373947_0837683 3300035725 Unclassified 628
147 Ga0436364_0886680 3300037853 Bacteria 1229
148 Ga0439460_0374037 3300042461 Unclassified 504
149 Ga0466957_1078543 3300044842 Unclassified 579
150 Ga0495585_0426221 3300046492 Unclassified 637
151 Ga0495656_0204237 3300046615 Bacteria 982
152 Ga0496100_0519552 3300048903 Unclassified 919
153 Ga0496102_0225295 3300048905 Bacteria 1768
154 Ga0496102_0322524 3300048905 Unclassified 1455
155 Ga0496106_0652400 3300048909 Unclassified 841
156 Ga0496106_0713130 3300048909 Unclassified 799
157 Ga0496109_0956574 3300048912 Unclassified 794
158 Ga0496110_0025564 3300048913 Bacteria 5047
159 Ga0496112_0060089 3300048915 Unclassified 3745
160 Ga0496112_0253676 3300048915 Bacteria 1710
161 Ga0496112_0265000 3300048915 Unclassified 1667
162 Ga0496114_0086731 3300048917 Bacteria 2653
163 Ga0501292_023130 3300049515 Bacteria 1014
164 Ga0501031_0374673 3300049568 Unclassified 921
165 Ga0501040_0416311 3300049576 Bacteria 966
166 Ga0501041_0137932 3300049577 Bacteria 1520
167 Ga0501048_0165266 3300049582 Bacteria 1567
168 Ga0501070_1353537 3300049586 Unclassified 542
169 Ga0501071_0017033 3300049587 Bacteria 5005
170 Ga0501072_0389693 3300049588 Bacteria 1105
171 Ga0501073_0585416 3300049589 Bacteria 771
172 Ga0501074_0457656 3300049590 Unclassified 905
173 Ga0501075_0045722 3300049591 Bacteria 3287
174 Ga0501076_0148675 3300049592 Unclassified 1905
175 Ga0501076_0171462 3300049592 Bacteria 1768
176 Ga0501077_0094347 3300049593 Unclassified 1897
177 Ga0501077_0662034 3300049593 Bacteria 671
178 Ga0501217_070277 3300049661 Bacteria 952
179 Ga0501236_108747 3300049670 Unclassified 552
180 Ga0501259_057323 3300049688 Bacteria 806
181 Ga0501079_0058797 3300049741 Unclassified 2967
182 Ga0501079_0067720 3300049741 Bacteria 2756
183 Ga0501080_0241168 3300049742 Bacteria 1650
184 Ga0501080_0963414 3300049742 Bacteria 741
185 Ga0501081_0127171 3300049743 Unclassified 1819
186 Ga0501081_0162015 3300049743 Bacteria 1612
187 Ga0501081_1119511 3300049743 Unclassified 596
188 Ga0501263_012639 3300049760 Bacteria 1061
189 nmdc:mga00v17_963862_c1 3300050491 Unclassified 538
190 nmdc:mga05p37_110137_c1 3300050507 Bacteria 3387
191 nmdc:mga05p37_380822_c1 3300050507 Bacteria 1653
192 nmdc:mga05p37_524_c1 3300050507 Bacteria 42534
193 nmdc:mga09592_24328_c1 3300050508 Bacteria 5007
194 nmdc:mga0qj67_127420_c1 3300050509 Unclassified 2060
195 nmdc:mga0qj67_6359_c1 3300050509 Bacteria 8677
196 nmdc:mga0qj67_868553_c1 3300050509 Unclassified 712
197 nmdc:mga06r32_1854334_c1 3300050510 Unclassified 538
198 nmdc:mga06r32_185742_c1 3300050510 Bacteria 2066
199 nmdc:mga08y16_337707_c1 3300050511 Unclassified 1549
200 nmdc:mga0n895_1120559_c1 3300050512 Unclassified 764
201 nmdc:mga0n895_232017_c1 3300050512 Bacteria 1873
202 nmdc:mga0n895_781905_c1 3300050512 Bacteria 946
203 nmdc:mga0a205_1338182_c1 3300050515 Bacteria 564
204 nmdc:mga0a205_64106_c1 3300050515 Bacteria 3549
205 nmdc:mga0a205_78144_c1 3300050515 Unclassified 3197
206 Ga0501084_0119238 3300054114 Bacteria 2218
207 Ga0501084_0223438 3300054114 Unclassified 1589
208 Ga0590074_097108 3300059423 Bacteria 573
209 Ga0501082_0380677 3300060353 Unclassified 1231
210 Ga0530510_1345602 3300061734 Unclassified 548
211 Ga0068866_10481780
212 Ga0065707_10827428
213 Ga0070676_10651514
214 Ga0070683_100286588
215 Ga0068869_100777589
216 Ga0070666_10014739
217 Ga0070680_100832942
218 Ga0070682_101233609
219 Ga0068868_100030601
220 Ga0070689_100255056
221 Ga0070691_10059184
222 Ga0070691_10210501
223 Ga0070687_100470980
224 Ga0070671_100310727
225 Ga0070667_100071785
226 Ga0070667_100075058
227 Ga0070711_100029136
228 Ga0070705_100001060
229 Ga0070694_100001368
230 Ga0070694_100190690
231 Ga0070708_100134005
232 Ga0070708_100710287
233 Ga0070685_10290263
234 Ga0070706_100008000
235 Ga0070707_101906944
236 Ga0070707_102089906
237 Ga0070698_100000897
238 Ga0070698_101712103
239 Ga0070699_100000024
240 Ga0070699_100140348
241 Ga0070699_100802689
242 Ga0070699_100822431
243 Ga0070697_100168318
244 Ga0070697_100481634
245 Ga0070686_100000026
246 Ga0070695_100000110
247 Ga0070695_100020689
248 Ga0070696_100029575
249 Ga0070696_100251434
250 Ga0070665_100018509
251 Ga0068855_100003583
252 Ga0070664_100783018
253 Ga0068856_100014773
254 Ga0068856_100029347
255 Ga0070702_100005877
256 Ga0068852_100368206
257 Ga0068859_100090819
258 Ga0068864_100228720
259 Ga0068861_101405730
260 Ga0068861_101566334
261 Ga0068858_100036766
262 Ga0068860_100265766
263 Ga0081455_10063908
264 Ga0081455_10164067
265 Ga0075364_11093356
266 Ga0075432_10100329
267 Ga0070712_100080734
268 Ga0068871_100191085
269 Ga0075428_100003767
270 Ga0075428_100756978
271 Ga0075428_101340981
272 Ga0075430_100194041
273 Ga0075430_100239841
274 Ga0075430_100501081
275 Ga0075431_100029838
276 Ga0075431_100955649
277 Ga0075431_101776252
278 Ga0075433_10082445
279 Ga0075433_10085617
280 Ga0075434_100023676
281 Ga0075434_101361443
282 Ga0075434_101527906
283 Ga0075434_102342402
284 Ga0075429_100285814
285 Ga0068865_100609874
286 Ga0097620_100090818
287 Ga0099794_10071217
288 Ga0105240_10007560
289 Ga0111539_10135485
290 Ga0105245_10631247
291 Ga0105247_10558488
292 Ga0114129_10007125
293 Ga0114129_10053369
294 Ga0114129_10073550
295 Ga0114129_10767792
296 Ga0114129_12904346
297 Ga0105243_10149347
298 Ga0105243_11224103
299 Ga0105242_10007497
300 Ga0105242_10192987
301 Ga0105242_10337702
302 Ga0105248_10062884
303 Ga0105248_10423986
304 Ga0105248_10874897
305 Ga0105237_10141175
306 Ga0105238_10532585
307 Ga0105249_10054117
308 Ga0105246_10660763
309 Ga0157369_10070230
310 Ga0157374_10231780
311 Ga0163162_10099380
312 Ga0163162_10318883
313 Ga0157372_10057733
314 Ga0157375_10612457
315 Ga0163163_10566120
316 Ga0157379_10049215
317 Ga0157379_10064127
318 Ga0157379_11857450
319 Ga0157376_11018300
320 Ga0213873_10003776
321 Ga0213874_10015697
322 Ga0213876_10005108
323 Ga0213875_10170839
324 Ga0207642_10170170
325 Ga0207710_10358383
326 Ga0207680_10097236
327 Ga0207684_10001066
328 Ga0207663_10042887
329 Ga0207687_10277608
330 Ga0207686_10020175
331 Ga0207686_10134783
332 Ga0207709_10016146
333 Ga0207709_11666412
334 Ga0207704_10229501
335 Ga0207711_10037566
336 Ga0207689_10877798
337 Ga0207661_10248822
338 Ga0207712_10905225
339 Ga0207668_10204499
340 Ga0207658_10221520
341 Ga0207677_10006494
342 Ga0207703_10019020
343 Ga0207702_10010629
344 Ga0207675_101551343
345 Ga0209588_1025843
346 Ga0209588_1064135
347 Ga0268266_10055171
348 Ga0265329_10070039
349 Ga0307408_100117791
350 Ga0307408_101211957
351 Ga0307410_10322064
352 Ga0307416_100302699
353 Ga0307414_11234156
354 Ga0307415_100804494
355 Ga0373954_0607993
356 Ga0373947_0837683
357 Ga0436364_0886680
358 Ga0439460_0374037
359 Ga0466957_1078543
360 Ga0495585_0426221
361 Ga0495656_0204237
362 Ga0496100_0519552
363 Ga0496102_0225295
364 Ga0496102_0322524
365 Ga0496106_0652400
366 Ga0496106_0713130
367 Ga0496109_0956574
368 Ga0496110_0025564
369 Ga0496112_0060089
370 Ga0496112_0253676
371 Ga0496112_0265000
372 Ga0496114_0086731
373 Ga0501292_023130
374 Ga0501031_0374673
375 Ga0501040_0416311
376 Ga0501041_0137932
377 Ga0501048_0165266
378 Ga0501070_1353537
379 Ga0501071_0017033
380 Ga0501072_0389693
381 Ga0501073_0585416
382 Ga0501074_0457656
383 Ga0501075_0045722
384 Ga0501076_0148675
385 Ga0501076_0171462
386 Ga0501077_0094347
387 Ga0501077_0662034
388 Ga0501217_070277
389 Ga0501236_108747
390 Ga0501259_057323
391 Ga0501079_0058797
392 Ga0501079_0067720
393 Ga0501080_0241168
394 Ga0501080_0963414
395 Ga0501081_0127171
396 Ga0501081_0162015
397 Ga0501081_1119511
398 Ga0501263_012639
399 nmdc:mga00v17_963862_c1
400 nmdc:mga05p37_110137_c1
401 nmdc:mga05p37_380822_c1
402 nmdc:mga05p37_524_c1
403 nmdc:mga09592_24328_c1
404 nmdc:mga0qj67_127420_c1
405 nmdc:mga0qj67_6359_c1
406 nmdc:mga0qj67_868553_c1
407 nmdc:mga06r32_1854334_c1
408 nmdc:mga06r32_185742_c1
409 nmdc:mga08y16_337707_c1
410 nmdc:mga0n895_1120559_c1
411 nmdc:mga0n895_232017_c1
412 nmdc:mga0n895_781905_c1
413 nmdc:mga0a205_1338182_c1
414 nmdc:mga0a205_64106_c1
415 nmdc:mga0a205_78144_c1
416 Ga0501084_0119238
417 Ga0501084_0223438
418 Ga0590074_097108
419 Ga0501082_0380677
420 Ga0530510_1345602

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11746

DUF3303

Domain of unknown function (DUF3303)

4

92

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cfx-assembly1.cif.gz_C structure of b.subtilis lrpc 0.7233 4 82
4lub-assembly1.cif.gz_B x-ray structure of prephenate dehydratase from streptococcus mutans 0.6771 2 76
4pcq-assembly2.cif.gz_C crystal structure of mtbaldr (rv2779c) 0.6702 4 82
4pcq-assembly2.cif.gz_D crystal structure of mtbaldr (rv2779c) 0.6659 2 82
4pcq-assembly1.cif.gz_B crystal structure of mtbaldr (rv2779c) 0.6587 4 82
ID Description Score Start End Superfamily
af_P76092_330_583_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7296 34 55 3.40.50.150
2cfxA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.7288 4 82 3.30.70.920
af_Q2G1I7_88_170_3.30.70.3090 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer 0.7049 4 79 3.30.70.3090
af_Q4DKY3_4_112_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6937 3 82 3.30.70.100
2nyiB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.6702 2 81 3.30.70.260
ID Description Score Start End GO Terms
AF-A0A7V8XRM9-F1-model_v4 DUF3303 family protein 0.9987 4 92
AF-A0A7Y5NG27-F1-model_v4 DUF3303 family protein 0.9971 1 73
AF-A0A536Y4F4-F1-model_v4 DUF3303 domain-containing protein 0.9905 8 92
AF-A0A2V6SFN8-F1-model_v4 DUF3303 domain-containing protein 0.9905 8 92
AF-A0A2V6U4X1-F1-model_v4 DUF3303 domain-containing protein 0.9903 5 93

Map