F320091

General Info

Members Datasets Scaffolds Average Seq Length
210 137 420 191

Family's Representative Sequence

Representative Sequence 3300005466|Ga0070685_10001422|Ga0070685_100014222
Length 205
Sequence VVRSPAAVFFFTKPDRRQIDRFLAAQRSRTFSYRETGASRRTVPGGYTQDHNRIQLGEGRAAFARAVEAFHHWKQFDLGWVSAHPSTAPLEPGITVAVRVRHLGFWSLNACRIVYTIDDEGPVVRFGFAYGTLPDHAEQGEERFTVEWHHEDNSVWYDILAFSRPNHPLARLGLPITRRLQKRFASNSKLVMARAAAAQWKGKGT

Samples

Sample ID Description Type Environment
1 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
90 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
91 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
92 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
93 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
94 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
95 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
96 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
97 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
98 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
99 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
100 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
101 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
102 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
103 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
104 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
105 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
106 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
107 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
108 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
109 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
110 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
111 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
112 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
113 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
114 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
115 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
116 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
117 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
118 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
119 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
120 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
121 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
122 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
123 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
124 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
125 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
126 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
127 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
128 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
129 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
130 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
131 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
132 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
133 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
134 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
135 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
136 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
137 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.38
Rhizosphere 96.67
Stem 0
Stem Tuber 0
Unclassified 8.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070685_10001422 3300005466 Bacteria 12565
2 SwRhRL2b_contig_278653 2162886007 Bacteria 868
3 MRS1b_contig_2212172 2162886011 Bacteria 1995
4 Ga0065714_10002185 3300005288 Bacteria 199213
5 Ga0065704_10255708 3300005289 Bacteria 978
6 Ga0065712_10067739 3300005290 Bacteria 87070
7 Ga0065715_10089342 3300005293 Bacteria 11055
8 Ga0065715_10186015 3300005293 Bacteria 1437
9 Ga0065707_10235044 3300005295 Bacteria 1175
10 Ga0065707_10550980 3300005295 Unclassified 721
11 Ga0070670_100006357 3300005331 Bacteria 9998
12 Ga0070670_100257821 3300005331 Bacteria 1520
13 Ga0068869_100562336 3300005334 Bacteria 959
14 Ga0070682_100010538 3300005337 Bacteria 5246
15 Ga0070682_100021888 3300005337 Bacteria 3780
16 Ga0070682_100097319 3300005337 Bacteria 1937
17 Ga0070689_100266685 3300005340 Bacteria 1416
18 Ga0070692_10028702 3300005345 Bacteria 2767
19 Ga0070668_100809792 3300005347 Bacteria 833
20 Ga0070669_100056260 3300005353 Bacteria 2884
21 Ga0070671_100018340 3300005355 Bacteria 5683
22 Ga0070688_100020219 3300005365 Bacteria 3868
23 Ga0070688_100299624 3300005365 Bacteria 1162
24 Ga0070688_100609281 3300005365 Bacteria 837
25 Ga0070659_100586355 3300005366 Archaea 957
26 Ga0070667_100991620 3300005367 Unclassified 784
27 Ga0070703_10070608 3300005406 Bacteria 1166
28 Ga0070705_100000046 3300005440 Bacteria 62508
29 Ga0070705_100019780 3300005440 Bacteria 3549
30 Ga0070705_100105031 3300005440 Bacteria 1793
31 Ga0070705_100200411 3300005440 Unclassified 1368
32 Ga0070705_100359788 3300005440 Bacteria 1064
33 Ga0070700_100000226 3300005441 Bacteria 31294
34 Ga0070700_100016448 3300005441 Unclassified 4213
35 Ga0070700_100095732 3300005441 Bacteria 1947
36 Ga0070700_100218894 3300005441 Unclassified 1348
37 Ga0070694_100007340 3300005444 Bacteria 6720
38 Ga0070694_100063884 3300005444 Bacteria 2519
39 Ga0070694_100133121 3300005444 Bacteria 1798
40 Ga0070694_100139565 3300005444 Bacteria 1759
41 Ga0070694_100672474 3300005444 Bacteria 840
42 Ga0070663_100004000 3300005455 Bacteria 8596
43 Ga0070681_10055719 3300005458 Bacteria 3935
44 Ga0070681_10057462 3300005458 Bacteria 3871
45 Ga0070681_11171462 3300005458 Bacteria 690
46 Ga0070685_10024923 3300005466 Bacteria 3289
47 Ga0070698_100350572 3300005471 Bacteria 1408
48 Ga0070699_100000079 3300005518 Bacteria 92794
49 Ga0070699_100003194 3300005518 Bacteria 14496
50 Ga0070679_100148954 3300005530 Bacteria 2318
51 Ga0068853_100083521 3300005539 Bacteria 2798
52 Ga0068853_100084926 3300005539 Bacteria 2774
53 Ga0070695_100239000 3300005545 Bacteria 1317
54 Ga0070695_100295397 3300005545 Bacteria 1196
55 Ga0070696_100001438 3300005546 Bacteria 15587
56 Ga0070696_100003561 3300005546 Bacteria 10374
57 Ga0070696_100066476 3300005546 Bacteria 2528
58 Ga0070696_100141347 3300005546 Bacteria 1760
59 Ga0070696_100820582 3300005546 Bacteria 767
60 Ga0070693_100005893 3300005547 Bacteria 5923
61 Ga0070693_100024087 3300005547 Bacteria 3260
62 Ga0070693_100046368 3300005547 Bacteria 2468
63 Ga0070693_100205763 3300005547 Bacteria 1281
64 Ga0070665_100000779 3300005548 Bacteria 41952
65 Ga0070665_100000929 3300005548 Bacteria 37471
66 Ga0070704_100160996 3300005549 Bacteria 1775
67 Ga0068855_101121866 3300005563 Bacteria 821
68 Ga0068854_100135319 3300005578 Bacteria 1886
69 Ga0068852_101203865 3300005616 Unclassified 778
70 Ga0068859_100007431 3300005617 Bacteria 11119
71 Ga0068859_100036259 3300005617 Bacteria 4950
72 Ga0068859_100170136 3300005617 Bacteria 2260
73 Ga0068864_100024825 3300005618 Bacteria 5042
74 Ga0068864_100473206 3300005618 Bacteria 1201
75 Ga0068864_101159349 3300005618 Bacteria 770
76 Ga0068861_100001140 3300005719 Bacteria 16543
77 Ga0068861_100632100 3300005719 Bacteria 987
78 Ga0068861_100800232 3300005719 Bacteria 885
79 Ga0068851_10000905 3300005834 Bacteria 12783
80 Ga0068863_100081694 3300005841 Bacteria 3061
81 Ga0068858_100448101 3300005842 Bacteria 1244
82 Ga0068862_100139170 3300005844 Bacteria 2153
83 Ga0070717_10244691 3300006028 Bacteria 1583
84 Ga0097621_101085064 3300006237 Bacteria 751
85 Ga0075428_100466395 3300006844 Bacteria 1352
86 Ga0075433_10001873 3300006852 Bacteria 15807
87 Ga0075433_10090555 3300006852 Bacteria 2704
88 Ga0075434_100000136 3300006871 Bacteria 44550
89 Ga0075436_100006349 3300006914 Bacteria 8100
90 Ga0097620_100007431 3300006931 Bacteria 11119
91 Ga0097620_100036259 3300006931 Bacteria 4950
92 Ga0097620_100170144 3300006931 Bacteria 2260
93 Ga0105240_10062843 3300009093 Bacteria 4621
94 Ga0111539_10911063 3300009094 Bacteria 1022
95 Ga0114129_10090219 3300009147 Bacteria 4249
96 Ga0114129_10303249 3300009147 Bacteria 2128
97 Ga0114129_10328621 3300009147 Unclassified 2031
98 Ga0114129_10413270 3300009147 Unclassified 1776
99 Ga0114129_10869105 3300009147 Unclassified 1145
100 Ga0105243_10209615 3300009148 Bacteria 1715
101 Ga0105241_10752506 3300009174 Bacteria 894
102 Ga0105241_11186483 3300009174 Unclassified 722
103 Ga0105248_10044902 3300009177 Bacteria 4956
104 Ga0105237_10000493 3300009545 Bacteria 55867
105 Ga0105237_10336011 3300009545 Bacteria 1515
106 Ga0105237_10891768 3300009545 Bacteria 896
107 Ga0105238_10003696 3300009551 Bacteria 15229
108 Ga0105238_10016425 3300009551 Bacteria 7493
109 Ga0105249_10007245 3300009553 Bacteria 9676
110 Ga0105249_10033270 3300009553 Bacteria 4667
111 Ga0157370_10545876 3300013104 Bacteria 1063
112 Ga0157369_10629910 3300013105 Bacteria 1106
113 Ga0157374_10138955 3300013296 Bacteria 2357
114 Ga0157372_10440539 3300013307 Bacteria 1518
115 Ga0157372_10747214 3300013307 Bacteria 1137
116 Ga0157375_10017276 3300013308 Bacteria 6507
117 Ga0163163_10227788 3300014325 Bacteria 1913
118 Ga0163163_11586594 3300014325 Unclassified 715
119 Ga0157380_10556156 3300014326 Bacteria 1126
120 Ga0157377_10135736 3300014745 Bacteria 1507
121 Ga0157379_10418474 3300014968 Bacteria 1234
122 Ga0207656_10030725 3300025321 Bacteria 2221
123 Ga0207656_10080652 3300025321 Bacteria 1462
124 Ga0207647_10004949 3300025904 Bacteria 9821
125 Ga0207647_10061949 3300025904 Bacteria 2280
126 Ga0207643_10009385 3300025908 Bacteria 5256
127 Ga0207707_10043358 3300025912 Bacteria 3924
128 Ga0207707_10047030 3300025912 Bacteria 3758
129 Ga0207707_11009045 3300025912 Bacteria 683
130 Ga0207671_10006395 3300025914 Bacteria 10502
131 Ga0207671_10544118 3300025914 Bacteria 926
132 Ga0207694_10042844 3300025924 Bacteria 3493
133 Ga0207650_10038990 3300025925 Bacteria 3472
134 Ga0207650_10494446 3300025925 Bacteria 1022
135 Ga0207650_10704147 3300025925 Bacteria 853
136 Ga0207644_10101791 3300025931 Bacteria 2159
137 Ga0207644_10649460 3300025931 Unclassified 878
138 Ga0207709_10772818 3300025935 Bacteria 774
139 Ga0207711_10029543 3300025941 Bacteria 4625
140 Ga0207658_10839284 3300025986 Bacteria 835
141 Ga0207639_10113299 3300026041 Bacteria 2215
142 Ga0207639_10990743 3300026041 Bacteria 787
143 Ga0207708_10000140 3300026075 Bacteria 57251
144 Ga0207708_10129699 3300026075 Bacteria 1971
145 Ga0207641_10146178 3300026088 Bacteria 2138
146 Ga0207676_10067262 3300026095 Bacteria 2861
147 Ga0207676_11428981 3300026095 Unclassified 688
148 Ga0207674_10728294 3300026116 Bacteria 957
149 Ga0207675_100043031 3300026118 Bacteria 4217
150 Ga0207675_100071865 3300026118 Bacteria 3235
151 Ga0207698_10146577 3300026142 Bacteria 2042
152 Ga0268266_10000575 3300028379 Bacteria 50661
153 Ga0268266_10001225 3300028379 Bacteria 31498
154 Ga0307408_100164708 3300031548 Bacteria 1764
155 Ga0307405_10001478 3300031731 Bacteria 9924
156 Ga0307405_11160926 3300031731 Bacteria 666
157 Ga0307413_10011609 3300031824 Bacteria 4344
158 Ga0307410_10032291 3300031852 Bacteria 3367
159 Ga0307406_10105756 3300031901 Bacteria 1926
160 Ga0307407_10169352 3300031903 Bacteria 1437
161 Ga0307412_10009621 3300031911 Bacteria 5552
162 Ga0307409_100128970 3300031995 Bacteria 2157
163 Ga0307416_100008402 3300032002 Bacteria 6660
164 Ga0307416_101656013 3300032002 Bacteria 745
165 Ga0307414_10004078 3300032004 Bacteria 7877
166 Ga0307411_10138042 3300032005 Bacteria 1793
167 Ga0307415_100036800 3300032126 Bacteria 3210
168 Ga0373956_0148323 3300035119 Bacteria 1103
169 Ga0395900_0276068 3300037418 Bacteria 1674
170 Ga0395900_0810009 3300037418 Bacteria 864
171 Ga0395898_0206154 3300037466 Bacteria 1876
172 Ga0395901_0378936 3300038443 Bacteria 1456
173 Ga0436365_0464420 3300039437 Bacteria 923
174 Ga0436365_1662151 3300039437 Bacteria 1069
175 Ga0436360_1090045 3300039438 Bacteria 1041
176 Ga0439448_0047003 3300042005 Bacteria 1407
177 Ga0450889_002414 3300042144 Bacteria 1863
178 Ga0466963_0027431 3300044694 Bacteria 3647
179 Ga0496105_0327976 3300048908 Bacteria 1226
180 Ga0496106_0028535 3300048909 Bacteria 4157
181 Ga0496107_0150027 3300048910 Bacteria 1724
182 Ga0496112_0177431 3300048915 Bacteria 2095
183 Ga0496113_0024499 3300048916 Bacteria 4290
184 Ga0501292_036128 3300049515 Unclassified 842
185 Ga0501198_001677 3300049649 Bacteria 2926
186 Ga0501207_000199 3300049654 Bacteria 5924
187 Ga0501208_002838 3300049655 Bacteria 1860
188 Ga0501214_009428 3300049659 Bacteria 1049
189 Ga0501217_000751 3300049661 Bacteria 5619
190 Ga0501217_103529 3300049661 Unclassified 811
191 Ga0501223_001099 3300049663 Bacteria 6370
192 Ga0501224_002722 3300049664 Bacteria 2432
193 Ga0501227_000506 3300049665 Bacteria 8356
194 Ga0501235_003062 3300049669 Bacteria 3606
195 Ga0501251_007213 3300049681 Bacteria 1231
196 Ga0501257_018117 3300049686 Bacteria 1640
197 Ga0501258_016283 3300049687 Bacteria 839
198 Ga0501225_0000919 3300049705 Bacteria 9191
199 Ga0501229_010540 3300049706 Bacteria 1168
200 Ga0501245_027005 3300049708 Bacteria 930
201 Ga0501232_019722 3300049757 Bacteria 859
202 Ga0501270_036474 3300049767 Bacteria 838
203 Ga0501212_006015 3300049851 Bacteria 1624
204 Ga0501226_000776 3300049853 Bacteria 4292
205 nmdc:mga0n895_303336_c1 3300050512 Bacteria 1619
206 nmdc:mga0n895_439688_c1 3300050512 Unclassified 1317
207 nmdc:mga0a205_109688_c1 3300050515 Bacteria 2658
208 nmdc:mga0a205_111115_c1 3300050515 Bacteria 2639
209 nmdc:mga0a205_72979_c1 3300050515 Bacteria 3316
210 Ga0495619_0740766 3300053085 Unclassified 667
211 Ga0070685_10001422
212 SwRhRL2b_contig_278653
213 MRS1b_contig_2212172
214 Ga0065714_10002185
215 Ga0065704_10255708
216 Ga0065712_10067739
217 Ga0065715_10089342
218 Ga0065715_10186015
219 Ga0065707_10235044
220 Ga0065707_10550980
221 Ga0070670_100006357
222 Ga0070670_100257821
223 Ga0068869_100562336
224 Ga0070682_100010538
225 Ga0070682_100021888
226 Ga0070682_100097319
227 Ga0070689_100266685
228 Ga0070692_10028702
229 Ga0070668_100809792
230 Ga0070669_100056260
231 Ga0070671_100018340
232 Ga0070688_100020219
233 Ga0070688_100299624
234 Ga0070688_100609281
235 Ga0070659_100586355
236 Ga0070667_100991620
237 Ga0070703_10070608
238 Ga0070705_100000046
239 Ga0070705_100019780
240 Ga0070705_100105031
241 Ga0070705_100200411
242 Ga0070705_100359788
243 Ga0070700_100000226
244 Ga0070700_100016448
245 Ga0070700_100095732
246 Ga0070700_100218894
247 Ga0070694_100007340
248 Ga0070694_100063884
249 Ga0070694_100133121
250 Ga0070694_100139565
251 Ga0070694_100672474
252 Ga0070663_100004000
253 Ga0070681_10055719
254 Ga0070681_10057462
255 Ga0070681_11171462
256 Ga0070685_10024923
257 Ga0070698_100350572
258 Ga0070699_100000079
259 Ga0070699_100003194
260 Ga0070679_100148954
261 Ga0068853_100083521
262 Ga0068853_100084926
263 Ga0070695_100239000
264 Ga0070695_100295397
265 Ga0070696_100001438
266 Ga0070696_100003561
267 Ga0070696_100066476
268 Ga0070696_100141347
269 Ga0070696_100820582
270 Ga0070693_100005893
271 Ga0070693_100024087
272 Ga0070693_100046368
273 Ga0070693_100205763
274 Ga0070665_100000779
275 Ga0070665_100000929
276 Ga0070704_100160996
277 Ga0068855_101121866
278 Ga0068854_100135319
279 Ga0068852_101203865
280 Ga0068859_100007431
281 Ga0068859_100036259
282 Ga0068859_100170136
283 Ga0068864_100024825
284 Ga0068864_100473206
285 Ga0068864_101159349
286 Ga0068861_100001140
287 Ga0068861_100632100
288 Ga0068861_100800232
289 Ga0068851_10000905
290 Ga0068863_100081694
291 Ga0068858_100448101
292 Ga0068862_100139170
293 Ga0070717_10244691
294 Ga0097621_101085064
295 Ga0075428_100466395
296 Ga0075433_10001873
297 Ga0075433_10090555
298 Ga0075434_100000136
299 Ga0075436_100006349
300 Ga0097620_100007431
301 Ga0097620_100036259
302 Ga0097620_100170144
303 Ga0105240_10062843
304 Ga0111539_10911063
305 Ga0114129_10090219
306 Ga0114129_10303249
307 Ga0114129_10328621
308 Ga0114129_10413270
309 Ga0114129_10869105
310 Ga0105243_10209615
311 Ga0105241_10752506
312 Ga0105241_11186483
313 Ga0105248_10044902
314 Ga0105237_10000493
315 Ga0105237_10336011
316 Ga0105237_10891768
317 Ga0105238_10003696
318 Ga0105238_10016425
319 Ga0105249_10007245
320 Ga0105249_10033270
321 Ga0157370_10545876
322 Ga0157369_10629910
323 Ga0157374_10138955
324 Ga0157372_10440539
325 Ga0157372_10747214
326 Ga0157375_10017276
327 Ga0163163_10227788
328 Ga0163163_11586594
329 Ga0157380_10556156
330 Ga0157377_10135736
331 Ga0157379_10418474
332 Ga0207656_10030725
333 Ga0207656_10080652
334 Ga0207647_10004949
335 Ga0207647_10061949
336 Ga0207643_10009385
337 Ga0207707_10043358
338 Ga0207707_10047030
339 Ga0207707_11009045
340 Ga0207671_10006395
341 Ga0207671_10544118
342 Ga0207694_10042844
343 Ga0207650_10038990
344 Ga0207650_10494446
345 Ga0207650_10704147
346 Ga0207644_10101791
347 Ga0207644_10649460
348 Ga0207709_10772818
349 Ga0207711_10029543
350 Ga0207658_10839284
351 Ga0207639_10113299
352 Ga0207639_10990743
353 Ga0207708_10000140
354 Ga0207708_10129699
355 Ga0207641_10146178
356 Ga0207676_10067262
357 Ga0207676_11428981
358 Ga0207674_10728294
359 Ga0207675_100043031
360 Ga0207675_100071865
361 Ga0207698_10146577
362 Ga0268266_10000575
363 Ga0268266_10001225
364 Ga0307408_100164708
365 Ga0307405_10001478
366 Ga0307405_11160926
367 Ga0307413_10011609
368 Ga0307410_10032291
369 Ga0307406_10105756
370 Ga0307407_10169352
371 Ga0307412_10009621
372 Ga0307409_100128970
373 Ga0307416_100008402
374 Ga0307416_101656013
375 Ga0307414_10004078
376 Ga0307411_10138042
377 Ga0307415_100036800
378 Ga0373956_0148323
379 Ga0395900_0276068
380 Ga0395900_0810009
381 Ga0395898_0206154
382 Ga0395901_0378936
383 Ga0436365_0464420
384 Ga0436365_1662151
385 Ga0436360_1090045
386 Ga0439448_0047003
387 Ga0450889_002414
388 Ga0466963_0027431
389 Ga0496105_0327976
390 Ga0496106_0028535
391 Ga0496107_0150027
392 Ga0496112_0177431
393 Ga0496113_0024499
394 Ga0501292_036128
395 Ga0501198_001677
396 Ga0501207_000199
397 Ga0501208_002838
398 Ga0501214_009428
399 Ga0501217_000751
400 Ga0501217_103529
401 Ga0501223_001099
402 Ga0501224_002722
403 Ga0501227_000506
404 Ga0501235_003062
405 Ga0501251_007213
406 Ga0501257_018117
407 Ga0501258_016283
408 Ga0501225_0000919
409 Ga0501229_010540
410 Ga0501245_027005
411 Ga0501232_019722
412 Ga0501270_036474
413 Ga0501212_006015
414 Ga0501226_000776
415 nmdc:mga0n895_303336_c1
416 nmdc:mga0n895_439688_c1
417 nmdc:mga0a205_109688_c1
418 nmdc:mga0a205_111115_c1
419 nmdc:mga0a205_72979_c1
420 Ga0495619_0740766

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09348

DUF1990

Domain of unknown function (DUF1990)

32

189

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7b3u-assembly1.cif.gz_B oxa-10 beta-lactamase with covalent modification 0.7073 109 155
7tmu-assembly4.cif.gz_D crystal structure of the protein of unknown function ypo0625 from yersinia pestis 0.6952 40 190
1k54-assembly1.cif.gz_C oxa-10 class d beta-lactamase partially acylated with reacted 6beta-(1-hydroxy-1-methylethyl) penicillanic acid 0.6861 109 156
7tmu-assembly4.cif.gz_D crystal structure of the protein of unknown function ypo0625 from yersinia pestis 0.6828 40 190
1k54-assembly2.cif.gz_D oxa-10 class d beta-lactamase partially acylated with reacted 6beta-(1-hydroxy-1-methylethyl) penicillanic acid 0.6734 109 155
ID Description Score Start End Superfamily
af_Q10SY4_84_240_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9437 39 181 3.30.530.20
af_Q86JL6_34_202_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8737 23 183 3.30.530.20
af_O06198_12_165_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8632 26 183 3.30.530.20
af_Q10SY4_84_240_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8565 39 181 3.30.530.20
af_O06198_12_165_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8476 26 183 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A5C1AEE6-F1-model_v4 DUF1990 domain-containing protein 0.9908 1 192
AF-A0A225D9U5-F1-model_v4 DUF1990 domain-containing protein 0.9864 1 190
AF-A0A2E9QTV8-F1-model_v4 DUF1990 domain-containing protein 0.9792 1 189
AF-A0A2V8Y4R1-F1-model_v4 DUF1990 domain-containing protein 0.9788 1 193
AF-A0A2S8FJJ7-F1-model_v4 DUF1990 domain-containing protein 0.9775 1 189

Map