F319968

General Info

Members Datasets Scaffolds Average Seq Length
210 147 420 136

Family's Representative Sequence

Representative Sequence 3300005337|Ga0070682_100419880|Ga0070682_1004198801
Length 150
Sequence MSEPRKLLFVCVENSCRSQMAEAFAHILGDDSVEAYSAGSRPSGIVNPGAIESMKEIGYDLSTHESKSLHDLPDVEWDFVATMGCGDECPFVRAKRREDWQVPDPKSMDPDGFRAVRGRIFLKVQSLLTSYLKTDCSSSDPYFPKEKIVR

Samples

Sample ID Description Type Environment
1 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
98 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
99 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
100 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
101 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
102 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
103 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
104 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
105 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
106 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
107 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
108 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
109 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
110 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
111 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
112 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
113 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
114 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
115 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
116 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
117 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
118 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
119 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
120 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
121 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
122 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
123 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
124 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
125 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
126 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
127 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
130 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
131 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
132 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
133 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
134 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
135 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
136 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
137 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
139 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
140 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
141 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
142 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
143 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
144 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
145 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
146 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
147 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 99.05
Stem 0
Stem Tuber 0
Unclassified 19.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070682_100419880 3300005337 Bacteria 1016
2 Ga0065707_10106010 3300005295 Bacteria 2618
3 Ga0070683_100528261 3300005329 Bacteria 1128
4 Ga0070680_100007808 3300005336 Bacteria 8152
5 Ga0070680_100611784 3300005336 Bacteria 935
6 Ga0070661_100152597 3300005344 Bacteria 1747
7 Ga0070692_11009025 3300005345 Bacteria 582
8 Ga0070669_100131448 3300005353 Bacteria 1921
9 Ga0070675_101534882 3300005354 Unclassified 614
10 Ga0070675_101756372 3300005354 Bacteria 572
11 Ga0070671_101165905 3300005355 Bacteria 678
12 Ga0070671_101480314 3300005355 Bacteria 601
13 Ga0070659_100063232 3300005366 Bacteria 2928
14 Ga0070659_100322894 3300005366 Bacteria 1291
15 Ga0070701_10052597 3300005438 Bacteria 2117
16 Ga0070701_10865836 3300005438 Bacteria 621
17 Ga0070694_100841139 3300005444 Bacteria 755
18 Ga0070708_100010621 3300005445 Bacteria 7465
19 Ga0070708_100343492 3300005445 Unclassified 1406
20 Ga0070663_100344449 3300005455 Bacteria 1205
21 Ga0070678_100559658 3300005456 Unclassified 1016
22 Ga0070681_10006858 3300005458 Bacteria 11083
23 Ga0068867_101013667 3300005459 Bacteria 753
24 Ga0070685_11578357 3300005466 Unclassified 507
25 Ga0070706_100003539 3300005467 Bacteria 15353
26 Ga0070706_100025830 3300005467 Bacteria 5405
27 Ga0070706_101202299 3300005467 Unclassified 696
28 Ga0070707_100007032 3300005468 Bacteria 10439
29 Ga0070707_100020302 3300005468 Bacteria 6265
30 Ga0070707_100642090 3300005468 Bacteria 1024
31 Ga0070698_100259375 3300005471 Bacteria 1670
32 Ga0070698_100874107 3300005471 Unclassified 844
33 Ga0070699_100129167 3300005518 Bacteria 2227
34 Ga0070699_100161011 3300005518 Bacteria 1986
35 Ga0070699_100580893 3300005518 Unclassified 1021
36 Ga0070679_100102447 3300005530 Bacteria 2849
37 Ga0070679_101685030 3300005530 Unclassified 582
38 Ga0070697_100001471 3300005536 Bacteria 17920
39 Ga0070697_100016746 3300005536 Bacteria 5765
40 Ga0070697_100030358 3300005536 Bacteria 4342
41 Ga0070697_100396902 3300005536 Bacteria 1196
42 Ga0070697_100532654 3300005536 Bacteria 1029
43 Ga0070697_101508601 3300005536 Bacteria 601
44 Ga0068853_100062556 3300005539 Bacteria 3221
45 Ga0070672_100478044 3300005543 Bacteria 1076
46 Ga0070672_101277069 3300005543 Bacteria 655
47 Ga0070686_100005485 3300005544 Bacteria 7022
48 Ga0070686_100135582 3300005544 Bacteria 1708
49 Ga0070704_100001508 3300005549 Bacteria 12546
50 Ga0070704_100308009 3300005549 Bacteria 1322
51 Ga0068855_100038501 3300005563 Bacteria 5681
52 Ga0068855_101044289 3300005563 Bacteria 857
53 Ga0070664_100989395 3300005564 Unclassified 790
54 Ga0070664_101326251 3300005564 Bacteria 680
55 Ga0068857_100670959 3300005577 Unclassified 983
56 Ga0068854_100360554 3300005578 Bacteria 1192
57 Ga0068854_100688425 3300005578 Bacteria 881
58 Ga0068852_100037592 3300005616 Bacteria 4060
59 Ga0068852_100819031 3300005616 Bacteria 946
60 Ga0068859_100111097 3300005617 Bacteria 2803
61 Ga0068859_101592920 3300005617 Unclassified 721
62 Ga0068861_100006707 3300005719 Bacteria 7868
63 Ga0068861_100073336 3300005719 Bacteria 2659
64 Ga0068863_100524467 3300005841 Bacteria 1168
65 Ga0068858_100422220 3300005842 Unclassified 1282
66 Ga0068858_102313133 3300005842 Bacteria 531
67 Ga0068862_100130695 3300005844 Bacteria 2220
68 Ga0068862_102090471 3300005844 Unclassified 577
69 Ga0068871_100669884 3300006358 Bacteria 948
70 Ga0075428_100001970 3300006844 Bacteria 22113
71 Ga0075430_100016853 3300006846 Bacteria 6224
72 Ga0075431_100029669 3300006847 Bacteria 5631
73 Ga0075431_100289853 3300006847 Bacteria 1656
74 Ga0075433_10389461 3300006852 Bacteria 1230
75 Ga0075434_101555494 3300006871 Unclassified 670
76 Ga0075429_100002954 3300006880 Bacteria 14421
77 Ga0068865_100355473 3300006881 Bacteria 1188
78 Ga0075436_100000044 3300006914 Bacteria 77101
79 Ga0097620_100111094 3300006931 Bacteria 2803
80 Ga0097620_101592638 3300006931 Unclassified 721
81 Ga0075435_100001106 3300007076 Bacteria 17164
82 Ga0099794_10176280 3300007265 Unclassified 1090
83 Ga0099794_10385347 3300007265 Unclassified 731
84 Ga0105240_10030376 3300009093 Bacteria 7023
85 Ga0111539_10181188 3300009094 Unclassified 2460
86 Ga0105247_10200336 3300009101 Unclassified 1341
87 Ga0114129_10008055 3300009147 Bacteria 15015
88 Ga0114129_10686827 3300009147 Bacteria 1317
89 Ga0105243_10045786 3300009148 Bacteria 3440
90 Ga0105242_10555815 3300009176 Bacteria 1101
91 Ga0105237_10043821 3300009545 Bacteria 4506
92 Ga0105237_10181175 3300009545 Bacteria 2107
93 Ga0105249_10021661 3300009553 Bacteria 5754
94 Ga0105239_10151875 3300010375 Bacteria 2585
95 Ga0105239_11038050 3300010375 Unclassified 943
96 Ga0157373_10182241 3300013100 Unclassified 1479
97 Ga0157370_10058663 3300013104 Unclassified 3658
98 Ga0157369_10050846 3300013105 Bacteria 4486
99 Ga0157378_10057128 3300013297 Bacteria 3478
100 Ga0157372_10050062 3300013307 Bacteria 4648
101 Ga0157375_10469497 3300013308 Bacteria 1423
102 Ga0157380_10012748 3300014326 Bacteria 6105
103 Ga0157380_10074790 3300014326 Bacteria 2751
104 Ga0157377_11354584 3300014745 Archaea 559
105 Ga0207680_10486013 3300025903 Bacteria 879
106 Ga0207645_10466081 3300025907 Unclassified 853
107 Ga0207705_10087031 3300025909 Bacteria 2284
108 Ga0207684_10001598 3300025910 Bacteria 24083
109 Ga0207684_10031401 3300025910 Bacteria 4519
110 Ga0207684_10198565 3300025910 Unclassified 1730
111 Ga0207684_10211839 3300025910 Bacteria 1671
112 Ga0207684_10266134 3300025910 Bacteria 1479
113 Ga0207707_10026597 3300025912 Bacteria 5057
114 Ga0207695_10337607 3300025913 Bacteria 1395
115 Ga0207660_10147314 3300025917 Unclassified 1805
116 Ga0207662_10325775 3300025918 Bacteria 1026
117 Ga0207652_10028418 3300025921 Bacteria 4666
118 Ga0207646_10000518 3300025922 Bacteria 51449
119 Ga0207646_10003776 3300025922 Bacteria 16868
120 Ga0207646_10048360 3300025922 Unclassified 3812
121 Ga0207650_10169592 3300025925 Bacteria 1734
122 Ga0207650_10753198 3300025925 Unclassified 824
123 Ga0207690_10048966 3300025932 Bacteria 2814
124 Ga0207706_10506900 3300025933 Bacteria 1041
125 Ga0207709_10024502 3300025935 Bacteria 3446
126 Ga0207665_10000025 3300025939 Bacteria 100584
127 Ga0207665_11051904 3300025939 Unclassified 648
128 Ga0207691_10068615 3300025940 Bacteria 3203
129 Ga0207691_10348603 3300025940 Bacteria 1267
130 Ga0207661_10259470 3300025944 Bacteria 1548
131 Ga0207661_10908650 3300025944 Bacteria 811
132 Ga0207667_10089311 3300025949 Bacteria 3185
133 Ga0207651_11020373 3300025960 Bacteria 740
134 Ga0207712_10160239 3300025961 Bacteria 1748
135 Ga0207677_12195137 3300026023 Bacteria 514
136 Ga0207703_10427841 3300026035 Unclassified 1233
137 Ga0207703_11775856 3300026035 Bacteria 593
138 Ga0207639_10018412 3300026041 Bacteria 4962
139 Ga0207678_10433297 3300026067 Bacteria 1141
140 Ga0207675_100002801 3300026118 Bacteria 17132
141 Ga0207675_100055348 3300026118 Bacteria 3701
142 Ga0207698_10654496 3300026142 Bacteria 1041
143 Ga0207698_10819354 3300026142 Bacteria 934
144 Ga0210000_1027774 3300027462 Bacteria 880
145 Ga0268265_11088766 3300028380 Unclassified 793
146 Ga0268265_11962049 3300028380 Unclassified 592
147 Ga0268264_12118019 3300028381 Bacteria 571
148 Ga0265326_10109022 3300028558 Bacteria 786
149 Ga0265323_10011309 3300028653 Bacteria 3603
150 Ga0265323_10020544 3300028653 Unclassified 2542
151 Ga0265323_10126296 3300028653 Unclassified 831
152 Ga0265328_10343675 3300031239 Bacteria 580
153 Ga0265331_10010470 3300031250 Bacteria 5131
154 Ga0265327_10000005 3300031251 Bacteria 790146
155 Ga0265316_10002087 3300031344 Bacteria 21015
156 Ga0265316_10052201 3300031344 Bacteria 3208
157 Ga0265342_10023511 3300031712 Bacteria 3900
158 Ga0307405_11032762 3300031731 Bacteria 703
159 Ga0307405_11127741 3300031731 Bacteria 675
160 Ga0307410_10175574 3300031852 Bacteria 1618
161 Ga0307406_10122267 3300031901 Bacteria 1812
162 Ga0307406_10693981 3300031901 Bacteria 849
163 Ga0307407_11318923 3300031903 Bacteria 567
164 Ga0307416_100134613 3300032002 Bacteria 2233
165 Ga0307416_101150533 3300032002 Bacteria 881
166 Ga0307411_10662504 3300032005 Unclassified 905
167 Ga0307415_100153813 3300032126 Bacteria 1774
168 Ga0316583_10009087 3300032133 Bacteria 3584
169 Ga0395905_0004746 3300037471 Bacteria 14044
170 Ga0436364_1415831 3300037853 Bacteria 2506
171 Ga0439449_0107480 3300042007 Bacteria 1033
172 Ga0439455_0067186 3300042012 Bacteria 959
173 Ga0439460_0162311 3300042461 Unclassified 750
174 Ga0451577_0007127 3300042876 Bacteria 11026
175 Ga0453683_0024017 3300044673 Bacteria 3882
176 Ga0453684_0007625 3300044712 Bacteria 19821
177 Ga0453684_0022121 3300044712 Bacteria 9454
178 Ga0451576_0042877 3300045051 Bacteria 4777
179 Ga0495582_0011327 3300046473 Bacteria 4913
180 Ga0495639_0456479 3300046475 Bacteria 649
181 Ga0495666_0315332 3300046526 Bacteria 706
182 Ga0495658_0002012 3300046683 Bacteria 10359
183 Ga0495593_0556444 3300047673 Bacteria 575
184 Ga0496124_0016491 3300048927 Bacteria 7017
185 Ga0501034_1153129 3300049571 Bacteria 655
186 Ga0501047_0313804 3300049581 Bacteria 1408
187 Ga0501047_0586272 3300049581 Bacteria 937
188 Ga0501069_0008568 3300049585 Bacteria 5378
189 Ga0501070_0014662 3300049586 Bacteria 6595
190 Ga0501070_0299402 3300049586 Unclassified 1310
191 Ga0501071_0338549 3300049587 Bacteria 1144
192 Ga0501074_0014559 3300049590 Bacteria 5722
193 Ga0501077_0062311 3300049593 Bacteria 2367
194 Ga0501202_171846 3300049652 Unclassified 580
195 Ga0501257_149127 3300049686 Unclassified 644
196 Ga0501080_0039782 3300049742 Bacteria 4387
197 Ga0501035_0023395 3300049822 Bacteria 5667
198 Ga0501044_0085054 3300049823 Bacteria 3196
199 nmdc:mga05p37_152358_c1 3300050507 Bacteria 2827
200 nmdc:mga05p37_451282_c1 3300050507 Bacteria 1488
201 nmdc:mga05p37_81_c1 3300050507 Bacteria 84634
202 nmdc:mga09592_346634_c1 3300050508 Bacteria 1286
203 nmdc:mga0qj67_200373_c1 3300050509 Bacteria 1622
204 nmdc:mga06r32_108217_c1 3300050510 Bacteria 2732
205 nmdc:mga06r32_17150_c1 3300050510 Bacteria 6610
206 nmdc:mga08y16_142557_c1 3300050511 Unclassified 2491
207 nmdc:mga0n895_951429_c1 3300050512 Unclassified 842
208 nmdc:mga0rr50_64_c1 3300050513 Bacteria 63318
209 nmdc:mga08x19_61_c1 3300050514 Bacteria 114972
210 nmdc:mga0a205_260089_c1 3300050515 Bacteria 1613
211 Ga0070682_100419880
212 Ga0065707_10106010
213 Ga0070683_100528261
214 Ga0070680_100007808
215 Ga0070680_100611784
216 Ga0070661_100152597
217 Ga0070692_11009025
218 Ga0070669_100131448
219 Ga0070675_101534882
220 Ga0070675_101756372
221 Ga0070671_101165905
222 Ga0070671_101480314
223 Ga0070659_100063232
224 Ga0070659_100322894
225 Ga0070701_10052597
226 Ga0070701_10865836
227 Ga0070694_100841139
228 Ga0070708_100010621
229 Ga0070708_100343492
230 Ga0070663_100344449
231 Ga0070678_100559658
232 Ga0070681_10006858
233 Ga0068867_101013667
234 Ga0070685_11578357
235 Ga0070706_100003539
236 Ga0070706_100025830
237 Ga0070706_101202299
238 Ga0070707_100007032
239 Ga0070707_100020302
240 Ga0070707_100642090
241 Ga0070698_100259375
242 Ga0070698_100874107
243 Ga0070699_100129167
244 Ga0070699_100161011
245 Ga0070699_100580893
246 Ga0070679_100102447
247 Ga0070679_101685030
248 Ga0070697_100001471
249 Ga0070697_100016746
250 Ga0070697_100030358
251 Ga0070697_100396902
252 Ga0070697_100532654
253 Ga0070697_101508601
254 Ga0068853_100062556
255 Ga0070672_100478044
256 Ga0070672_101277069
257 Ga0070686_100005485
258 Ga0070686_100135582
259 Ga0070704_100001508
260 Ga0070704_100308009
261 Ga0068855_100038501
262 Ga0068855_101044289
263 Ga0070664_100989395
264 Ga0070664_101326251
265 Ga0068857_100670959
266 Ga0068854_100360554
267 Ga0068854_100688425
268 Ga0068852_100037592
269 Ga0068852_100819031
270 Ga0068859_100111097
271 Ga0068859_101592920
272 Ga0068861_100006707
273 Ga0068861_100073336
274 Ga0068863_100524467
275 Ga0068858_100422220
276 Ga0068858_102313133
277 Ga0068862_100130695
278 Ga0068862_102090471
279 Ga0068871_100669884
280 Ga0075428_100001970
281 Ga0075430_100016853
282 Ga0075431_100029669
283 Ga0075431_100289853
284 Ga0075433_10389461
285 Ga0075434_101555494
286 Ga0075429_100002954
287 Ga0068865_100355473
288 Ga0075436_100000044
289 Ga0097620_100111094
290 Ga0097620_101592638
291 Ga0075435_100001106
292 Ga0099794_10176280
293 Ga0099794_10385347
294 Ga0105240_10030376
295 Ga0111539_10181188
296 Ga0105247_10200336
297 Ga0114129_10008055
298 Ga0114129_10686827
299 Ga0105243_10045786
300 Ga0105242_10555815
301 Ga0105237_10043821
302 Ga0105237_10181175
303 Ga0105249_10021661
304 Ga0105239_10151875
305 Ga0105239_11038050
306 Ga0157373_10182241
307 Ga0157370_10058663
308 Ga0157369_10050846
309 Ga0157378_10057128
310 Ga0157372_10050062
311 Ga0157375_10469497
312 Ga0157380_10012748
313 Ga0157380_10074790
314 Ga0157377_11354584
315 Ga0207680_10486013
316 Ga0207645_10466081
317 Ga0207705_10087031
318 Ga0207684_10001598
319 Ga0207684_10031401
320 Ga0207684_10198565
321 Ga0207684_10211839
322 Ga0207684_10266134
323 Ga0207707_10026597
324 Ga0207695_10337607
325 Ga0207660_10147314
326 Ga0207662_10325775
327 Ga0207652_10028418
328 Ga0207646_10000518
329 Ga0207646_10003776
330 Ga0207646_10048360
331 Ga0207650_10169592
332 Ga0207650_10753198
333 Ga0207690_10048966
334 Ga0207706_10506900
335 Ga0207709_10024502
336 Ga0207665_10000025
337 Ga0207665_11051904
338 Ga0207691_10068615
339 Ga0207691_10348603
340 Ga0207661_10259470
341 Ga0207661_10908650
342 Ga0207667_10089311
343 Ga0207651_11020373
344 Ga0207712_10160239
345 Ga0207677_12195137
346 Ga0207703_10427841
347 Ga0207703_11775856
348 Ga0207639_10018412
349 Ga0207678_10433297
350 Ga0207675_100002801
351 Ga0207675_100055348
352 Ga0207698_10654496
353 Ga0207698_10819354
354 Ga0210000_1027774
355 Ga0268265_11088766
356 Ga0268265_11962049
357 Ga0268264_12118019
358 Ga0265326_10109022
359 Ga0265323_10011309
360 Ga0265323_10020544
361 Ga0265323_10126296
362 Ga0265328_10343675
363 Ga0265331_10010470
364 Ga0265327_10000005
365 Ga0265316_10002087
366 Ga0265316_10052201
367 Ga0265342_10023511
368 Ga0307405_11032762
369 Ga0307405_11127741
370 Ga0307410_10175574
371 Ga0307406_10122267
372 Ga0307406_10693981
373 Ga0307407_11318923
374 Ga0307416_100134613
375 Ga0307416_101150533
376 Ga0307411_10662504
377 Ga0307415_100153813
378 Ga0316583_10009087
379 Ga0395905_0004746
380 Ga0436364_1415831
381 Ga0439449_0107480
382 Ga0439455_0067186
383 Ga0439460_0162311
384 Ga0451577_0007127
385 Ga0453683_0024017
386 Ga0453684_0007625
387 Ga0453684_0022121
388 Ga0451576_0042877
389 Ga0495582_0011327
390 Ga0495639_0456479
391 Ga0495666_0315332
392 Ga0495658_0002012
393 Ga0495593_0556444
394 Ga0496124_0016491
395 Ga0501034_1153129
396 Ga0501047_0313804
397 Ga0501047_0586272
398 Ga0501069_0008568
399 Ga0501070_0014662
400 Ga0501070_0299402
401 Ga0501071_0338549
402 Ga0501074_0014559
403 Ga0501077_0062311
404 Ga0501202_171846
405 Ga0501257_149127
406 Ga0501080_0039782
407 Ga0501035_0023395
408 Ga0501044_0085054
409 nmdc:mga05p37_152358_c1
410 nmdc:mga05p37_451282_c1
411 nmdc:mga05p37_81_c1
412 nmdc:mga09592_346634_c1
413 nmdc:mga0qj67_200373_c1
414 nmdc:mga06r32_108217_c1
415 nmdc:mga06r32_17150_c1
416 nmdc:mga08y16_142557_c1
417 nmdc:mga0n895_951429_c1
418 nmdc:mga0rr50_64_c1
419 nmdc:mga08x19_61_c1
420 nmdc:mga0a205_260089_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01451

LMWPc

Low molecular weight phosphotyrosine protein phosphatase

7

128

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ljl-assembly1.cif.gz_A wild type pi258 s. aureus arsenate reductase 0.9131 13 137
1rxi-assembly1.cif.gz_A pi258 arsenate reductase (arsc) triple mutant c10s/c15a/c82s 0.9037 14 137
8p5n-assembly2.cif.gz_B arsenate reductase (arsc2) from deinococcus indicus, co-crystallized with arsenate 0.9018 14 139
2myu-assembly1.cif.gz_A an arsenate reductase in oxidized state 0.9002 15 141
8p6m-assembly1.cif.gz_B arsenate reductase (arsc2) from deinococcus indicus 0.8943 14 138
ID Description Score Start End Superfamily
af_I6X4W4_364_495_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9329 15 145 3.40.50.2300
af_I6X4W4_364_495_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9195 15 145 3.40.50.2300
2myuA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9002 15 141 3.40.50.2300
3t38B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8752 14 145 3.40.50.2300
2myuA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8683 15 141 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A7X3Q697-F1-model_v4 deleted 0.9992 13 141
AF-A0A6B0XWD6-F1-model_v4 Arsenate reductase ArsC 0.9984 31 141 GO:0046685
AF-A0A6I6GZ29-F1-model_v4 deleted 0.9966 15 139
AF-A0A1F9UVP3-F1-model_v4 Phosphotyrosine protein phosphatase I domain-containing protein 0.9925 14 143 GO:0046685
AF-A0A2V6GL75-F1-model_v4 Arsenate reductase ArsC 0.9924 26 131 GO:0046685

Map