F319873

General Info

Members Datasets Scaffolds Average Seq Length
210 155 186 229

Family's Representative Sequence

Representative Sequence 3300003794|Ga0055531_10014720|Ga0055531_100147203
Length 254
Sequence VQMRWRYPTPALAQTHPNAAAQPAERLMRILMVLTSHDTLGNTGHKTGFWLEEFASPYYVFTDAGVSVTVVSPKGGQPPIDPKSDDPNNQTEAQTRFKADRKALEVLANTLRLDSVSAEDFDTVFYPGGHGPMWDLAEDPHSIKLIESFYDSGKPVAAVCHAPGVLRHVKHKGEPIVKGKRVAGFTNTEEAEVQLTDVVPFLVEDELKRLGGLYQKTDNWYPFAVVDGRLITGQNPSSSTITAETLLRLMKSLS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
3 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
4 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
5 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
6 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
7 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
8 2739367700 Dyella sp. YR388 Isolate Unclassified
9 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
10 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
11 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
12 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
13 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
14 2818991457 Xanthomonas translucens 569 Isolate Unclassified
15 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
16 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
17 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
18 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
19 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
20 2919150387 Rahnella aceris 1817 Isolate Unclassified
21 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
22 2927143783 Rahnella sp. 2050 Isolate Unclassified
23 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
24 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
25 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
26 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
27 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
28 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
29 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
30 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
31 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
32 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
33 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
34 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
35 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
36 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
37 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
38 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
39 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
40 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
53 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
58 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
61 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
67 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
68 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
69 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
71 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
72 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
74 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
77 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
90 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
91 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
92 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
93 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
94 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
95 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
96 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
97 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
98 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
99 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
100 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
101 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
102 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
103 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
104 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
105 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
106 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
107 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
108 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
109 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
110 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
111 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
112 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
113 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
114 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
115 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
116 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
117 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
118 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
119 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
120 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
121 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
122 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
123 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
124 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
125 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
126 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
127 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
128 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
129 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
130 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
131 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
132 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
133 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
134 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
135 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
136 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
137 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
138 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
139 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
140 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
141 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
142 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
143 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
144 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
145 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
146 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
147 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
148 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
149 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
150 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
152 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
153 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
154 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
155 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.57
Metatranscriptomes 0
Isolates 11.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.57
Nodule 0.95
Rhizoplane 7.14
Rhizosphere 50
Stem 0
Stem Tuber 0
Unclassified 23.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2899781 2162886007 Bacteria 3945
2 SwRhRL2b_contig_719850 2162886007 Bacteria 4508
3 JGI25156J39149_1000205 3300002705 Bacteria 40906
4 JGI25163J39215_1000193 3300002771 Bacteria 23709
5 JGI25164J39214_1000014 3300002772 Bacteria 219691
6 rootH2_10047650 3300003320 Bacteria 2835
7 rootH1_10048395 3300003323 Bacteria 8360
8 Ga0055538_1000005 3300003751 Bacteria 575218
9 Ga0055539_1000007 3300003752 Bacteria 575218
10 Ga0055533_1000009 3300003756 Bacteria 575218
11 Ga0055525_1000010 3300003759 Bacteria 575218
12 Ga0055527_1005355 3300003760 Bacteria 1675
13 Ga0055536_1000204 3300003781 Bacteria 48447
14 Ga0055536_1008711 3300003781 Bacteria 4312
15 Ga0055536_1014122 3300003781 Bacteria 2828
16 Ga0055530_10010492 3300003791 Bacteria 3418
17 Ga0055531_10014720 3300003794 Bacteria 3503
18 Ga0055531_10015811 3300003794 Bacteria 3298
19 Ga0055531_10051005 3300003794 Bacteria 1090
20 Ga0055541_1000005 3300003841 Bacteria 575218
21 Ga0058692_1000090 3300003856 Bacteria 62885
22 Ga0065704_10000763 3300005289 Bacteria 34745
23 Ga0065704_10070903 3300005289 Bacteria 14826
24 Ga0065704_10080227 3300005289 Bacteria 3987
25 Ga0070670_100000993 3300005331 Bacteria 22311
26 Ga0070714_100527815 3300005435 Bacteria 1128
27 Ga0070714_100700585 3300005435 Bacteria 977
28 Ga0070663_100018754 3300005455 Bacteria 4544
29 Ga0070679_100146938 3300005530 Bacteria 2335
30 Ga0068855_101214901 3300005563 Bacteria 783
31 Ga0070664_100308378 3300005564 Bacteria 1432
32 Ga0070702_100604169 3300005615 Bacteria 823
33 Ga0070715_10296645 3300006163 Bacteria 863
34 Ga0075430_100036126 3300006846 Bacteria 4190
35 Ga0075431_100042751 3300006847 Bacteria 4674
36 Ga0075433_10130356 3300006852 Bacteria 2234
37 Ga0075434_100796277 3300006871 Bacteria 961
38 Ga0105251_10000272 3300009011 Bacteria 51783
39 Ga0105244_10000194 3300009036 Bacteria 61396
40 Ga0105243_10008468 3300009148 Bacteria 7895
41 Ga0157371_10007508 3300013102 Bacteria 8821
42 Ga0163162_10296741 3300013306 Bacteria 1748
43 Ga0163162_10479839 3300013306 Bacteria 1375
44 Ga0182006_1017511 3300015261 Bacteria 3042
45 Ga0182005_1001045 3300015265 Bacteria 11706
46 Ga0163161_10347116 3300017792 Bacteria 1179
47 Ga0209760_100001 3300025207 Bacteria 348781
48 Ga0209784_100001 3300025224 Bacteria 3600592
49 Ga0209566_100001 3300025225 Bacteria 3600765
50 Ga0209674_100002 3300025226 Bacteria 3600592
51 Ga0209672_100675 3300025228 Bacteria 17217
52 Ga0209563_100008 3300025230 Bacteria 1554545
53 Ga0207427_100002 3300025231 Bacteria 1355321
54 Ga0209437_100007 3300025233 Bacteria 938377
55 Ga0209026_1005469 3300025250 Bacteria 3414
56 Ga0209677_100004 3300025253 Bacteria 1554545
57 Ga0209759_1000002 3300025256 Bacteria 1027596
58 Ga0209233_1016217 3300025261 Bacteria 2057
59 Ga0209455_1004719 3300025272 Bacteria 4382
60 Ga0209130_1013781 3300025284 Bacteria 2058
61 Ga0209675_1013192 3300025291 Bacteria 2603
62 Ga0209676_1000075 3300025292 Bacteria 303609
63 Ga0209676_1000674 3300025292 Bacteria 48485
64 Ga0209676_1015206 3300025292 Bacteria 2844
65 Ga0209025_1004950 3300025294 Bacteria 11174
66 Ga0209025_1092935 3300025294 Bacteria 980
67 Ga0209564_1005110 3300025295 Bacteria 7635
68 Ga0209050_1004450 3300025298 Bacteria 9458
69 Ga0209051_1010105 3300025303 Bacteria 4801
70 Ga0209257_1000498 3300025304 Bacteria 70112
71 Ga0209257_1003504 3300025304 Bacteria 13364
72 Ga0209257_1042518 3300025304 Bacteria 1340
73 Ga0207696_1000444 3300025711 Bacteria 36917
74 Ga0207655_1000157 3300025728 Bacteria 124885
75 Ga0207713_1000379 3300025735 Bacteria 48102
76 Ga0207692_10215810 3300025898 Bacteria 1135
77 Ga0207660_10514112 3300025917 Bacteria 972
78 Ga0207652_10111408 3300025921 Bacteria 2427
79 Ga0207650_10005735 3300025925 Bacteria 8471
80 Ga0207709_10009937 3300025935 Bacteria 5240
81 Ga0209371_1000043 3300027312 Bacteria 331009
82 Ga0268256_1000044 3300030500 Bacteria 330997
83 Ga0265331_10186423 3300031250 Bacteria 936
84 Ga0307513_10306500 3300031456 Bacteria 1352
85 Ga0316576_10069442 3300031727 Bacteria 2598
86 Ga0316576_10195308 3300031727 Bacteria 1525
87 Ga0307406_10206497 3300031901 Bacteria 1450
88 Ga0307414_10025387 3300032004 Bacteria 3795
89 Ga0307414_10029627 3300032004 Bacteria 3565
90 Ga0316584_0037655 3300036712 Bacteria 3595
91 Ga0395905_0255997 3300037471 Bacteria 1635
92 Ga0395905_0528627 3300037471 Bacteria 1080
93 Ga0439436_0011733 3300041404 Bacteria 2661
94 Ga0451791_1345811 3300041451 Bacteria 1003
95 Ga0451800_1161449 3300041459 Bacteria 1137
96 Ga0451851_0773014 3300041507 Bacteria 1057
97 Ga0439449_0004160 3300042007 Bacteria 5596
98 Ga0439452_021323 3300042010 Bacteria 1690
99 Ga0451577_0000118 3300042876 Bacteria 174137
100 Ga0451577_0035509 3300042876 Bacteria 4490
101 Ga0451577_0054256 3300042876 Bacteria 3578
102 Ga0451577_0081668 3300042876 Bacteria 2883
103 Ga0451577_0616374 3300042876 Bacteria 984
104 Ga0451577_0862709 3300042876 Bacteria 816
105 Ga0453683_0000027 3300044673 Bacteria 248505
106 Ga0453683_0000036 3300044673 Bacteria 232009
107 Ga0453684_0000416 3300044712 Bacteria 174046
108 Ga0453684_0001501 3300044712 Bacteria 65687
109 Ga0453684_0002808 3300044712 Bacteria 41155
110 Ga0453684_0003337 3300044712 Bacteria 36435
111 Ga0453684_0038108 3300044712 Bacteria 6581
112 Ga0453684_0044983 3300044712 Bacteria 5895
113 Ga0453684_0371466 3300044712 Bacteria 1608
114 Ga0451576_0000069 3300045051 Bacteria 259862
115 Ga0451576_0000319 3300045051 Bacteria 116651
116 Ga0451576_0000820 3300045051 Bacteria 60721
117 Ga0451576_0452917 3300045051 Bacteria 1347
118 Ga0495627_011558 3300046453 Bacteria 3165
119 Ga0495638_0000112 3300046460 Bacteria 130876
120 Ga0495650_0000016 3300046471 Bacteria 554693
121 Ga0495650_0003484 3300046471 Bacteria 11433
122 Ga0495606_0000134 3300046507 Bacteria 125913
123 Ga0495606_0007844 3300046507 Bacteria 9424
124 Ga0495610_0002433 3300046512 Bacteria 15661
125 Ga0495631_0166197 3300046518 Bacteria 946
126 Ga0495648_0011187 3300046524 Bacteria 6778
127 Ga0495648_0050728 3300046524 Bacteria 2533
128 Ga0495642_0065905 3300046528 Bacteria 1508
129 Ga0495652_0321438 3300046529 Bacteria 1118
130 Ga0495609_0093871 3300046538 Bacteria 1303
131 Ga0495597_0043396 3300046542 Bacteria 2003
132 Ga0495622_0003024 3300046557 Bacteria 7976
133 Ga0495667_0154143 3300046559 Bacteria 1479
134 Ga0495625_0015376 3300046660 Bacteria 6064
135 Ga0495661_0053492 3300046665 Bacteria 2428
136 Ga0495670_0286310 3300046691 Bacteria 882
137 Ga0495649_0000173 3300046694 Bacteria 56514
138 Ga0495660_0000007 3300046810 Bacteria 485295
139 Ga0495680_0168613 3300047322 Bacteria 1586
140 Ga0495681_0000986 3300047470 Bacteria 21800
141 Ga0495615_0139437 3300048090 Bacteria 714
142 Ga0495626_0054144 3300048091 Bacteria 1843
143 Ga0496100_0005631 3300048903 Bacteria 6770
144 Ga0496104_0423116 3300048907 Bacteria 1244
145 Ga0496108_0052143 3300048911 Bacteria 3427
146 Ga0496109_0389577 3300048912 Bacteria 1316
147 Ga0496110_0029299 3300048913 Bacteria 4736
148 Ga0496111_0023907 3300048914 Bacteria 4295
149 Ga0496112_0011738 3300048915 Bacteria 8020
150 Ga0496114_0000155 3300048917 Bacteria 49214
151 Ga0496114_0423226 3300048917 Bacteria 1180
152 Ga0496115_0000495 3300048918 Bacteria 31032
153 Ga0496115_0007006 3300048918 Bacteria 8281
154 Ga0496115_0086528 3300048918 Bacteria 2557
155 Ga0496116_0000127 3300048919 Bacteria 158773
156 Ga0496116_0025815 3300048919 Bacteria 4310
157 Ga0496117_0000368 3300048920 Bacteria 78448
158 Ga0496117_0004360 3300048920 Bacteria 15698
159 Ga0496118_0001275 3300048921 Bacteria 38632
160 Ga0496118_0087895 3300048921 Bacteria 2152
161 Ga0496118_0133968 3300048921 Bacteria 1584
162 Ga0496119_0000450 3300048922 Bacteria 56283
163 Ga0496119_0000779 3300048922 Bacteria 42634
164 Ga0496119_0034122 3300048922 Bacteria 3358
165 Ga0496120_0000458 3300048923 Bacteria 64377
166 Ga0496120_0009492 3300048923 Bacteria 6893
167 Ga0496122_0000013 3300048925 Bacteria 501039
168 Ga0496122_0000896 3300048925 Bacteria 55027
169 Ga0496122_0136449 3300048925 Bacteria 1545
170 Ga0496123_0000010 3300048926 Bacteria 501039
171 Ga0496123_0000137 3300048926 Bacteria 152169
172 Ga0496123_0230420 3300048926 Bacteria 927
173 Ga0496124_0000515 3300048927 Bacteria 66726
174 Ga0496124_0000725 3300048927 Bacteria 54102
175 Ga0496125_0000019 3300048928 Bacteria 474989
176 Ga0496125_0008045 3300048928 Bacteria 11130
177 Ga0496126_0001396 3300048929 Bacteria 38235
178 Ga0496126_0002648 3300048929 Bacteria 23744
179 Ga0496126_0016963 3300048929 Bacteria 7266
180 Ga0496126_0034622 3300048929 Bacteria 4742
181 Ga0496126_0127207 3300048929 Bacteria 2204
182 Ga0495678_006932 3300049459 Bacteria 5948
183 Ga0501034_0000521 3300049571 Bacteria 61943
184 Ga0501043_0001103 3300049579 Bacteria 23737
185 nmdc:mga0qj67_189782_c1 3300050509 Bacteria 1670
186 nmdc:mga06r32_35635_c1 3300050510 Bacteria 4695

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048907 Ga0496104_0423116 Ga0496104_0423116_15_596 186
2 3300005435 Ga0070714_100700585 Ga0070714_1007005851 216
3 3300025898 Ga0207692_10215810 Ga0207692_102158101 216
4 iso_pu_bacteria 2739367700 2739733893 220
5 iso_pu_bacteria 2818991272 2819242781 220
6 iso_pu_bacteria 8005246636 8005246837 220
7 3300042876 Ga0451577_0616374 Ga0451577_0616374_267_941 221
8 iso_pu_bacteria 2643221579 2643909324 221
9 iso_pu_bacteria 2643221581 2643914827 221
10 iso_pu_bacteria 2687453129 2687579866 221
11 iso_pu_bacteria 2818991457 2819661229 221
12 iso_pu_bacteria 2852103415 2852105493 221
13 iso_pu_bacteria 2923516293 2923517266 221
14 iso_pu_bacteria 8024486573 8024489453 221
15 3300005435 Ga0070714_100527815 Ga0070714_1005278152 222
16 3300025921 Ga0207652_10111408 Ga0207652_101114082 222
17 3300046518 Ga0495631_0166197 Ga0495631_0166197_237_935 222
18 3300048911 Ga0496108_0052143 Ga0496108_0052143_2418_3101 222
19 3300048912 Ga0496109_0389577 Ga0496109_0389577_474_1157 222
20 3300048913 Ga0496110_0029299 Ga0496110_0029299_321_1004 222
21 3300048914 Ga0496111_0023907 Ga0496111_0023907_2361_3044 222
22 3300048915 Ga0496112_0011738 Ga0496112_0011738_3184_3867 222
23 iso_pu_bacteria 2523231067 2523470835 222
24 iso_pu_bacteria 2596583598 2597032768 222
25 iso_pu_bacteria 2667528173 2671108175 222
26 iso_pu_bacteria 2739367866 2740033470 222
27 iso_pu_bacteria 2744054900 2746084609 222
28 iso_pu_bacteria 2744054901 2746098531 222
29 iso_pu_bacteria 2747842428 2747949758 222
30 iso_pu_bacteria 2852684882 2852687098 222
31 iso_pu_bacteria 2904474040 2904475153 222
32 iso_pu_bacteria 2919130084 2919131128 222
33 iso_pu_bacteria 2919150387 2919151499 222
34 iso_pu_bacteria 2927143783 2927146373 222
35 iso_pu_bacteria 2929195423 2929196368 222
36 3300003760 Ga0055527_1005355 Ga0055527_10053552 224
37 3300003781 Ga0055536_1000204 Ga0055536_100020412 224
38 3300003794 Ga0055531_10015811 Ga0055531_100158113 224
39 3300005455 Ga0070663_100018754 Ga0070663_1000187542 224
40 3300025228 Ga0209672_100675 Ga0209672_1006755 224
41 3300025272 Ga0209455_1004719 Ga0209455_10047192 224
42 3300025291 Ga0209675_1013192 Ga0209675_10131922 224
43 3300025292 Ga0209676_1000674 Ga0209676_100067435 224
44 3300025294 Ga0209025_1004950 Ga0209025_100495010 224
45 3300025294 Ga0209025_1092935 Ga0209025_10929352 224
46 3300025304 Ga0209257_1000498 Ga0209257_10004987 224
47 3300031250 Ga0265331_10186423 Ga0265331_101864231 224
48 3300041404 Ga0439436_0011733 Ga0439436_0011733_25_699 224
49 3300042007 Ga0439449_0004160 Ga0439449_0004160_442_1116 224
50 3300042010 Ga0439452_021323 Ga0439452_021323_819_1493 224
51 3300042876 Ga0451577_0000118 Ga0451577_0000118_138107_138781 224
52 3300042876 Ga0451577_0035509 Ga0451577_0035509_34_708 224
53 3300042876 Ga0451577_0054256 Ga0451577_0054256_393_1067 224
54 3300042876 Ga0451577_0862709 Ga0451577_0862709_114_788 224
55 3300044712 Ga0453684_0000416 Ga0453684_0000416_35357_36031 224
56 3300044712 Ga0453684_0001501 Ga0453684_0001501_13477_14151 224
57 3300044712 Ga0453684_0038108 Ga0453684_0038108_5143_5817 224
58 3300044712 Ga0453684_0044983 Ga0453684_0044983_4696_5370 224
59 3300045051 Ga0451576_0000319 Ga0451576_0000319_115001_115675 224
60 3300045051 Ga0451576_0000820 Ga0451576_0000820_25041_25715 224
61 3300045051 Ga0451576_0452917 Ga0451576_0452917_367_1041 224
62 3300046460 Ga0495638_0000112 Ga0495638_0000112_21271_21945 224
63 3300046507 Ga0495606_0000134 Ga0495606_0000134_51962_52636 224
64 3300046557 Ga0495622_0003024 Ga0495622_0003024_6276_6950 224
65 3300046660 Ga0495625_0015376 Ga0495625_0015376_1273_1947 224
66 3300046694 Ga0495649_0000173 Ga0495649_0000173_43096_43770 224
67 3300048918 Ga0496115_0000495 Ga0496115_0000495_12080_12754 224
68 3300048918 Ga0496115_0007006 Ga0496115_0007006_4324_4998 224
69 3300048929 Ga0496126_0002648 Ga0496126_0002648_14117_14791 224
70 3300048929 Ga0496126_0127207 Ga0496126_0127207_77_751 224
71 3300049459 Ga0495678_006932 Ga0495678_006932_4262_4936 224
72 3300049579 Ga0501043_0001103 Ga0501043_0001103_1184_1858 224
73 3300003781 Ga0055536_1014122 Ga0055536_10141223 225
74 3300003794 Ga0055531_10051005 Ga0055531_100510052 225
75 3300005289 Ga0065704_10070903 Ga0065704_100709036 225
76 3300017792 Ga0163161_10347116 Ga0163161_103471161 225
77 3300025250 Ga0209026_1005469 Ga0209026_10054693 225
78 3300025292 Ga0209676_1015206 Ga0209676_10152063 225
79 3300025298 Ga0209050_1004450 Ga0209050_100445010 225
80 3300025304 Ga0209257_1003504 Ga0209257_100350415 225
81 3300031727 Ga0316576_10069442 Ga0316576_100694426 225
82 3300031727 Ga0316576_10195308 Ga0316576_101953082 225
83 3300032004 Ga0307414_10025387 Ga0307414_100253875 225
84 3300036712 Ga0316584_0037655 Ga0316584_0037655_1179_1856 225
85 3300042876 Ga0451577_0081668 Ga0451577_0081668_1570_2247 225
86 3300044673 Ga0453683_0000027 Ga0453683_0000027_195925_196611 225
87 3300044673 Ga0453683_0000036 Ga0453683_0000036_14611_15288 225
88 3300044712 Ga0453684_0002808 Ga0453684_0002808_3714_4391 225
89 3300044712 Ga0453684_0003337 Ga0453684_0003337_19249_19935 225
90 3300045051 Ga0451576_0000069 Ga0451576_0000069_43153_43830 225
91 3300046507 Ga0495606_0007844 Ga0495606_0007844_6424_7110 225
92 3300046529 Ga0495652_0321438 Ga0495652_0321438_194_877 225
93 3300046559 Ga0495667_0154143 Ga0495667_0154143_299_982 225
94 3300047322 Ga0495680_0168613 Ga0495680_0168613_564_1247 225
95 3300048903 Ga0496100_0005631 Ga0496100_0005631_1536_2219 225
96 3300048917 Ga0496114_0000155 Ga0496114_0000155_47929_48606 225
97 3300048925 Ga0496122_0136449 Ga0496122_0136449_188_871 225
98 3300048926 Ga0496123_0230420 Ga0496123_0230420_46_729 225
99 3300048929 Ga0496126_0016963 Ga0496126_0016963_128_805 225
100 3300049571 Ga0501034_0000521 Ga0501034_0000521_28513_29190 225
101 2162886007 SwRhRL2b_contig_719850 SwRhRL2b_0653.00002710 226
102 3300002705 JGI25156J39149_1000205 JGI25156J39149_100020514 226
103 3300002771 JGI25163J39215_1000193 JGI25163J39215_100019319 226
104 3300002772 JGI25164J39214_1000014 JGI25164J39214_100001419 226
105 3300003320 rootH2_10047650 rootH2_100476504 226
106 3300003323 rootH1_10048395 rootH1_100483953 226
107 3300003751 Ga0055538_1000005 Ga0055538_1000005489 226
108 3300003752 Ga0055539_1000007 Ga0055539_1000007489 226
109 3300003756 Ga0055533_1000009 Ga0055533_1000009489 226
110 3300003759 Ga0055525_1000010 Ga0055525_1000010489 226
111 3300003781 Ga0055536_1008711 Ga0055536_10087112 226
112 3300003841 Ga0055541_1000005 Ga0055541_100000576 226
113 3300003856 Ga0058692_1000090 Ga0058692_100009015 226
114 3300005289 Ga0065704_10000763 Ga0065704_1000076313 226
115 3300005289 Ga0065704_10080227 Ga0065704_100802271 226
116 3300005331 Ga0070670_100000993 Ga0070670_10000099312 226
117 3300005563 Ga0068855_101214901 Ga0068855_1012149011 226
118 3300009036 Ga0105244_10000194 Ga0105244_100001943 226
119 3300009148 Ga0105243_10008468 Ga0105243_100084685 226
120 3300013306 Ga0163162_10479839 Ga0163162_104798392 226
121 3300015261 Ga0182006_1017511 Ga0182006_10175113 226
122 3300015265 Ga0182005_1001045 Ga0182005_10010457 226
123 3300025207 Ga0209760_100001 Ga0209760_100001245 226
124 3300025224 Ga0209784_100001 Ga0209784_1000011031 226
125 3300025225 Ga0209566_100001 Ga0209566_1000011031 226
126 3300025226 Ga0209674_100002 Ga0209674_1000021031 226
127 3300025230 Ga0209563_100008 Ga0209563_1000081033 226
128 3300025231 Ga0207427_100002 Ga0207427_100002245 226
129 3300025233 Ga0209437_100007 Ga0209437_100007485 226
130 3300025253 Ga0209677_100004 Ga0209677_1000041033 226
131 3300025256 Ga0209759_1000002 Ga0209759_1000002221 226
132 3300025261 Ga0209233_1016217 Ga0209233_10162172 226
133 3300025292 Ga0209676_1000075 Ga0209676_100007549 226
134 3300025711 Ga0207696_1000444 Ga0207696_100044410 226
135 3300025728 Ga0207655_1000157 Ga0207655_100015764 226
136 3300025735 Ga0207713_1000379 Ga0207713_100037911 226
137 3300025925 Ga0207650_10005735 Ga0207650_100057353 226
138 3300025935 Ga0207709_10009937 Ga0207709_100099373 226
139 3300027312 Ga0209371_1000043 Ga0209371_1000043240 226
140 3300030500 Ga0268256_1000044 Ga0268256_1000044240 226
141 3300031456 Ga0307513_10306500 Ga0307513_103065002 226
142 3300032004 Ga0307414_10029627 Ga0307414_100296272 226
143 3300041451 Ga0451791_1345811 Ga0451791_1345811_210_890 226
144 3300041459 Ga0451800_1161449 Ga0451800_1161449_93_794 226
145 3300041507 Ga0451851_0773014 Ga0451851_0773014_74_754 226
146 3300044712 Ga0453684_0371466 Ga0453684_0371466_547_1233 226
147 3300046453 Ga0495627_011558 Ga0495627_011558_1409_2095 226
148 3300046471 Ga0495650_0000016 Ga0495650_0000016_158715_159410 226
149 3300046471 Ga0495650_0003484 Ga0495650_0003484_1686_2372 226
150 3300046512 Ga0495610_0002433 Ga0495610_0002433_11193_11873 226
151 3300046524 Ga0495648_0011187 Ga0495648_0011187_854_1537 226
152 3300046524 Ga0495648_0050728 Ga0495648_0050728_1561_2244 226
153 3300046528 Ga0495642_0065905 Ga0495642_0065905_692_1378 226
154 3300046538 Ga0495609_0093871 Ga0495609_0093871_261_971 226
155 3300046691 Ga0495670_0286310 Ga0495670_0286310_88_777 226
156 3300046810 Ga0495660_0000007 Ga0495660_0000007_115014_115709 226
157 3300047470 Ga0495681_0000986 Ga0495681_0000986_20201_20887 226
158 3300048090 Ga0495615_0139437 Ga0495615_0139437_11_703 226
159 3300048091 Ga0495626_0054144 Ga0495626_0054144_661_1371 226
160 3300048918 Ga0496115_0086528 Ga0496115_0086528_240_926 226
161 3300048919 Ga0496116_0000127 Ga0496116_0000127_114935_115630 226
162 3300048919 Ga0496116_0025815 Ga0496116_0025815_3118_3798 226
163 3300048920 Ga0496117_0004360 Ga0496117_0004360_2331_3026 226
164 3300048921 Ga0496118_0001275 Ga0496118_0001275_6599_7294 226
165 3300048921 Ga0496118_0087895 Ga0496118_0087895_935_1615 226
166 3300048922 Ga0496119_0000450 Ga0496119_0000450_13300_13983 226
167 3300048922 Ga0496119_0034122 Ga0496119_0034122_1701_2396 226
168 3300048923 Ga0496120_0009492 Ga0496120_0009492_2380_3075 226
169 3300048925 Ga0496122_0000013 Ga0496122_0000013_163014_163709 226
170 3300048926 Ga0496123_0000010 Ga0496123_0000010_337331_338026 226
171 3300048927 Ga0496124_0000515 Ga0496124_0000515_38016_38711 226
172 3300048928 Ga0496125_0000019 Ga0496125_0000019_104736_105431 226
173 3300048928 Ga0496125_0008045 Ga0496125_0008045_1501_2181 226
174 3300048929 Ga0496126_0001396 Ga0496126_0001396_9671_10366 226
175 3300048929 Ga0496126_0034622 Ga0496126_0034622_1724_2404 226
176 3300005530 Ga0070679_100146938 Ga0070679_1001469383 227
177 3300005564 Ga0070664_100308378 Ga0070664_1003083781 227
178 3300005615 Ga0070702_100604169 Ga0070702_1006041691 227
179 3300006163 Ga0070715_10296645 Ga0070715_102966451 227
180 3300006846 Ga0075430_100036126 Ga0075430_1000361266 227
181 3300006847 Ga0075431_100042751 Ga0075431_1000427512 227
182 3300006852 Ga0075433_10130356 Ga0075433_101303563 227
183 3300006871 Ga0075434_100796277 Ga0075434_1007962772 227
184 3300025917 Ga0207660_10514112 Ga0207660_105141122 227
185 3300031901 Ga0307406_10206497 Ga0307406_102064972 227
186 3300037471 Ga0395905_0255997 Ga0395905_0255997_371_1087 227
187 3300046542 Ga0495597_0043396 Ga0495597_0043396_1236_1940 227
188 3300048917 Ga0496114_0423226 Ga0496114_0423226_183_893 227
189 3300050509 nmdc:mga0qj67_189782_c1 nmdc:mga0qj67_189782_c1_348_1076 227
190 3300050510 nmdc:mga06r32_35635_c1 nmdc:mga06r32_35635_c1_695_1423 227
191 3300003791 Ga0055530_10010492 Ga0055530_100104924 231
192 3300025295 Ga0209564_1005110 Ga0209564_10051105 231
193 3300025303 Ga0209051_1010105 Ga0209051_10101053 231
194 3300025304 Ga0209257_1042518 Ga0209257_10425183 231
195 3300003794 Ga0055531_10014720 Ga0055531_100147203 232
196 3300025284 Ga0209130_1013781 Ga0209130_10137812 232
197 iso_pu_bacteria 2908739725 2908746255 233
198 3300013102 Ga0157371_10007508 Ga0157371_100075082 235
199 3300013306 Ga0163162_10296741 Ga0163162_102967412 235
200 2162886007 SwRhRL2b_contig_2899781 SwRhRL2b_0615.00000600 236
201 3300009011 Ga0105251_10000272 Ga0105251_1000027249 236
202 3300037471 Ga0395905_0528627 Ga0395905_0528627_208_954 236
203 3300046665 Ga0495661_0053492 Ga0495661_0053492_874_1653 236
204 3300048920 Ga0496117_0000368 Ga0496117_0000368_50036_50746 236
205 3300048921 Ga0496118_0133968 Ga0496118_0133968_560_1270 236
206 3300048922 Ga0496119_0000779 Ga0496119_0000779_12463_13173 236
207 3300048923 Ga0496120_0000458 Ga0496120_0000458_29458_30168 236
208 3300048925 Ga0496122_0000896 Ga0496122_0000896_30590_31300 236
209 3300048926 Ga0496123_0000137 Ga0496123_0000137_30799_31509 236
210 3300048927 Ga0496124_0000725 Ga0496124_0000725_23922_24632 236

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17124

ThiJ_like

ThiJ/PfpI family-like

45

179

0.8

PF01965

DJ-1_PfpI

DJ-1/PfpI family

45

249

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
4p5p-assembly1.cif.gz_A x-ray structure of francisella tularensis rapid encystment protein 24 kda (rep24), gene product of ftn_0841 0.9541 11 234
4p5p-assembly1.cif.gz_A x-ray structure of francisella tularensis rapid encystment protein 24 kda (rep24), gene product of ftn_0841 0.9378 11 234
1u9c-assembly1.cif.gz_A crystallographic structure of apc35852 0.9281 10 235
4qyx-assembly1.cif.gz_A crystal structure of ydr533cp 0.927 10 234
1qvv-assembly1.cif.gz_D-2 crystal structure of the s. cerevisiae ydr533c protein 0.9249 12 236
ID Description Score Start End Superfamily
4p5pA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9538 11 234 3.40.50.880
af_Q54W12_1_221_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9534 11 230 3.40.50.880
4p5pA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9374 11 234 3.40.50.880
af_Q54W12_1_221_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9368 11 230 3.40.50.880
af_Q58377_26_203_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9298 10 235 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A351NYN2-F1-model_v4 Type 1 glutamine amidotransferase domain-containing protein 0.9983 137 234 GO:0005737
GO:0016740
GO:0019172
GO:0019243
AF-W4RWS6-F1-model_v4 ThiJ/PfpI family protein 0.9971 117 236 GO:0005737
GO:0019172
GO:0019243
AF-A0A455U1L9-F1-model_v4 DJ-1/PfpI domain-containing protein 0.9961 145 234 GO:0005737
GO:0019172
GO:0019243
AF-A0A844BBE8-F1-model_v4 DJ-1/PfpI family protein 0.9956 133 235 GO:0005737
GO:0019172
GO:0019243
AF-A0A2N8FPJ5-F1-model_v4 deleted 0.9935 11 100

Feature Viewer

pLDDT pTM Quality
93.23 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map