F319840

General Info

Members Datasets Scaffolds Average Seq Length
210 138 199 379

Family's Representative Sequence

Representative Sequence 3300002737|JGI25162J39368_1000774|JGI25162J39368_10007743
Length 426
Sequence LFFDCTFCVINRHDGFIGVYTPQQIPIFNTLTYICYKLKELQDIVNAFNMAVKTGRQTALATVVLVEGSSYRRAGARMLVTDDGQLTGAISGGCLEGDALRKARLAMAHTRPMLVTYDTTDDDDAKFGVGLGCNGIIHILIEPIDPDKEDTPISLLKQFLSKREPVVLITMFSLKERQASQPGTCLLMCNDKQTRGSIPDNEIKTALLRDAAEVLANGNSVTKTYVYGNGYTCFIELLRPAVSLMIFGAGNDAIPLVQFANVLGWQVTLVDGRANYAVPQRFPSVNKILIAKPEQVLPQLYFDDRTVVVLMTHNYNYDMAMLQQLLPLQLPYVASLGPKKRLQRMLTELKDNGIIITTEQLNSIYGPAGIDIGSENADEIALSIIAEIQAVLNNRTVSSLRDKTSVHNRHIQQVLQQTDGEFKAFN

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
3 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
4 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
5 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
6 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
7 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
8 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
9 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
10 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
11 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
12 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
13 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
14 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
15 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
16 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
17 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
18 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
19 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
20 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
21 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
22 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
23 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
24 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
62 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
63 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
64 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
65 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
66 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
67 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
70 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
95 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
96 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
97 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
98 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
99 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
100 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
101 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
102 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
105 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
106 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
107 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
108 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
109 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
110 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
111 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
112 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
113 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
114 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
115 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
116 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
117 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
118 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
119 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
120 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
121 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
122 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
123 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
124 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
125 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
128 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
130 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
131 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
132 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
133 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
134 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
135 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
136 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
137 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
138 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.81
Metatranscriptomes 0.95
Isolates 5.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.14
Nodule 0
Rhizoplane 0.48
Rhizosphere 70.48
Stem 0
Stem Tuber 0
Unclassified 11.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10003274 3300001990 Bacteria 5744
2 JGI24737J22298_10016020 3300001990 Bacteria 2420
3 JGI24735J21928_10000004 3300002067 Bacteria 381713
4 JGI25162J39368_1000292 3300002737 Bacteria 46381
5 JGI25162J39368_1000774 3300002737 Bacteria 21551
6 JGI25154J39366_1000005 3300002738 Bacteria 345115
7 JGI25165J46597_1001445 3300003214 Bacteria 12601
8 JGI25153J46596_10016224 3300003215 Bacteria 2995
9 rootH1_10017068 3300003316 Bacteria 8847
10 rootH2_10005500 3300003320 Bacteria 68238
11 rootH2_10162172 3300003320 Bacteria 2565
12 rootH1_10009528 3300003323 Bacteria 31356
13 rootH1_10071763 3300003323 Bacteria 10790
14 rootH1_10108398 3300003323 Bacteria 2490
15 rootH1_10370954 3300003323 Bacteria 2306
16 JGI25160J50197_1017458 3300003354 Bacteria 2272
17 Ga0055526_1017841 3300003771 Bacteria 2685
18 Ga0055528_1000105 3300003790 Bacteria 67910
19 Ga0058863_11615853 3300004799 Bacteria 1424
20 Ga0058862_11959936 3300004803 Bacteria 1561
21 Ga0065165_1000168 3300005262 Bacteria 115574
22 Ga0065714_10004282 3300005288 Bacteria 6495
23 Ga0070658_10000073 3300005327 Bacteria 96498
24 Ga0070658_10016212 3300005327 Bacteria 5962
25 Ga0068869_100016079 3300005334 Bacteria 5037
26 Ga0070666_10000050 3300005335 Bacteria 100280
27 Ga0070674_100025331 3300005356 Bacteria 3861
28 Ga0070659_100000640 3300005366 Bacteria 25630
29 Ga0070659_100006161 3300005366 Bacteria 8658
30 Ga0070667_100049300 3300005367 Bacteria 3546
31 Ga0070681_10163995 3300005458 Bacteria 2146
32 Ga0070679_100041499 3300005530 Bacteria 4578
33 Ga0068855_100000226 3300005563 Bacteria 72130
34 Ga0068855_100008956 3300005563 Bacteria 12100
35 Ga0068855_100012697 3300005563 Bacteria 10164
36 Ga0068855_100055810 3300005563 Bacteria 4637
37 Ga0068855_100148189 3300005563 Unclassified 2670
38 Ga0068857_100021988 3300005577 Bacteria 5613
39 Ga0068854_100044792 3300005578 Bacteria 3143
40 Ga0068856_100000044 3300005614 Bacteria 111437
41 Ga0068856_100015723 3300005614 Bacteria 7317
42 Ga0068852_100003986 3300005616 Bacteria 10377
43 Ga0068859_100000025 3300005617 Bacteria 191679
44 Ga0068864_100012580 3300005618 Bacteria 6996
45 Ga0068863_100063617 3300005841 Bacteria 3489
46 Ga0068858_100018416 3300005842 Bacteria 6537
47 Ga0075366_10000123 3300006195 Bacteria 32043
48 Ga0075366_10000490 3300006195 Bacteria 18314
49 Ga0097621_100030922 3300006237 Bacteria 4242
50 Ga0068871_100002075 3300006358 Bacteria 13555
51 Ga0097620_100000025 3300006931 Bacteria 191679
52 Ga0105240_10010268 3300009093 Bacteria 13181
53 Ga0105240_10065114 3300009093 Bacteria 4525
54 Ga0105240_10185199 3300009093 Bacteria 2453
55 Ga0105247_10005807 3300009101 Bacteria 7719
56 Ga0105241_10005149 3300009174 Bacteria 9644
57 Ga0105237_10005071 3300009545 Bacteria 14963
58 Ga0105237_10009007 3300009545 Bacteria 10732
59 Ga0105237_10014702 3300009545 Bacteria 8172
60 Ga0105237_10022673 3300009545 Bacteria 6441
61 Ga0105249_10006762 3300009553 Bacteria 9991
62 Ga0105239_10000012 3300010375 Bacteria 332279
63 Ga0105239_10000305 3300010375 Bacteria 72644
64 Ga0105239_10000959 3300010375 Bacteria 40551
65 Ga0157373_10000249 3300013100 Bacteria 44077
66 Ga0157373_10000464 3300013100 Bacteria 32220
67 Ga0157371_10000617 3300013102 Bacteria 42318
68 Ga0157371_10012452 3300013102 Bacteria 6501
69 Ga0157371_10175633 3300013102 Bacteria 1531
70 Ga0157370_10104123 3300013104 Unclassified 2656
71 Ga0157369_10009731 3300013105 Bacteria 10993
72 Ga0163162_10000344 3300013306 Bacteria 42218
73 Ga0163162_10002223 3300013306 Bacteria 18226
74 Ga0163162_10005913 3300013306 Bacteria 11836
75 Ga0163162_10016706 3300013306 Bacteria 7174
76 Ga0157372_10000483 3300013307 Bacteria 44004
77 Ga0157372_10003543 3300013307 Bacteria 16828
78 Ga0157372_10041160 3300013307 Bacteria 5108
79 Ga0157376_10007363 3300014969 Bacteria 7848
80 Ga0207427_100766 3300025231 Bacteria 14625
81 Ga0209437_100041 3300025233 Bacteria 444465
82 Ga0209437_100052 3300025233 Bacteria 380548
83 Ga0209646_1000017 3300025246 Bacteria 488265
84 Ga0209026_1000279 3300025250 Bacteria 59283
85 Ga0209026_1000296 3300025250 Bacteria 54741
86 Ga0209026_1002658 3300025250 Bacteria 6493
87 Ga0209026_1003317 3300025250 Bacteria 5358
88 Ga0209129_1004915 3300025258 Bacteria 4984
89 Ga0209233_1000067 3300025261 Bacteria 380554
90 Ga0209673_1000107 3300025273 Bacteria 184825
91 Ga0209564_1003679 3300025295 Bacteria 10121
92 Ga0209564_1005434 3300025295 Bacteria 7281
93 Ga0209758_1003306 3300025297 Bacteria 14924
94 Ga0209758_1008369 3300025297 Bacteria 6726
95 Ga0209758_1009784 3300025297 Bacteria 5875
96 Ga0209050_1000476 3300025298 Bacteria 70845
97 Ga0207426_1001102 3300025302 Bacteria 24863
98 Ga0207426_1002505 3300025302 Bacteria 11575
99 Ga0207426_1009290 3300025302 Bacteria 3903
100 Ga0207680_10000086 3300025903 Bacteria 42622
101 Ga0207647_10000043 3300025904 Bacteria 91109
102 Ga0207647_10103032 3300025904 Bacteria 1692
103 Ga0207705_10000225 3300025909 Bacteria 56142
104 Ga0207707_10033953 3300025912 Bacteria 4465
105 Ga0207695_10044060 3300025913 Bacteria 4749
106 Ga0207695_10235754 3300025913 Bacteria 1732
107 Ga0207671_10001801 3300025914 Bacteria 23958
108 Ga0207671_10003741 3300025914 Bacteria 14990
109 Ga0207671_10008467 3300025914 Bacteria 8720
110 Ga0207671_10014756 3300025914 Bacteria 6159
111 Ga0207657_10023212 3300025919 Bacteria 5782
112 Ga0207652_10036142 3300025921 Bacteria 4176
113 Ga0207690_10001736 3300025932 Bacteria 13382
114 Ga0207690_10024039 3300025932 Bacteria 3812
115 Ga0207689_10003687 3300025942 Bacteria 13959
116 Ga0207667_10000039 3300025949 Bacteria 278843
117 Ga0207667_10022290 3300025949 Bacteria 7000
118 Ga0207667_10053257 3300025949 Bacteria 4259
119 Ga0207667_10148144 3300025949 Unclassified 2416
120 Ga0207651_10100539 3300025960 Unclassified 2144
121 Ga0207712_10003644 3300025961 Bacteria 9703
122 Ga0207668_10014591 3300025972 Bacteria 4864
123 Ga0207640_10097344 3300025981 Bacteria 2054
124 Ga0207703_10010342 3300026035 Bacteria 7304
125 Ga0207702_10000140 3300026078 Bacteria 87544
126 Ga0207641_10000661 3300026088 Bacteria 37590
127 Ga0207676_10009979 3300026095 Bacteria 6756
128 Ga0207674_10059818 3300026116 Unclassified 3854
129 Ga0207698_10002995 3300026142 Bacteria 10135
130 Ga0268264_10002545 3300028381 Bacteria 15994
131 Ga0307515_10000162 3300028794 Bacteria 163720
132 Ga0307515_10000280 3300028794 Bacteria 125330
133 Ga0307515_10000353 3300028794 Bacteria 112876
134 Ga0265338_10126463 3300028800 Bacteria 2027
135 Ga0265327_10064600 3300031251 Bacteria 1854
136 Ga0307513_10075983 3300031456 Bacteria 3486
137 Ga0307509_10081127 3300031507 Bacteria 3352
138 Ga0307412_10050853 3300031911 Bacteria 2737
139 Ga0307414_10025091 3300032004 Bacteria 3811
140 Ga0307507_10000345 3300033179 Bacteria 94462
141 Ga0395899_0000001 3300037312 Bacteria 1750322
142 Ga0395901_0016117 3300038443 Bacteria 7613
143 Ga0466972_0005413 3300044658 Bacteria 6394
144 Ga0495650_0000023 3300046471 Bacteria 527763
145 Ga0495650_0000238 3300046471 Bacteria 110217
146 Ga0495585_0000071 3300046492 Bacteria 105916
147 Ga0495585_0003481 3300046492 Bacteria 10626
148 Ga0495583_0056799 3300046506 Bacteria 1763
149 Ga0495606_0000008 3300046507 Bacteria 321373
150 Ga0495606_0016272 3300046507 Bacteria 5679
151 Ga0495606_0033866 3300046507 Bacteria 3516
152 Ga0495610_0000880 3300046512 Bacteria 27919
153 Ga0495610_0070995 3300046512 Bacteria 1625
154 Ga0495616_0005811 3300046513 Bacteria 7538
155 Ga0495616_0008349 3300046513 Bacteria 6142
156 Ga0495644_0009348 3300046523 Bacteria 3780
157 Ga0495648_0017465 3300046524 Bacteria 5126
158 Ga0495648_0077957 3300046524 Bacteria 1897
159 Ga0495609_0008924 3300046538 Bacteria 4877
160 Ga0495633_0000029 3300046558 Bacteria 200381
161 Ga0495633_0015641 3300046558 Bacteria 3933
162 Ga0495668_0000070 3300046616 Bacteria 174051
163 Ga0495668_0000658 3300046616 Bacteria 41497
164 Ga0495625_0000017 3300046660 Bacteria 299728
165 Ga0495625_0000018 3300046660 Bacteria 299567
166 Ga0495625_0001080 3300046660 Bacteria 35353
167 Ga0495625_0001647 3300046660 Bacteria 26189
168 Ga0495625_0022364 3300046660 Bacteria 4849
169 Ga0495625_0053307 3300046660 Bacteria 2893
170 Ga0495661_0001270 3300046665 Bacteria 21694
171 Ga0495661_0013013 3300046665 Bacteria 5605
172 Ga0495661_0017370 3300046665 Bacteria 4753
173 Ga0495649_0000008 3300046694 Bacteria 483706
174 Ga0495649_0000015 3300046694 Bacteria 246431
175 Ga0495660_0011741 3300046810 Bacteria 5079
176 Ga0495683_0069256 3300047323 Bacteria 1734
177 Ga0495687_000631 3300047443 Bacteria 40299
178 Ga0495687_045006 3300047443 Bacteria 1914
179 Ga0495686_0000106 3300047472 Bacteria 175852
180 Ga0495686_0012722 3300047472 Bacteria 5875
181 Ga0495686_0137520 3300047472 Bacteria 1444
182 Ga0495678_014950 3300049459 Bacteria 3591
183 Ga0495682_0032204 3300049460 Bacteria 1937
184 Ga0501033_0064647 3300049570 Unclassified 2692
185 Ga0501037_0132122 3300049573 Bacteria 1790
186 Ga0501223_000898 3300049663 Bacteria 7051
187 Ga0501035_0040333 3300049822 Bacteria 4220
188 Ga0501044_0068085 3300049823 Bacteria 3627
189 nmdc:mga0k408_128_c1 3300050493 Bacteria 37793
190 nmdc:mga0k408_16453_c1 3300050493 Bacteria 4105
191 nmdc:mga0k408_171_c1 3300050493 Bacteria 34186
192 Ga0500635_0000259 3300053080 Bacteria 21533
193 Ga0500635_0020833 3300053080 Bacteria 2013
194 Ga0500608_000134 3300053122 Bacteria 30077
195 Ga0500618_000037 3300053125 Bacteria 117320
196 Ga0500616_0000833 3300053153 Bacteria 34656
197 Ga0500622_0000844 3300053156 Bacteria 26216
198 Ga0500624_000177 3300053157 Bacteria 25324
199 Ga0500645_000279 3300053730 Bacteria 36588

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300004799 Ga0058863_11615853 Ga0058863_116158532 320
2 3300004803 Ga0058862_11959936 Ga0058862_119599361 320
3 3300005458 Ga0070681_10163995 Ga0070681_101639952 320
4 3300050493 nmdc:mga0k408_16453_c1 nmdc:mga0k408_16453_c1_10_1029 321
5 3300046471 Ga0495650_0000023 Ga0495650_0000023_469766_470842 340
6 3300046538 Ga0495609_0008924 Ga0495609_0008924_1033_2109 340
7 3300049570 Ga0501033_0064647 Ga0501033_0064647_503_1627 340
8 3300005327 Ga0070658_10000073 Ga0070658_1000007315 343
9 3300025909 Ga0207705_10000225 Ga0207705_1000022531 343
10 3300053153 Ga0500616_0000833 Ga0500616_0000833_20140_21576 347
11 3300046616 Ga0495668_0000658 Ga0495668_0000658_29542_30648 349
12 3300005563 Ga0068855_100000226 Ga0068855_10000022611 350
13 3300005563 Ga0068855_100008956 Ga0068855_10000895610 350
14 3300005563 Ga0068855_100012697 Ga0068855_1000126972 350
15 3300005614 Ga0068856_100000044 Ga0068856_10000004451 350
16 3300005614 Ga0068856_100015723 Ga0068856_1000157232 350
17 3300025919 Ga0207657_10023212 Ga0207657_100232124 350
18 3300025949 Ga0207667_10000039 Ga0207667_1000003974 350
19 3300025949 Ga0207667_10022290 Ga0207667_100222901 350
20 3300025949 Ga0207667_10053257 Ga0207667_100532572 350
21 3300026078 Ga0207702_10000140 Ga0207702_1000014033 350
22 3300028800 Ga0265338_10126463 Ga0265338_101264631 350
23 3300031251 Ga0265327_10064600 Ga0265327_100646002 350
24 3300046507 Ga0495606_0016272 Ga0495606_0016272_268_1374 350
25 3300046810 Ga0495660_0011741 Ga0495660_0011741_1278_2384 350
26 3300002737 JGI25162J39368_1000292 JGI25162J39368_100029212 351
27 3300003323 rootH1_10370954 rootH1_103709542 351
28 3300005578 Ga0068854_100044792 Ga0068854_1000447922 351
29 3300006195 Ga0075366_10000490 Ga0075366_100004908 351
30 3300009545 Ga0105237_10005071 Ga0105237_100050716 351
31 3300010375 Ga0105239_10000305 Ga0105239_1000030512 351
32 3300013306 Ga0163162_10002223 Ga0163162_1000222321 351
33 3300025233 Ga0209437_100041 Ga0209437_10004112 351
34 3300025258 Ga0209129_1004915 Ga0209129_10049152 351
35 3300025914 Ga0207671_10003741 Ga0207671_100037415 351
36 3300025981 Ga0207640_10097344 Ga0207640_100973442 351
37 3300046506 Ga0495583_0056799 Ga0495583_0056799_606_1715 351
38 3300046512 Ga0495610_0070995 Ga0495610_0070995_274_1383 351
39 3300046513 Ga0495616_0008349 Ga0495616_0008349_3082_4191 351
40 3300046660 Ga0495625_0000018 Ga0495625_0000018_71764_72873 351
41 3300046665 Ga0495661_0001270 Ga0495661_0001270_16780_17889 351
42 3300046694 Ga0495649_0000015 Ga0495649_0000015_266_1375 351
43 3300047472 Ga0495686_0000106 Ga0495686_0000106_23508_24617 351
44 3300050493 nmdc:mga0k408_128_c1 nmdc:mga0k408_128_c1_31503_32612 351
45 3300053156 Ga0500622_0000844 Ga0500622_0000844_1979_3097 351
46 iso_pu_bacteria 2840677318 2840679440 351
47 iso_pu_bacteria 2896085136 2896087251 351
48 3300003320 rootH2_10005500 rootH2_1000550047 352
49 3300047472 Ga0495686_0137520 Ga0495686_0137520_151_1263 352
50 3300053157 Ga0500624_000177 Ga0500624_000177_2390_3544 352
51 3300053730 Ga0500645_000279 Ga0500645_000279_10739_12340 352
52 3300003323 rootH1_10071763 rootH1_100717639 353
53 3300009093 Ga0105240_10065114 Ga0105240_100651142 354
54 3300025913 Ga0207695_10044060 Ga0207695_100440602 354
55 3300031911 Ga0307412_10050853 Ga0307412_100508532 355
56 3300053080 Ga0500635_0000259 Ga0500635_0000259_3014_4135 355
57 3300005366 Ga0070659_100000640 Ga0070659_10000064015 356
58 3300025932 Ga0207690_10001736 Ga0207690_100017369 356
59 iso_pu_bacteria 2919437846 2919438956 356
60 iso_pu_bacteria 2929921140 2929925634 356
61 3300031456 Ga0307513_10075983 Ga0307513_100759834 357
62 iso_pu_bacteria 2599185184 2599480864 357
63 iso_pu_bacteria 2928078545 2928080780 357
64 iso_pu_bacteria 2928147474 2928151002 357
65 iso_pu_bacteria 2932082852 2932087645 357
66 iso_pu_bacteria 8003151029 8003153396 357
67 3300003215 JGI25153J46596_10016224 JGI25153J46596_100162242 358
68 3300003354 JGI25160J50197_1017458 JGI25160J50197_10174581 358
69 3300003771 Ga0055526_1017841 Ga0055526_10178412 358
70 3300003790 Ga0055528_1000105 Ga0055528_100010538 358
71 3300005262 Ga0065165_1000168 Ga0065165_100016851 358
72 3300013102 Ga0157371_10175633 Ga0157371_101756331 358
73 3300025250 Ga0209026_1000279 Ga0209026_100027935 358
74 3300025273 Ga0209673_1000107 Ga0209673_100010713 358
75 3300025295 Ga0209564_1003679 Ga0209564_10036795 358
76 3300025295 Ga0209564_1005434 Ga0209564_10054343 358
77 3300025297 Ga0209758_1003306 Ga0209758_10033063 358
78 3300025297 Ga0209758_1008369 Ga0209758_10083694 358
79 3300025298 Ga0209050_1000476 Ga0209050_10004768 358
80 3300025302 Ga0207426_1002505 Ga0207426_10025058 358
81 3300025302 Ga0207426_1009290 Ga0207426_10092902 358
82 3300044658 Ga0466972_0005413 Ga0466972_0005413_312_1505 358
83 3300049663 Ga0501223_000898 Ga0501223_000898_744_1916 358
84 3300001990 JGI24737J22298_10016020 JGI24737J22298_100160201 359
85 3300005334 Ga0068869_100016079 Ga0068869_1000160795 359
86 3300005335 Ga0070666_10000050 Ga0070666_1000005088 359
87 3300005356 Ga0070674_100025331 Ga0070674_1000253312 359
88 3300005366 Ga0070659_100006161 Ga0070659_1000061613 359
89 3300005367 Ga0070667_100049300 Ga0070667_1000493002 359
90 3300005563 Ga0068855_100148189 Ga0068855_1001481892 359
91 3300005577 Ga0068857_100021988 Ga0068857_1000219883 359
92 3300005616 Ga0068852_100003986 Ga0068852_1000039865 359
93 3300005617 Ga0068859_100000025 Ga0068859_10000002582 359
94 3300005618 Ga0068864_100012580 Ga0068864_1000125802 359
95 3300005841 Ga0068863_100063617 Ga0068863_1000636172 359
96 3300005842 Ga0068858_100018416 Ga0068858_1000184162 359
97 3300006237 Ga0097621_100030922 Ga0097621_1000309223 359
98 3300006358 Ga0068871_100002075 Ga0068871_10000207514 359
99 3300006931 Ga0097620_100000025 Ga0097620_10000002582 359
100 3300009101 Ga0105247_10005807 Ga0105247_100058073 359
101 3300009174 Ga0105241_10005149 Ga0105241_100051497 359
102 3300009545 Ga0105237_10014702 Ga0105237_1001470210 359
103 3300009553 Ga0105249_10006762 Ga0105249_1000676210 359
104 3300013100 Ga0157373_10000249 Ga0157373_1000024939 359
105 3300013100 Ga0157373_10000464 Ga0157373_1000046423 359
106 3300013102 Ga0157371_10000617 Ga0157371_1000061721 359
107 3300013104 Ga0157370_10104123 Ga0157370_101041231 359
108 3300013306 Ga0163162_10000344 Ga0163162_1000034423 359
109 3300013307 Ga0157372_10000483 Ga0157372_1000048317 359
110 3300013307 Ga0157372_10041160 Ga0157372_100411602 359
111 3300014969 Ga0157376_10007363 Ga0157376_100073635 359
112 3300025903 Ga0207680_10000086 Ga0207680_100000866 359
113 3300025904 Ga0207647_10000043 Ga0207647_1000004317 359
114 3300025904 Ga0207647_10103032 Ga0207647_101030322 359
115 3300025914 Ga0207671_10014756 Ga0207671_100147562 359
116 3300025932 Ga0207690_10024039 Ga0207690_100240393 359
117 3300025942 Ga0207689_10003687 Ga0207689_1000368717 359
118 3300025949 Ga0207667_10148144 Ga0207667_101481442 359
119 3300025960 Ga0207651_10100539 Ga0207651_101005391 359
120 3300025961 Ga0207712_10003644 Ga0207712_100036443 359
121 3300025972 Ga0207668_10014591 Ga0207668_100145912 359
122 3300026035 Ga0207703_10010342 Ga0207703_100103423 359
123 3300026088 Ga0207641_10000661 Ga0207641_1000066121 359
124 3300026095 Ga0207676_10009979 Ga0207676_100099792 359
125 3300026116 Ga0207674_10059818 Ga0207674_100598183 359
126 3300026142 Ga0207698_10002995 Ga0207698_100029958 359
127 3300028381 Ga0268264_10002545 Ga0268264_100025453 359
128 3300028794 Ga0307515_10000162 Ga0307515_10000162112 359
129 3300038443 Ga0395901_0016117 Ga0395901_0016117_2768_3901 359
130 3300047472 Ga0495686_0012722 Ga0495686_0012722_3876_5009 359
131 3300053122 Ga0500608_000134 Ga0500608_000134_12372_13520 359
132 3300002737 JGI25162J39368_1000774 JGI25162J39368_10007743 360
133 3300003214 JGI25165J46597_1001445 JGI25165J46597_10014459 360
134 3300003323 rootH1_10009528 rootH1_1000952815 360
135 3300003323 rootH1_10108398 rootH1_101083982 360
136 3300005288 Ga0065714_10004282 Ga0065714_100042826 360
137 3300005327 Ga0070658_10016212 Ga0070658_100162124 360
138 3300005530 Ga0070679_100041499 Ga0070679_1000414993 360
139 3300006195 Ga0075366_10000123 Ga0075366_1000012336 360
140 3300009093 Ga0105240_10010268 Ga0105240_1001026810 360
141 3300009093 Ga0105240_10185199 Ga0105240_101851993 360
142 3300009545 Ga0105237_10009007 Ga0105237_100090075 360
143 3300009545 Ga0105237_10022673 Ga0105237_100226734 360
144 3300010375 Ga0105239_10000012 Ga0105239_10000012184 360
145 3300010375 Ga0105239_10000959 Ga0105239_1000095916 360
146 3300013306 Ga0163162_10005913 Ga0163162_100059133 360
147 3300025231 Ga0207427_100766 Ga0207427_1007668 360
148 3300025233 Ga0209437_100052 Ga0209437_100052111 360
149 3300025250 Ga0209026_1002658 Ga0209026_10026589 360
150 3300025250 Ga0209026_1003317 Ga0209026_10033173 360
151 3300025261 Ga0209233_1000067 Ga0209233_1000067111 360
152 3300025912 Ga0207707_10033953 Ga0207707_100339532 360
153 3300025913 Ga0207695_10235754 Ga0207695_102357542 360
154 3300025914 Ga0207671_10001801 Ga0207671_1000180114 360
155 3300025914 Ga0207671_10008467 Ga0207671_100084678 360
156 3300025921 Ga0207652_10036142 Ga0207652_100361423 360
157 3300028794 Ga0307515_10000280 Ga0307515_1000028036 360
158 3300028794 Ga0307515_10000353 Ga0307515_1000035339 360
159 3300031507 Ga0307509_10081127 Ga0307509_100811273 360
160 3300032004 Ga0307414_10025091 Ga0307414_100250913 360
161 3300033179 Ga0307507_10000345 Ga0307507_1000034578 360
162 3300037312 Ga0395899_0000001 Ga0395899_0000001_1010583_1011722 360
163 3300046492 Ga0495585_0003481 Ga0495585_0003481_2640_3791 360
164 3300046513 Ga0495616_0005811 Ga0495616_0005811_400_1551 360
165 3300046524 Ga0495648_0017465 Ga0495648_0017465_1532_2683 360
166 3300046524 Ga0495648_0077957 Ga0495648_0077957_161_1312 360
167 3300046558 Ga0495633_0000029 Ga0495633_0000029_148685_149836 360
168 3300046616 Ga0495668_0000070 Ga0495668_0000070_11713_12864 360
169 3300046660 Ga0495625_0001080 Ga0495625_0001080_22640_23791 360
170 3300046660 Ga0495625_0001647 Ga0495625_0001647_11815_12966 360
171 3300046660 Ga0495625_0022364 Ga0495625_0022364_1729_2880 360
172 3300046660 Ga0495625_0053307 Ga0495625_0053307_98_1249 360
173 3300046665 Ga0495661_0013013 Ga0495661_0013013_1922_3130 360
174 3300047443 Ga0495687_045006 Ga0495687_045006_614_1765 360
175 3300049459 Ga0495678_014950 Ga0495678_014950_1750_2901 360
176 3300049460 Ga0495682_0032204 Ga0495682_0032204_414_1565 360
177 3300050493 nmdc:mga0k408_171_c1 nmdc:mga0k408_171_c1_31956_33197 360
178 3300053125 Ga0500618_000037 Ga0500618_000037_99497_100648 360
179 iso_pu_bacteria 2852623160 2852623776 360
180 iso_pu_bacteria 2884933994 2884937318 360
181 3300001990 JGI24737J22298_10003274 JGI24737J22298_100032742 361
182 3300002067 JGI24735J21928_10000004 JGI24735J21928_10000004267 361
183 3300002738 JGI25154J39366_1000005 JGI25154J39366_100000593 361
184 3300003316 rootH1_10017068 rootH1_100170685 361
185 3300003320 rootH2_10162172 rootH2_101621722 361
186 3300005563 Ga0068855_100055810 Ga0068855_1000558103 361
187 3300013102 Ga0157371_10012452 Ga0157371_100124522 361
188 3300013105 Ga0157369_10009731 Ga0157369_100097314 361
189 3300013306 Ga0163162_10016706 Ga0163162_100167063 361
190 3300013307 Ga0157372_10003543 Ga0157372_100035434 361
191 3300025246 Ga0209646_1000017 Ga0209646_1000017304 361
192 3300025250 Ga0209026_1000296 Ga0209026_100029613 361
193 3300025297 Ga0209758_1009784 Ga0209758_10097843 361
194 3300025302 Ga0207426_1001102 Ga0207426_100110211 361
195 3300046471 Ga0495650_0000238 Ga0495650_0000238_45300_46439 361
196 3300046492 Ga0495585_0000071 Ga0495585_0000071_82140_83279 361
197 3300046507 Ga0495606_0000008 Ga0495606_0000008_277306_278445 361
198 3300046507 Ga0495606_0033866 Ga0495606_0033866_1875_3020 361
199 3300046512 Ga0495610_0000880 Ga0495610_0000880_23902_25041 361
200 3300046523 Ga0495644_0009348 Ga0495644_0009348_877_2022 361
201 3300046558 Ga0495633_0015641 Ga0495633_0015641_672_1811 361
202 3300046660 Ga0495625_0000017 Ga0495625_0000017_42065_43204 361
203 3300046665 Ga0495661_0017370 Ga0495661_0017370_3590_4729 361
204 3300046694 Ga0495649_0000008 Ga0495649_0000008_294501_295640 361
205 3300047323 Ga0495683_0069256 Ga0495683_0069256_331_1470 361
206 3300047443 Ga0495687_000631 Ga0495687_000631_23405_24544 361
207 3300049573 Ga0501037_0132122 Ga0501037_0132122_88_1242 361
208 3300049822 Ga0501035_0040333 Ga0501035_0040333_1684_2838 361
209 3300049823 Ga0501044_0068085 Ga0501044_0068085_1860_3014 361
210 3300053080 Ga0500635_0020833 Ga0500635_0020833_553_1695 361

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13478

XdhC_C

XdhC Rossmann domain

244

388

0.98

PF02625

XdhC_CoxI

XdhC and CoxI family

51

118

0.97

PF02625

XdhC_CoxI

XdhC and CoxI family

159

226

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ici-assembly1.cif.gz_A crystal structure of human mical3 0.9194 186 217
8gsm-assembly1.cif.gz_G crystal structure of vibmo1 0.9126 185 218
4rep-assembly1.cif.gz_A crystal structure of gamma-carotenoid desaturase 0.9117 185 218
4j36-assembly1.cif.gz_A cocrystal structure of kynurenine 3-monooxygenase in complex with upf 648 inhibitor(kmo-394upf) 0.8984 187 218
4j33-assembly2.cif.gz_B crystal structure of kynurenine 3-monooxygenase (kmo-394) 0.8964 186 218
ID Description Score Start End Superfamily
af_Q0D7W4_71_358_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9091 184 218 3.50.50.60
af_A0A1D6EF23_1_151_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9021 185 218 3.50.50.60
af_Q46808_105_253_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9018 188 337 3.40.50.720
2yquB02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8978 187 218 3.50.50.60
af_Q54GT1_13_197_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8932 186 218 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A0M3CJJ7-F1-model_v4 deleted 0.9751 232 352
AF-A0A1Q7FSA3-F1-model_v4 XdhC Rossmann domain-containing protein 0.9739 244 352
AF-A0A1I4UTJ0-F1-model_v4 Xanthine and CO dehydrogenase maturation factor, XdhC/CoxF family 0.9652 1 352
AF-R7ZVI7-F1-model_v4 Xanthine and CO dehydrogenase maturation factor, XdhC/CoxF family 0.9648 1 352
AF-A0A4Q1RWI6-F1-model_v4 XdhC Rossmann domain-containing protein 0.9572 190 283

Feature Viewer

pLDDT pTM Quality
88.48 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map