F319765

General Info

Members Datasets Scaffolds Average Seq Length
209 163 418 72

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2721755755|2723848624
Length 80
Sequence SKPGSSRAKPSRVKVREHRERLRRQGLRPIQIWVPDVRAPAFRSAAHRQSLAVAASSHGRDDQAFIDSVSAFSDDVDGNE

Samples

Sample ID Description Type Environment
1 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
4 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
5 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
6 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
7 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
8 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
9 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
12 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
13 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
14 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
15 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
16 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
17 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
18 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
19 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
20 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
21 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
22 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
23 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
24 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
25 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
26 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
27 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
28 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
29 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
30 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
31 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
44 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
45 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
46 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
47 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
48 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
49 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
50 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
51 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
52 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
53 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
54 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
55 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
56 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
57 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
58 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
59 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
60 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
61 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
62 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
63 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
64 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
65 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
66 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
67 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
68 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
69 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
70 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
71 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
72 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
73 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
74 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
75 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
76 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
77 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
78 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
79 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
80 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
81 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
82 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
83 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
84 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
85 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
86 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
87 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
88 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
89 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
90 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
91 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
92 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
93 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
94 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
95 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
96 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
97 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
98 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
99 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
100 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
101 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
102 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
109 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
110 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
111 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
112 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
113 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
116 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
117 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
118 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
119 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
120 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
121 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
122 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
123 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
124 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
125 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
126 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
127 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
128 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
129 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
130 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
131 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
132 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
133 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
134 2909399089 Nguyenibacter vanlangensis LMG 31431 Isolate Unclassified
135 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
136 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
137 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
138 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
139 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
140 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
141 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
142 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
143 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
144 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
145 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
146 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
147 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
148 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
149 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
150 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
151 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
152 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
153 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
154 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
155 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
156 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
157 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
158 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
159 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
160 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
161 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
162 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
163 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 84.21
Metatranscriptomes 0
Isolates 15.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.13
Nodule 14.35
Rhizoplane 1.91
Rhizosphere 66.99
Stem 0
Stem Tuber 0
Unclassified 6.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10000694 3300003215 Bacteria 20570
2 rootH1_10215537 3300003323 Bacteria 2176
3 Ga0070714_102295230 3300005435 Bacteria 525
4 Ga0070713_100145897 3300005436 Bacteria 2101
5 Ga0070713_100360534 3300005436 Bacteria 1350
6 Ga0070710_10088308 3300005437 Bacteria 1824
7 Ga0070710_10782556 3300005437 Bacteria 680
8 Ga0070711_100311040 3300005439 Bacteria 1256
9 Ga0070711_101610117 3300005439 Bacteria 568
10 Ga0070681_10227605 3300005458 Bacteria 1779
11 Ga0070681_11209060 3300005458 Bacteria 678
12 Ga0068867_101377191 3300005459 Bacteria 653
13 Ga0070699_100403146 3300005518 Bacteria 1236
14 Ga0070679_100379913 3300005530 Bacteria 1359
15 Ga0070684_101205360 3300005535 Bacteria 712
16 Ga0068854_101913697 3300005578 Bacteria 545
17 Ga0081538_10183615 3300005981 Bacteria 890
18 Ga0081540_1281083 3300005983 Bacteria 574
19 Ga0070717_10086352 3300006028 Bacteria 2641
20 Ga0075365_10133795 3300006038 Bacteria 1717
21 Ga0075365_10498289 3300006038 Bacteria 861
22 Ga0070715_10396860 3300006163 Bacteria 766
23 Ga0070712_100085484 3300006175 Bacteria 2297
24 Ga0070712_100226702 3300006175 Bacteria 1482
25 Ga0070712_100651693 3300006175 Bacteria 895
26 Ga0068871_101406042 3300006358 Bacteria 658
27 Ga0075430_100017106 3300006846 Bacteria 6176
28 Ga0075431_100001762 3300006847 Bacteria 20387
29 Ga0075429_100582577 3300006880 Bacteria 980
30 Ga0099794_10007986 3300007265 Bacteria 4376
31 Ga0099794_10255752 3300007265 Unclassified 904
32 Ga0105245_10418685 3300009098 Bacteria 1342
33 Ga0105245_12570421 3300009098 Bacteria 562
34 Ga0105239_10540249 3300010375 Bacteria 1327
35 Ga0105239_10900460 3300010375 Bacteria 1015
36 Ga0157370_10101384 3300013104 Bacteria 2696
37 Ga0163162_10957692 3300013306 Bacteria 967
38 Ga0157376_10359266 3300014969 Bacteria 1396
39 Ga0157376_10961483 3300014969 Bacteria 875
40 Ga0213872_10000447 3300021361 Bacteria 33712
41 Ga0213872_10174795 3300021361 Bacteria 930
42 Ga0213876_10064884 3300021384 Bacteria 1927
43 Ga0207692_10286115 3300025898 Bacteria 999
44 Ga0207692_10653000 3300025898 Bacteria 680
45 Ga0207685_10640199 3300025905 Bacteria 574
46 Ga0207699_10460423 3300025906 Bacteria 913
47 Ga0207707_11182560 3300025912 Unclassified 620
48 Ga0207693_10070851 3300025915 Bacteria 2728
49 Ga0207693_10130012 3300025915 Bacteria 1979
50 Ga0207660_10745993 3300025917 Bacteria 799
51 Ga0207652_10082064 3300025921 Bacteria 2821
52 Ga0207652_10186905 3300025921 Bacteria 1863
53 Ga0207700_10326518 3300025928 Bacteria 1331
54 Ga0207664_11131066 3300025929 Bacteria 699
55 Ga0207665_10096438 3300025939 Bacteria 2057
56 Ga0207648_11054644 3300026089 Bacteria 762
57 Ga0209588_1002793 3300027671 Bacteria 4779
58 Ga0307515_10587341 3300028794 Bacteria 724
59 Ga0307408_100067433 3300031548 Bacteria 2632
60 Ga0316576_10400368 3300031727 Bacteria 1017
61 Ga0307405_10536931 3300031731 Bacteria 944
62 Ga0307405_10750263 3300031731 Bacteria 813
63 Ga0316577_10197646 3300031733 Bacteria 1136
64 Ga0307413_10834264 3300031824 Bacteria 777
65 Ga0307407_10820712 3300031903 Bacteria 709
66 Ga0307412_12068732 3300031911 Unclassified 528
67 Ga0307412_12304817 3300031911 Bacteria 502
68 Ga0307409_101842025 3300031995 Bacteria 634
69 Ga0307411_10337110 3300032005 Unclassified 1224
70 Ga0307415_101337068 3300032126 Bacteria 680
71 Ga0316580_10096630 3300032139 Unclassified 904
72 Ga0373927_0159845 3300035695 Bacteria 1476
73 Ga0373933_0376305 3300035724 Bacteria 924
74 Ga0373947_0159799 3300035725 Bacteria 1457
75 Ga0373947_0473035 3300035725 Bacteria 850
76 Ga0373947_0926885 3300035725 Unclassified 595
77 Ga0316582_0403734 3300036647 Bacteria 941
78 Ga0316584_0390870 3300036712 Bacteria 992
79 Ga0395898_0080155 3300037466 Bacteria 3149
80 Ga0395898_1926661 3300037466 Bacteria 511
81 Ga0395905_0060144 3300037471 Bacteria 3553
82 Ga0316581_0071348 3300037588 Unclassified 1067
83 Ga0436364_0142466 3300037853 Bacteria 513
84 Ga0436364_0242638 3300037853 Bacteria 1462
85 Ga0395901_0910328 3300038443 Bacteria 861
86 Ga0436365_0188581 3300039437 Bacteria 547
87 Ga0436365_0210532 3300039437 Bacteria 783
88 Ga0436365_1631213 3300039437 Bacteria 3821
89 Ga0436365_1841274 3300039437 Unclassified 842
90 Ga0436360_0337833 3300039438 Bacteria 1068
91 Ga0436360_0448838 3300039438 Bacteria 1489
92 Ga0436360_0871647 3300039438 Bacteria 611
93 Ga0436360_1269933 3300039438 Bacteria 1501
94 Ga0436361_0718319 3300039447 Bacteria 722
95 Ga0436361_0796880 3300039447 Bacteria 6814
96 Ga0436361_1086529 3300039447 Bacteria 1144
97 Ga0436361_1110176 3300039447 Bacteria 18005
98 Ga0436361_1148915 3300039447 Plasmid 3151
99 Ga0436363_0397539 3300039450 Bacteria 3094
100 Ga0436363_0596291 3300039450 Bacteria 1111
101 Ga0436363_0603193 3300039450 Bacteria 1217
102 Ga0436363_1195383 3300039450 Bacteria 726
103 Ga0436362_0094480 3300039453 Bacteria 1461
104 Ga0436362_1045078 3300039453 Unclassified 1580
105 Ga0436362_1106371 3300039453 Bacteria 747
106 Ga0439465_0396361 3300041413 Bacteria 525
107 Ga0451798_1120415 3300041458 Unclassified 576
108 Ga0451843_0847524 3300041509 Bacteria 541
109 Ga0466969_0103558 3300044656 Bacteria 1338
110 Ga0466966_0492556 3300044684 Bacteria 737
111 Ga0466959_0094676 3300045049 Bacteria 2142
112 Ga0466958_0405061 3300045836 Bacteria 881
113 Ga0466967_1897119 3300045976 Bacteria 593
114 Ga0495617_229388 3300046452 Bacteria 576
115 Ga0495592_0532133 3300046454 Bacteria 725
116 Ga0495605_0008947 3300046474 Bacteria 5644
117 Ga0495664_0919330 3300046477 Bacteria 511
118 Ga0495585_0059539 3300046492 Bacteria 2104
119 Ga0495583_0104003 3300046506 Bacteria 1209
120 Ga0495616_0047774 3300046513 Bacteria 2154
121 Ga0495618_0349345 3300046514 Bacteria 912
122 Ga0495620_0080824 3300046515 Bacteria 1315
123 Ga0495631_0078267 3300046518 Bacteria 1427
124 Ga0495632_0126536 3300046519 Bacteria 1191
125 Ga0495648_0052076 3300046524 Bacteria 2489
126 Ga0495652_0122731 3300046529 Bacteria 2069
127 Ga0495652_0518391 3300046529 Bacteria 824
128 Ga0495652_1116579 3300046529 Unclassified 511
129 Ga0495668_0070472 3300046616 Bacteria 1922
130 Ga0495611_0354390 3300046648 Bacteria 673
131 Ga0495625_0006181 3300046660 Bacteria 10725
132 Ga0495669_0392593 3300046684 Bacteria 672
133 Ga0495670_0463700 3300046691 Bacteria 687
134 Ga0495676_0244479 3300047321 Bacteria 1227
135 Ga0495602_0034219 3300048088 Bacteria 4757
136 Ga0495602_0405629 3300048088 Bacteria 971
137 Ga0495602_0490814 3300048088 Bacteria 860
138 Ga0495602_1057196 3300048088 Unclassified 534
139 Ga0496100_1093914 3300048903 Bacteria 628
140 Ga0496115_0109221 3300048918 Bacteria 2271
141 Ga0496115_0999016 3300048918 Bacteria 640
142 Ga0496126_1036525 3300048929 Bacteria 613
143 Ga0495678_133284 3300049459 Bacteria 821
144 Ga0501033_0076253 3300049570 Bacteria 2461
145 Ga0501037_0131170 3300049573 Bacteria 1797
146 Ga0501041_0130022 3300049577 Bacteria 1568
147 Ga0501042_0063575 3300049578 Bacteria 2638
148 Ga0501047_0509711 3300049581 Bacteria 1029
149 Ga0501048_1114551 3300049582 Bacteria 568
150 Ga0501072_0528617 3300049588 Bacteria 932
151 Ga0501073_0731069 3300049589 Bacteria 683
152 Ga0501076_0124736 3300049592 Bacteria 2086
153 Ga0501079_0238719 3300049741 Bacteria 1420
154 Ga0501080_1758584 3300049742 Unclassified 522
155 Ga0501035_0660346 3300049822 Bacteria 847
156 Ga0501035_0779698 3300049822 Bacteria 765
157 Ga0501044_0007508 3300049823 Bacteria 11994
158 Ga0501044_0805559 3300049823 Bacteria 818
159 Ga0501045_0180224 3300049824 Bacteria 1574
160 nmdc:mga09592_563090_c1 3300050508 Bacteria 978
161 nmdc:mga09592_576013_c1 3300050508 Bacteria 966
162 nmdc:mga0qj67_64917_c1 3300050509 Bacteria 2905
163 Ga0500610_0242324 3300053079 Bacteria 837
164 Ga0500578_0093290 3300053086 Bacteria 1910
165 Ga0500556_0171587 3300053104 Bacteria 857
166 Ga0500557_021182 3300053105 Bacteria 1860
167 Ga0500569_033069 3300053109 Bacteria 1467
168 Ga0500594_0038392 3300053118 Bacteria 1297
169 Ga0500595_001082 3300053119 Bacteria 15117
170 Ga0500614_077194 3300053123 Unclassified 925
171 Ga0500577_0246012 3300053142 Bacteria 777
172 Ga0500588_0086818 3300053146 Bacteria 1057
173 Ga0500636_0010156 3300053177 Bacteria 5489
174 Ga0500636_0022967 3300053177 Bacteria 3687
175 Ga0500637_0225034 3300053178 Bacteria 1059
176 Ga0500601_026190 3300053737 Bacteria 683
177 2723848624 2721755755 Bacteria 8322773
178 2510319638 2510065059 Bacteria 6847884
179 2644129642 2643221623 Bacteria 5239945
180 2909400078 2909399089 Bacteria 3922598
181 2932832124 2932828146 Bacteria 9745859
182 2935622062 2935616580 Bacteria 9032984
183 2935643927 2935638405 Bacteria 10015038
184 2935669157 2935665750 Bacteria 9571747
185 2935692226 2935684952 Bacteria 9590419
186 2935700603 2935694250 Bacteria 9291695
187 2935708767 2935703347 Bacteria 10242284
188 2935720536 2935713505 Bacteria 9608509
189 2935729817 2935722832 Bacteria 9608746
190 2935739201 2935732158 Bacteria 9706831
191 2935748258 2935741537 Bacteria 9707219
192 2935758461 2935750917 Bacteria 9590372
193 2935805873 2935801545 Bacteria 9301974
194 2935833179 2935827899 Bacteria 10038562
195 2935843250 2935837841 Bacteria 9454360
196 2935860309 2935855204 Bacteria 9035059
197 2935867707 2935864058 Bacteria 9784707
198 2935878484 2935873716 Bacteria 9632195
199 2935998633 2935992306 Bacteria 9802711
200 2936006939 2936002035 Bacteria 9362176
201 2937829459 2937822353 Bacteria 7290551
202 2940564365 2940556831 Bacteria 9590747
203 2941544796 2941538514 Bacteria 9402094
204 2958073212 2958071322 Bacteria 6815895
205 2989780352 2989776772 Bacteria 4843317
206 8004634019 8004633249 Bacteria 6723080
207 8019584916 8019576017 Bacteria 10049540
208 8019609788 8019608314 Bacteria 10042931
209 8056676479 8056673599 Bacteria 7871253
210 JGI25153J46596_10000694
211 rootH1_10215537
212 Ga0070714_102295230
213 Ga0070713_100145897
214 Ga0070713_100360534
215 Ga0070710_10088308
216 Ga0070710_10782556
217 Ga0070711_100311040
218 Ga0070711_101610117
219 Ga0070681_10227605
220 Ga0070681_11209060
221 Ga0068867_101377191
222 Ga0070699_100403146
223 Ga0070679_100379913
224 Ga0070684_101205360
225 Ga0068854_101913697
226 Ga0081538_10183615
227 Ga0081540_1281083
228 Ga0070717_10086352
229 Ga0075365_10133795
230 Ga0075365_10498289
231 Ga0070715_10396860
232 Ga0070712_100085484
233 Ga0070712_100226702
234 Ga0070712_100651693
235 Ga0068871_101406042
236 Ga0075430_100017106
237 Ga0075431_100001762
238 Ga0075429_100582577
239 Ga0099794_10007986
240 Ga0099794_10255752
241 Ga0105245_10418685
242 Ga0105245_12570421
243 Ga0105239_10540249
244 Ga0105239_10900460
245 Ga0157370_10101384
246 Ga0163162_10957692
247 Ga0157376_10359266
248 Ga0157376_10961483
249 Ga0213872_10000447
250 Ga0213872_10174795
251 Ga0213876_10064884
252 Ga0207692_10286115
253 Ga0207692_10653000
254 Ga0207685_10640199
255 Ga0207699_10460423
256 Ga0207707_11182560
257 Ga0207693_10070851
258 Ga0207693_10130012
259 Ga0207660_10745993
260 Ga0207652_10082064
261 Ga0207652_10186905
262 Ga0207700_10326518
263 Ga0207664_11131066
264 Ga0207665_10096438
265 Ga0207648_11054644
266 Ga0209588_1002793
267 Ga0307515_10587341
268 Ga0307408_100067433
269 Ga0316576_10400368
270 Ga0307405_10536931
271 Ga0307405_10750263
272 Ga0316577_10197646
273 Ga0307413_10834264
274 Ga0307407_10820712
275 Ga0307412_12068732
276 Ga0307412_12304817
277 Ga0307409_101842025
278 Ga0307411_10337110
279 Ga0307415_101337068
280 Ga0316580_10096630
281 Ga0373927_0159845
282 Ga0373933_0376305
283 Ga0373947_0159799
284 Ga0373947_0473035
285 Ga0373947_0926885
286 Ga0316582_0403734
287 Ga0316584_0390870
288 Ga0395898_0080155
289 Ga0395898_1926661
290 Ga0395905_0060144
291 Ga0316581_0071348
292 Ga0436364_0142466
293 Ga0436364_0242638
294 Ga0395901_0910328
295 Ga0436365_0188581
296 Ga0436365_0210532
297 Ga0436365_1631213
298 Ga0436365_1841274
299 Ga0436360_0337833
300 Ga0436360_0448838
301 Ga0436360_0871647
302 Ga0436360_1269933
303 Ga0436361_0718319
304 Ga0436361_0796880
305 Ga0436361_1086529
306 Ga0436361_1110176
307 Ga0436361_1148915
308 Ga0436363_0397539
309 Ga0436363_0596291
310 Ga0436363_0603193
311 Ga0436363_1195383
312 Ga0436362_0094480
313 Ga0436362_1045078
314 Ga0436362_1106371
315 Ga0439465_0396361
316 Ga0451798_1120415
317 Ga0451843_0847524
318 Ga0466969_0103558
319 Ga0466966_0492556
320 Ga0466959_0094676
321 Ga0466958_0405061
322 Ga0466967_1897119
323 Ga0495617_229388
324 Ga0495592_0532133
325 Ga0495605_0008947
326 Ga0495664_0919330
327 Ga0495585_0059539
328 Ga0495583_0104003
329 Ga0495616_0047774
330 Ga0495618_0349345
331 Ga0495620_0080824
332 Ga0495631_0078267
333 Ga0495632_0126536
334 Ga0495648_0052076
335 Ga0495652_0122731
336 Ga0495652_0518391
337 Ga0495652_1116579
338 Ga0495668_0070472
339 Ga0495611_0354390
340 Ga0495625_0006181
341 Ga0495669_0392593
342 Ga0495670_0463700
343 Ga0495676_0244479
344 Ga0495602_0034219
345 Ga0495602_0405629
346 Ga0495602_0490814
347 Ga0495602_1057196
348 Ga0496100_1093914
349 Ga0496115_0109221
350 Ga0496115_0999016
351 Ga0496126_1036525
352 Ga0495678_133284
353 Ga0501033_0076253
354 Ga0501037_0131170
355 Ga0501041_0130022
356 Ga0501042_0063575
357 Ga0501047_0509711
358 Ga0501048_1114551
359 Ga0501072_0528617
360 Ga0501073_0731069
361 Ga0501076_0124736
362 Ga0501079_0238719
363 Ga0501080_1758584
364 Ga0501035_0660346
365 Ga0501035_0779698
366 Ga0501044_0007508
367 Ga0501044_0805559
368 Ga0501045_0180224
369 nmdc:mga09592_563090_c1
370 nmdc:mga09592_576013_c1
371 nmdc:mga0qj67_64917_c1
372 Ga0500610_0242324
373 Ga0500578_0093290
374 Ga0500556_0171587
375 Ga0500557_021182
376 Ga0500569_033069
377 Ga0500594_0038392
378 Ga0500595_001082
379 Ga0500614_077194
380 Ga0500577_0246012
381 Ga0500588_0086818
382 Ga0500636_0010156
383 Ga0500636_0022967
384 Ga0500637_0225034
385 Ga0500601_026190
386 2723848624
387 2510319638
388 2644129642
389 2909400078
390 2932832124
391 2935622062
392 2935643927
393 2935669157
394 2935692226
395 2935700603
396 2935708767
397 2935720536
398 2935729817
399 2935739201
400 2935748258
401 2935758461
402 2935805873
403 2935833179
404 2935843250
405 2935860309
406 2935867707
407 2935878484
408 2935998633
409 2936006939
410 2937829459
411 2940564365
412 2941544796
413 2958073212
414 2989780352
415 8004634019
416 8019584916
417 8019609788
418 8056676479

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11455

MazE-like

Antitoxin MazE-like

12

76

0.93

Map