F319443

General Info

Members Datasets Scaffolds Average Seq Length
209 136 418 247

Family's Representative Sequence

Representative Sequence 3300044842|Ga0466957_0279520|Ga0466957_0279520_88_915
Length 275
Sequence MYKTLRRGRIIGEPPSSPRTYRPDLPHVTLRVMSFAAKDEWLAGVDGCPGGWIAAFVRGTEVHIEVLPRFADVLAREPAVVAVDMPIGLPERTAQGGRKAENAIRPLLGARQSSVFSVPSRAAIHAATYADACAVAVVTSDPPRKVSKQLFNIAPKIREVDAVLRAHADLASRVFEVHPELAFWRMNGDRALDLPKKVKSRCYEPGLALRRSLLMASGFAAEVVNAPPPRGAGPDDLLDALACAFVARRLHRAEAVSFPDPPDRDAYGLPMAIWA

Samples

Sample ID Description Type Environment
1 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
30 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
50 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
65 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
66 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
67 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
68 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
69 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
70 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
71 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
72 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
73 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
74 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
75 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
76 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
77 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
78 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
79 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
80 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
81 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
82 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
83 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
84 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
85 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
86 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
87 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
88 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
89 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
90 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
103 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
104 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
105 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
106 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
107 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
108 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
109 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
110 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
113 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
114 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
115 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
116 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
117 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
118 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
119 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
120 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
121 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
122 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
123 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
124 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
125 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
126 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
127 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
128 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
129 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
130 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
131 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
132 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
133 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
134 2773857925 Microvirga vignae BR3299 Isolate Unclassified
135 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
136 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.61
Metatranscriptomes 0.96
Isolates 1.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.09
Nodule 0
Rhizoplane 0.96
Rhizosphere 88.04
Stem 0
Stem Tuber 0
Unclassified 0.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466957_0279520 3300044842 Bacteria 1117
2 JGI25406J46586_10027786 3300003203 Bacteria 2164
3 JGI25153J46596_10001652 3300003215 Bacteria 13208
4 rootL2_10054164 3300003322 Bacteria 1263
5 rootH1_10307934 3300003323 Bacteria 1374
6 Ga0070658_10019947 3300005327 Bacteria 5370
7 Ga0070658_10045121 3300005327 Bacteria 3563
8 Ga0070658_10102707 3300005327 Bacteria 2364
9 Ga0070658_10531092 3300005327 Bacteria 1017
10 Ga0070680_100021932 3300005336 Bacteria 5079
11 Ga0070680_100023840 3300005336 Bacteria 4884
12 Ga0070680_100054322 3300005336 Bacteria 3270
13 Ga0070660_100009730 3300005339 Bacteria 6776
14 Ga0070660_100016064 3300005339 Bacteria 5424
15 Ga0070659_100103054 3300005366 Bacteria 2298
16 Ga0070659_100537141 3300005366 Unclassified 1000
17 Ga0070714_100208967 3300005435 Bacteria 1788
18 Ga0070694_100105389 3300005444 Bacteria 2001
19 Ga0070708_100039337 3300005445 Bacteria 4137
20 Ga0070681_10007036 3300005458 Bacteria 10953
21 Ga0070681_10009946 3300005458 Bacteria 9373
22 Ga0068867_100532146 3300005459 Bacteria 1015
23 Ga0070706_100152508 3300005467 Bacteria 2157
24 Ga0070707_100050257 3300005468 Bacteria 3996
25 Ga0070698_100291706 3300005471 Bacteria 1562
26 Ga0070699_100410875 3300005518 Bacteria 1224
27 Ga0070679_100010200 3300005530 Bacteria 8905
28 Ga0070679_100052714 3300005530 Bacteria 4050
29 Ga0070679_100122350 3300005530 Bacteria 2586
30 Ga0070697_100166975 3300005536 Bacteria 1861
31 Ga0068855_100111871 3300005563 Bacteria 3134
32 Ga0068854_100210612 3300005578 Bacteria 1533
33 Ga0068856_100168134 3300005614 Bacteria 2204
34 Ga0081455_10035575 3300005937 Bacteria 4448
35 Ga0081540_1000315 3300005983 Bacteria 50137
36 Ga0081539_10001619 3300005985 Bacteria 36946
37 Ga0081539_10010883 3300005985 Bacteria 7306
38 Ga0070717_10063737 3300006028 Bacteria 3060
39 Ga0075365_10373006 3300006038 Bacteria 1006
40 Ga0075364_10516395 3300006051 Bacteria 817
41 Ga0075362_10034417 3300006177 Bacteria 2208
42 Ga0075367_10104243 3300006178 Bacteria 1736
43 Ga0075367_10321522 3300006178 Bacteria 975
44 Ga0075370_10104892 3300006353 Bacteria 1638
45 Ga0075428_100001200 3300006844 Bacteria 27756
46 Ga0075428_100082995 3300006844 Bacteria 3496
47 Ga0075428_100187390 3300006844 Bacteria 2238
48 Ga0075430_100000032 3300006846 Bacteria 72679
49 Ga0075431_100009024 3300006847 Bacteria 9998
50 Ga0075431_100131621 3300006847 Bacteria 2580
51 Ga0075431_100251898 3300006847 Bacteria 1794
52 Ga0075431_100315744 3300006847 Bacteria 1576
53 Ga0075433_10000072 3300006852 Bacteria 45390
54 Ga0075433_10018903 3300006852 Bacteria 5736
55 Ga0075433_10082543 3300006852 Bacteria 2834
56 Ga0075434_100000341 3300006871 Bacteria 33666
57 Ga0075434_100018020 3300006871 Bacteria 6813
58 Ga0075434_100136131 3300006871 Bacteria 2475
59 Ga0075429_100000631 3300006880 Bacteria 27160
60 Ga0075436_100017424 3300006914 Bacteria 4917
61 Ga0075435_100031353 3300007076 Bacteria 4187
62 Ga0075435_100061717 3300007076 Bacteria 3041
63 Ga0105240_10041606 3300009093 Bacteria 5863
64 Ga0111539_10001908 3300009094 Bacteria 27756
65 Ga0114129_10001035 3300009147 Bacteria 36374
66 Ga0114129_10001551 3300009147 Bacteria 31169
67 Ga0114129_10529433 3300009147 Bacteria 1535
68 Ga0114129_11255994 3300009147 Bacteria 920
69 Ga0105238_10047188 3300009551 Bacteria 4345
70 Ga0157371_10072040 3300013102 Bacteria 2447
71 Ga0157369_10070663 3300013105 Bacteria 3750
72 Ga0157369_10667941 3300013105 Bacteria 1071
73 Ga0197907_10211454 3300020069 Bacteria 1771
74 Ga0206356_11123422 3300020070 Bacteria 1805
75 Ga0209758_1000469 3300025297 Bacteria 66568
76 Ga0207705_10026788 3300025909 Bacteria 4109
77 Ga0207705_10067910 3300025909 Bacteria 2580
78 Ga0207705_10192034 3300025909 Bacteria 1545
79 Ga0207684_10011658 3300025910 Bacteria 7674
80 Ga0207707_10134908 3300025912 Bacteria 2158
81 Ga0207695_10060957 3300025913 Bacteria 3902
82 Ga0207693_10043069 3300025915 Bacteria 3553
83 Ga0207660_10016403 3300025917 Bacteria 4902
84 Ga0207660_10141045 3300025917 Bacteria 1842
85 Ga0207657_10005961 3300025919 Bacteria 12679
86 Ga0207657_10012139 3300025919 Bacteria 8512
87 Ga0207652_10008473 3300025921 Bacteria 8274
88 Ga0207652_10106353 3300025921 Bacteria 2483
89 Ga0207652_10693358 3300025921 Bacteria 909
90 Ga0207646_10058336 3300025922 Bacteria 3447
91 Ga0207694_10046766 3300025924 Bacteria 3345
92 Ga0207667_10071293 3300025949 Bacteria 3613
93 Ga0207667_10208914 3300025949 Bacteria 2001
94 Ga0207640_10330580 3300025981 Bacteria 1217
95 Ga0207703_10286249 3300026035 Bacteria 1498
96 Ga0207698_10117313 3300026142 Bacteria 2245
97 Ga0207428_10000082 3300027907 Bacteria 133684
98 Ga0265330_10029201 3300031235 Bacteria 2481
99 Ga0265332_10067090 3300031238 Bacteria 1530
100 Ga0265325_10106419 3300031241 Bacteria 1367
101 Ga0265325_10151796 3300031241 Bacteria 1095
102 Ga0265339_10017617 3300031249 Bacteria 4226
103 Ga0265327_10008917 3300031251 Bacteria 7360
104 Ga0265313_10011824 3300031595 Bacteria 5396
105 Ga0265314_10019730 3300031711 Bacteria 5215
106 Ga0265342_10000149 3300031712 Bacteria 79177
107 Ga0373961_0050653 3300035241 Bacteria 1230
108 Ga0395899_0019462 3300037312 Bacteria 5156
109 Ga0395899_0245616 3300037312 Bacteria 1230
110 Ga0395899_0269099 3300037312 Bacteria 1163
111 Ga0395900_0002835 3300037418 Bacteria 18922
112 Ga0395900_0165043 3300037418 Bacteria 2257
113 Ga0395900_0295240 3300037418 Bacteria 1608
114 Ga0395900_0487461 3300037418 Bacteria 1184
115 Ga0395898_0020711 3300037466 Bacteria 6676
116 Ga0395898_0033914 3300037466 Bacteria 5091
117 Ga0395898_0151684 3300037466 Bacteria 2217
118 Ga0395905_0102232 3300037471 Bacteria 2690
119 Ga0395901_0006379 3300038443 Bacteria 11952
120 Ga0395901_0204789 3300038443 Bacteria 2067
121 Ga0436361_0466980 3300039447 Bacteria 3480
122 Ga0466972_0151543 3300044658 Bacteria 1090
123 Ga0466963_0084760 3300044694 Bacteria 2150
124 Ga0466971_0018122 3300044719 Bacteria 3119
125 Ga0466960_0039216 3300044901 Bacteria 2233
126 Ga0466967_0294235 3300045976 Bacteria 1560
127 Ga0495638_0135612 3300046460 Bacteria 1442
128 Ga0495584_0008072 3300046491 Bacteria 5472
129 Ga0495656_0081822 3300046615 Bacteria 1459
130 Ga0496110_0009043 3300048913 Bacteria 8039
131 Ga0496111_0015280 3300048914 Bacteria 5267
132 Ga0501031_0051258 3300049568 Bacteria 2688
133 Ga0501032_0097925 3300049569 Bacteria 1944
134 Ga0501033_0035311 3300049570 Bacteria 3748
135 Ga0501033_0068615 3300049570 Bacteria 2606
136 Ga0501034_0106130 3300049571 Bacteria 2802
137 Ga0501034_0166246 3300049571 Bacteria 2174
138 Ga0501034_0193603 3300049571 Bacteria 1994
139 Ga0501036_0014849 3300049572 Bacteria 6497
140 Ga0501037_0022523 3300049573 Bacteria 4660
141 Ga0501038_0022202 3300049574 Bacteria 5687
142 Ga0501038_0035664 3300049574 Bacteria 4366
143 Ga0501038_0158489 3300049574 Bacteria 1841
144 Ga0501038_0215475 3300049574 Bacteria 1534
145 Ga0501039_0608394 3300049575 Bacteria 856
146 Ga0501042_0003820 3300049578 Bacteria 9520
147 Ga0501043_0227336 3300049579 Bacteria 1442
148 Ga0501046_0012773 3300049580 Bacteria 7143
149 Ga0501046_0172067 3300049580 Bacteria 1625
150 Ga0501047_0030818 3300049581 Bacteria 5170
151 Ga0501047_0089188 3300049581 Bacteria 2961
152 Ga0501047_0100284 3300049581 Bacteria 2775
153 Ga0501047_0152013 3300049581 Bacteria 2190
154 Ga0501047_0191945 3300049581 Bacteria 1905
155 Ga0501069_0002651 3300049585 Bacteria 9129
156 Ga0501070_0038326 3300049586 Bacteria 3999
157 Ga0501070_0047792 3300049586 Bacteria 3555
158 Ga0501073_0031696 3300049589 Bacteria 3771
159 Ga0501073_0223577 3300049589 Bacteria 1300
160 Ga0501073_0239799 3300049589 Bacteria 1252
161 Ga0501074_0132318 3300049590 Bacteria 1784
162 Ga0501076_0207686 3300049592 Bacteria 1600
163 Ga0501079_0024665 3300049741 Bacteria 4615
164 Ga0501079_0070497 3300049741 Bacteria 2699
165 Ga0501080_0008942 3300049742 Bacteria 9106
166 Ga0501083_0005799 3300049744 Bacteria 8748
167 Ga0501083_0015328 3300049744 Bacteria 5369
168 Ga0501083_0052270 3300049744 Bacteria 2745
169 Ga0501035_0018523 3300049822 Bacteria 6414
170 Ga0501035_0023250 3300049822 Bacteria 5684
171 Ga0501044_0000398 3300049823 Bacteria 53733
172 Ga0501044_0223963 3300049823 Bacteria 1830
173 Ga0501045_0018655 3300049824 Bacteria 4938
174 nmdc:mga03683_86817_c1 3300050489 Bacteria 1359
175 nmdc:mga03n38_140338_c1 3300050490 Bacteria 1206
176 nmdc:mga03n38_287002_c1 3300050490 Bacteria 880
177 nmdc:mga0yw44_121054_c1 3300050492 Bacteria 1686
178 nmdc:mga0k408_59937_c1 3300050493 Bacteria 2211
179 nmdc:mga0k408_76784_c1 3300050493 Bacteria 1953
180 nmdc:mga06z11_56154_c1 3300050494 Bacteria 2036
181 nmdc:mga04h51_157215_c1 3300050495 Bacteria 872
182 nmdc:mga07m45_67177_c1 3300050496 Bacteria 2038
183 nmdc:mga05p37_19_c2 3300050507 Bacteria 99994
184 nmdc:mga05p37_530037_c1 3300050507 Bacteria 1345
185 nmdc:mga05p37_5389_c1 3300050507 Bacteria 15038
186 nmdc:mga09592_238_c1 3300050508 Bacteria 40013
187 nmdc:mga0qj67_259_c1 3300050509 Bacteria 36242
188 nmdc:mga06r32_197828_c1 3300050510 Bacteria 1997
189 nmdc:mga06r32_2023_c1 3300050510 Bacteria 18128
190 nmdc:mga08y16_2735_c1 3300050511 Bacteria 18090
191 nmdc:mga0n895_1651_c1 3300050512 Bacteria 16871
192 nmdc:mga0n895_394_c1 3300050512 Bacteria 29311
193 nmdc:mga0n895_7279_c1 3300050512 Bacteria 9482
194 nmdc:mga0n895_768082_c1 3300050512 Bacteria 956
195 nmdc:mga0rr50_28022_c1 3300050513 Bacteria 3954
196 nmdc:mga0rr50_48999_c1 3300050513 Bacteria 3126
197 nmdc:mga0rr50_71247_c1 3300050513 Bacteria 2651
198 nmdc:mga08x19_4948_c1 3300050514 Bacteria 7867
199 nmdc:mga0a205_1167_c2 3300050515 Bacteria 15903
200 nmdc:mga0a205_249_c1 3300050515 Bacteria 38472
201 nmdc:mga0a205_497476_c1 3300050515 Bacteria 1076
202 Ga0495595_0069747 3300053084 Bacteria 1660
203 Ga0500652_000169 3300053131 Bacteria 25198
204 Ga0500616_0166481 3300053153 Bacteria 1005
205 Ga0501082_0693565 3300060353 Bacteria 891
206 Ga0530510_0533817 3300061734 Unclassified 890
207 2774871879 2773857925 Bacteria 6472445
208 2882459001 2882456835 Bacteria 6863978
209 2917554935 2917554339 Bacteria 4987857
210 Ga0466957_0279520
211 JGI25406J46586_10027786
212 JGI25153J46596_10001652
213 rootL2_10054164
214 rootH1_10307934
215 Ga0070658_10019947
216 Ga0070658_10045121
217 Ga0070658_10102707
218 Ga0070658_10531092
219 Ga0070680_100021932
220 Ga0070680_100023840
221 Ga0070680_100054322
222 Ga0070660_100009730
223 Ga0070660_100016064
224 Ga0070659_100103054
225 Ga0070659_100537141
226 Ga0070714_100208967
227 Ga0070694_100105389
228 Ga0070708_100039337
229 Ga0070681_10007036
230 Ga0070681_10009946
231 Ga0068867_100532146
232 Ga0070706_100152508
233 Ga0070707_100050257
234 Ga0070698_100291706
235 Ga0070699_100410875
236 Ga0070679_100010200
237 Ga0070679_100052714
238 Ga0070679_100122350
239 Ga0070697_100166975
240 Ga0068855_100111871
241 Ga0068854_100210612
242 Ga0068856_100168134
243 Ga0081455_10035575
244 Ga0081540_1000315
245 Ga0081539_10001619
246 Ga0081539_10010883
247 Ga0070717_10063737
248 Ga0075365_10373006
249 Ga0075364_10516395
250 Ga0075362_10034417
251 Ga0075367_10104243
252 Ga0075367_10321522
253 Ga0075370_10104892
254 Ga0075428_100001200
255 Ga0075428_100082995
256 Ga0075428_100187390
257 Ga0075430_100000032
258 Ga0075431_100009024
259 Ga0075431_100131621
260 Ga0075431_100251898
261 Ga0075431_100315744
262 Ga0075433_10000072
263 Ga0075433_10018903
264 Ga0075433_10082543
265 Ga0075434_100000341
266 Ga0075434_100018020
267 Ga0075434_100136131
268 Ga0075429_100000631
269 Ga0075436_100017424
270 Ga0075435_100031353
271 Ga0075435_100061717
272 Ga0105240_10041606
273 Ga0111539_10001908
274 Ga0114129_10001035
275 Ga0114129_10001551
276 Ga0114129_10529433
277 Ga0114129_11255994
278 Ga0105238_10047188
279 Ga0157371_10072040
280 Ga0157369_10070663
281 Ga0157369_10667941
282 Ga0197907_10211454
283 Ga0206356_11123422
284 Ga0209758_1000469
285 Ga0207705_10026788
286 Ga0207705_10067910
287 Ga0207705_10192034
288 Ga0207684_10011658
289 Ga0207707_10134908
290 Ga0207695_10060957
291 Ga0207693_10043069
292 Ga0207660_10016403
293 Ga0207660_10141045
294 Ga0207657_10005961
295 Ga0207657_10012139
296 Ga0207652_10008473
297 Ga0207652_10106353
298 Ga0207652_10693358
299 Ga0207646_10058336
300 Ga0207694_10046766
301 Ga0207667_10071293
302 Ga0207667_10208914
303 Ga0207640_10330580
304 Ga0207703_10286249
305 Ga0207698_10117313
306 Ga0207428_10000082
307 Ga0265330_10029201
308 Ga0265332_10067090
309 Ga0265325_10106419
310 Ga0265325_10151796
311 Ga0265339_10017617
312 Ga0265327_10008917
313 Ga0265313_10011824
314 Ga0265314_10019730
315 Ga0265342_10000149
316 Ga0373961_0050653
317 Ga0395899_0019462
318 Ga0395899_0245616
319 Ga0395899_0269099
320 Ga0395900_0002835
321 Ga0395900_0165043
322 Ga0395900_0295240
323 Ga0395900_0487461
324 Ga0395898_0020711
325 Ga0395898_0033914
326 Ga0395898_0151684
327 Ga0395905_0102232
328 Ga0395901_0006379
329 Ga0395901_0204789
330 Ga0436361_0466980
331 Ga0466972_0151543
332 Ga0466963_0084760
333 Ga0466971_0018122
334 Ga0466960_0039216
335 Ga0466967_0294235
336 Ga0495638_0135612
337 Ga0495584_0008072
338 Ga0495656_0081822
339 Ga0496110_0009043
340 Ga0496111_0015280
341 Ga0501031_0051258
342 Ga0501032_0097925
343 Ga0501033_0035311
344 Ga0501033_0068615
345 Ga0501034_0106130
346 Ga0501034_0166246
347 Ga0501034_0193603
348 Ga0501036_0014849
349 Ga0501037_0022523
350 Ga0501038_0022202
351 Ga0501038_0035664
352 Ga0501038_0158489
353 Ga0501038_0215475
354 Ga0501039_0608394
355 Ga0501042_0003820
356 Ga0501043_0227336
357 Ga0501046_0012773
358 Ga0501046_0172067
359 Ga0501047_0030818
360 Ga0501047_0089188
361 Ga0501047_0100284
362 Ga0501047_0152013
363 Ga0501047_0191945
364 Ga0501069_0002651
365 Ga0501070_0038326
366 Ga0501070_0047792
367 Ga0501073_0031696
368 Ga0501073_0223577
369 Ga0501073_0239799
370 Ga0501074_0132318
371 Ga0501076_0207686
372 Ga0501079_0024665
373 Ga0501079_0070497
374 Ga0501080_0008942
375 Ga0501083_0005799
376 Ga0501083_0015328
377 Ga0501083_0052270
378 Ga0501035_0018523
379 Ga0501035_0023250
380 Ga0501044_0000398
381 Ga0501044_0223963
382 Ga0501045_0018655
383 nmdc:mga03683_86817_c1
384 nmdc:mga03n38_140338_c1
385 nmdc:mga03n38_287002_c1
386 nmdc:mga0yw44_121054_c1
387 nmdc:mga0k408_59937_c1
388 nmdc:mga0k408_76784_c1
389 nmdc:mga06z11_56154_c1
390 nmdc:mga04h51_157215_c1
391 nmdc:mga07m45_67177_c1
392 nmdc:mga05p37_19_c2
393 nmdc:mga05p37_530037_c1
394 nmdc:mga05p37_5389_c1
395 nmdc:mga09592_238_c1
396 nmdc:mga0qj67_259_c1
397 nmdc:mga06r32_197828_c1
398 nmdc:mga06r32_2023_c1
399 nmdc:mga08y16_2735_c1
400 nmdc:mga0n895_1651_c1
401 nmdc:mga0n895_394_c1
402 nmdc:mga0n895_7279_c1
403 nmdc:mga0n895_768082_c1
404 nmdc:mga0rr50_28022_c1
405 nmdc:mga0rr50_48999_c1
406 nmdc:mga0rr50_71247_c1
407 nmdc:mga08x19_4948_c1
408 nmdc:mga0a205_1167_c2
409 nmdc:mga0a205_249_c1
410 nmdc:mga0a205_497476_c1
411 Ga0495595_0069747
412 Ga0500652_000169
413 Ga0500616_0166481
414 Ga0501082_0693565
415 Ga0530510_0533817
416 2774871879
417 2882459001
418 2917554935

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04250

DUF429

Protein of unknown function (DUF429)

44

264

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1oh7-assembly1.cif.gz_A the crystal structure of e. coli muts binding to dna with a g:g mismatch 0.7741 11 59
5x9w-assembly1.cif.gz_A mismatch repair protein 0.766 12 57
5yk4-assembly1.cif.gz_A mismatch repair protein 0.7644 12 57
1wbd-assembly1.cif.gz_B crystal structure of e. coli dna mismatch repair enzyme muts, e38q mutant, in complex with a g.t mismatch 0.762 11 59
1ng9-assembly1.cif.gz_B e.coli muts r697a: an atpase-asymmetry mutant 0.7401 6 59
ID Description Score Start End Superfamily
af_Q9P7T0_1_425_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8005 12 41 3.50.50.60
af_A0A0R0G2M3_144_398_3.30.70.1990 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7681 12 43 3.30.70.1990
af_Q2FYZ9_124_244_3.30.420.110 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;MutS, connector domain 0.7511 11 63 3.30.420.110
1oh6B02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;MutS, connector domain 0.7147 11 59 3.30.420.110
af_Q9TXR4_111_257_3.30.420.110 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;MutS, connector domain 0.7105 11 58 3.30.420.110
ID Description Score Start End GO Terms
AF-A0A439Z7D3-F1-model_v4 deleted 0.9311 135 240
AF-A0A5R2MVC2-F1-model_v4 DUF429 domain-containing protein 0.9142 125 224
AF-A0A3S1DNG1-F1-model_v4 DUF429 domain-containing protein 0.9062 141 240
AF-A0A370HVA2-F1-model_v4 Putative RNase H-like nuclease 0.8922 11 239
AF-A0A439Z7D3-F1-model_v4 deleted 0.8915 135 240

Map