F319382

General Info

Members Datasets Scaffolds Average Seq Length
209 139 418 152

Family's Representative Sequence

Representative Sequence 3300039447|Ga0436361_0057286|Ga0436361_0057286_34_582
Length 182
Sequence LTGERPTGSVRIVDHVQRTMRIALQAAQAAAAKGETPVGAVVVDPATGKVVATGANGPIGAHDPTAHAEIVALRKAAKKLGNYRLTGLTLVVTLEPCAMCAGAISHARIGRLVYGAEDPKGGGVVHGARVFDQPTCHWRPAVQGGVLAADSAELLRGFFRARRAPKGGSALPSGDFGPEDEP

Samples

Sample ID Description Type Environment
1 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
2 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
19 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
20 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
21 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
22 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
23 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
24 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
28 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
29 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
30 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
31 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
32 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
33 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
34 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
35 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
57 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
58 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
59 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
60 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
61 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
62 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
63 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
64 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
65 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
66 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
67 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
68 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
69 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
70 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
71 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
72 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
73 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
74 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
75 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
76 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
77 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
78 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
79 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
80 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
81 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
82 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
83 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
84 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
85 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
86 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
87 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
88 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
89 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
90 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
91 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
92 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
93 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
94 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
95 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
96 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
97 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
98 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
99 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
100 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
101 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
102 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
103 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
104 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
105 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
106 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
107 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
108 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
109 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
110 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
121 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
122 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
123 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
124 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
125 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
126 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
127 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
128 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
130 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
131 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
132 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
133 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
134 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
135 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
136 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
137 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
138 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
139 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.18
Nodule 0
Rhizoplane 3.83
Rhizosphere 81.82
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436361_0057286 3300039447 Bacteria 628
2 Ga0065165_1000171 3300005262 Bacteria 114917
3 Ga0070670_100299791 3300005331 Bacteria 1406
4 Ga0070666_10435270 3300005335 Bacteria 946
5 Ga0070680_100018418 3300005336 Bacteria 5517
6 Ga0070680_100037522 3300005336 Bacteria 3915
7 Ga0068868_100539223 3300005338 Bacteria 1027
8 Ga0070691_10182750 3300005341 Bacteria 1093
9 Ga0070661_100213209 3300005344 Bacteria 1479
10 Ga0070671_100026227 3300005355 Bacteria 4788
11 Ga0070671_100102033 3300005355 Bacteria 2407
12 Ga0070659_100012877 3300005366 Bacteria 6216
13 Ga0070667_100189836 3300005367 Bacteria 1820
14 Ga0070714_100921093 3300005435 Bacteria 849
15 Ga0070678_100029073 3300005456 Bacteria 3780
16 Ga0070681_10129141 3300005458 Bacteria 2459
17 Ga0068853_100088773 3300005539 Bacteria 2714
18 Ga0068853_100161457 3300005539 Bacteria 2022
19 Ga0070665_100000622 3300005548 Bacteria 48397
20 Ga0070665_100581340 3300005548 Bacteria 1133
21 Ga0068855_100064771 3300005563 Bacteria 4262
22 Ga0068862_100030843 3300005844 Bacteria 4520
23 Ga0075365_10892054 3300006038 Bacteria 627
24 Ga0075363_100033880 3300006048 Bacteria 2664
25 Ga0075364_10000712 3300006051 Bacteria 17375
26 Ga0070712_100040907 3300006175 Bacteria 3180
27 Ga0075367_10019407 3300006178 Bacteria 3768
28 Ga0075367_10396892 3300006178 Bacteria 872
29 Ga0097620_100432155 3300006931 Bacteria 1413
30 Ga0105251_10331906 3300009011 Bacteria 692
31 Ga0105240_10393891 3300009093 Bacteria 1562
32 Ga0105240_10747598 3300009093 Bacteria 1063
33 Ga0105248_10287452 3300009177 Bacteria 1851
34 Ga0105238_10776367 3300009551 Bacteria 973
35 Ga0105238_10899331 3300009551 Bacteria 904
36 Ga0105238_11189443 3300009551 Bacteria 787
37 Ga0105238_12136073 3300009551 Bacteria 594
38 Ga0105249_10271208 3300009553 Bacteria 1691
39 Ga0163162_10104015 3300013306 Bacteria 2934
40 Ga0163163_10246806 3300014325 Bacteria 1835
41 Ga0213874_10023006 3300021377 Bacteria 1734
42 Ga0213876_10000391 3300021384 Bacteria 36827
43 Ga0209148_1043371 3300025254 Bacteria 612
44 Ga0207680_10306360 3300025903 Bacteria 1108
45 Ga0207705_10008259 3300025909 Bacteria 7609
46 Ga0207707_10117990 3300025912 Bacteria 2319
47 Ga0207695_10001379 3300025913 Bacteria 41077
48 Ga0207695_10608466 3300025913 Bacteria 974
49 Ga0207693_10149482 3300025915 Bacteria 1837
50 Ga0207660_10051773 3300025917 Bacteria 2920
51 Ga0207660_10572330 3300025917 Bacteria 919
52 Ga0207657_10003963 3300025919 Bacteria 15722
53 Ga0207649_10201946 3300025920 Bacteria 1405
54 Ga0207652_10220448 3300025921 Bacteria 1709
55 Ga0207694_10177775 3300025924 Bacteria 1725
56 Ga0207694_10351453 3300025924 Bacteria 1220
57 Ga0207650_10067195 3300025925 Bacteria 2690
58 Ga0207690_10722855 3300025932 Bacteria 820
59 Ga0207706_10030719 3300025933 Bacteria 4791
60 Ga0207667_10094694 3300025949 Bacteria 3083
61 Ga0207640_10619660 3300025981 Bacteria 918
62 Ga0207658_10194171 3300025986 Bacteria 1690
63 Ga0207677_10453712 3300026023 Bacteria 1099
64 Ga0207639_10129568 3300026041 Bacteria 2086
65 Ga0207639_10465797 3300026041 Bacteria 1150
66 Ga0207676_10019096 3300026095 Bacteria 4995
67 Ga0207683_10040931 3300026121 Bacteria 4045
68 Ga0268266_10000621 3300028379 Bacteria 48218
69 Ga0268266_10055286 3300028379 Bacteria 3412
70 Ga0268266_10770072 3300028379 Bacteria 929
71 Ga0265337_1026642 3300028556 Bacteria 1749
72 Ga0265326_10012781 3300028558 Bacteria 2460
73 Ga0265334_10038942 3300028573 Bacteria 1867
74 Ga0307517_10002263 3300028786 Bacteria 31025
75 Ga0307517_10056380 3300028786 Bacteria 3835
76 Ga0265338_10023375 3300028800 Bacteria 6358
77 Ga0265338_10076535 3300028800 Bacteria 2834
78 Ga0265338_10498281 3300028800 Bacteria 858
79 Ga0265327_10059462 3300031251 Bacteria 1957
80 Ga0307513_10005398 3300031456 Bacteria 16908
81 Ga0307513_10022294 3300031456 Bacteria 7448
82 Ga0307513_10816434 3300031456 Bacteria 639
83 Ga0307513_10949632 3300031456 Bacteria 568
84 Ga0265314_10226314 3300031711 Bacteria 1088
85 Ga0307516_10000001 3300031730 Bacteria 510338
86 Ga0307413_10089587 3300031824 Bacteria 1999
87 Ga0307413_10336556 3300031824 Bacteria 1159
88 Ga0307410_10352907 3300031852 Bacteria 1176
89 Ga0307409_100166655 3300031995 Bacteria 1934
90 Ga0307411_10024375 3300032005 Bacteria 3606
91 Ga0307411_10151933 3300032005 Bacteria 1722
92 Ga0307510_10127068 3300033180 Bacteria 2235
93 Ga0373926_0151850 3300035083 Bacteria 882
94 Ga0373927_0000010 3300035695 Bacteria 183458
95 Ga0373937_0341567 3300036401 Bacteria 1418
96 Ga0373937_1013001 3300036401 Bacteria 779
97 Ga0373937_1387633 3300036401 Bacteria 650
98 Ga0316582_0036984 3300036647 Bacteria 3024
99 Ga0316584_0111783 3300036712 Bacteria 2044
100 Ga0395899_0023516 3300037312 Bacteria 4666
101 Ga0395900_0130444 3300037418 Bacteria 2576
102 Ga0395900_0201733 3300037418 Bacteria 2012
103 Ga0395900_0290044 3300037418 Bacteria 1625
104 Ga0395900_0545625 3300037418 Bacteria 1104
105 Ga0395898_0031266 3300037466 Bacteria 5321
106 Ga0395898_0397374 3300037466 Bacteria 1314
107 Ga0395898_1176303 3300037466 Bacteria 698
108 Ga0395905_0299831 3300037471 Bacteria 1494
109 Ga0395905_0847273 3300037471 Bacteria 817
110 Ga0436364_0532820 3300037853 Bacteria 2863
111 Ga0395901_0121403 3300038443 Bacteria 2746
112 Ga0395901_0195384 3300038443 Bacteria 2121
113 Ga0395901_0614855 3300038443 Bacteria 1094
114 Ga0395901_1123019 3300038443 Bacteria 755
115 Ga0395901_1203173 3300038443 Bacteria 723
116 Ga0436365_0439594 3300039437 Bacteria 58263
117 Ga0436365_1276611 3300039437 Bacteria 795
118 Ga0436365_1723541 3300039437 Bacteria 680
119 Ga0436361_0809022 3300039447 Bacteria 794
120 Ga0436363_1074935 3300039450 Bacteria 4168
121 Ga0451577_0000441 3300042876 Bacteria 73410
122 Ga0451577_0949006 3300042876 Bacteria 773
123 Ga0466972_0167760 3300044658 Bacteria 1031
124 Ga0466965_0133665 3300044683 Bacteria 1288
125 Ga0466961_0554291 3300044693 Bacteria 692
126 Ga0453684_0000177 3300044712 Bacteria 282969
127 Ga0453684_0003576 3300044712 Bacteria 34694
128 Ga0495651_0341614 3300046462 Bacteria 992
129 Ga0495650_0035207 3300046471 Bacteria 2206
130 Ga0495620_0125711 3300046515 Bacteria 1008
131 Ga0495643_0235648 3300046522 Bacteria 861
132 Ga0495642_0063868 3300046528 Bacteria 1531
133 Ga0495652_0424767 3300046529 Bacteria 936
134 Ga0495587_0131355 3300046536 Bacteria 1431
135 Ga0495621_0166511 3300046539 Bacteria 874
136 Ga0495668_0096364 3300046616 Bacteria 1619
137 Ga0495668_0107455 3300046616 Bacteria 1526
138 Ga0495668_0189826 3300046616 Bacteria 1125
139 Ga0495625_0018350 3300046660 Bacteria 5464
140 Ga0495625_0204266 3300046660 Bacteria 1302
141 Ga0495659_0298306 3300046664 Bacteria 680
142 Ga0495669_0059567 3300046684 Bacteria 1725
143 Ga0495669_0201702 3300046684 Bacteria 951
144 Ga0495613_0001433 3300046689 Bacteria 18206
145 Ga0495677_0033381 3300047445 Bacteria 1876
146 Ga0495677_0196625 3300047445 Bacteria 783
147 Ga0495686_0381730 3300047472 Bacteria 760
148 Ga0496101_0035181 3300048904 Bacteria 3542
149 Ga0496106_0371934 3300048909 Bacteria 1148
150 Ga0496107_0085763 3300048910 Bacteria 2298
151 Ga0496107_0142736 3300048910 Bacteria 1770
152 Ga0496108_0135402 3300048911 Bacteria 2119
153 Ga0496109_0063449 3300048912 Bacteria 3380
154 Ga0496110_0394926 3300048913 Bacteria 1261
155 Ga0496115_0460416 3300048918 Bacteria 1026
156 Ga0501032_0110000 3300049569 Bacteria 1824
157 Ga0501033_0002682 3300049570 Bacteria 14944
158 Ga0501033_0210901 3300049570 Bacteria 1385
159 Ga0501034_0003664 3300049571 Bacteria 17373
160 Ga0501034_0029833 3300049571 Bacteria 5543
161 Ga0501034_0273440 3300049571 Bacteria 1630
162 Ga0501036_0050700 3300049572 Bacteria 3515
163 Ga0501036_0093917 3300049572 Bacteria 2535
164 Ga0501036_0195223 3300049572 Bacteria 1703
165 Ga0501037_0076984 3300049573 Bacteria 2421
166 Ga0501037_0131804 3300049573 Bacteria 1792
167 Ga0501038_0000014 3300049574 Bacteria 164836
168 Ga0501038_0019132 3300049574 Bacteria 6176
169 Ga0501039_0399501 3300049575 Bacteria 1079
170 Ga0501043_0007413 3300049579 Bacteria 8705
171 Ga0501046_0039643 3300049580 Bacteria 3770
172 Ga0501046_0324097 3300049580 Bacteria 1122
173 Ga0501047_0001827 3300049581 Bacteria 20573
174 Ga0501047_0023006 3300049581 Bacteria 5982
175 Ga0501047_0124132 3300049581 Bacteria 2462
176 Ga0501047_0371409 3300049581 Bacteria 1265
177 Ga0501047_0378203 3300049581 Bacteria 1251
178 Ga0501067_0000058 3300049583 Bacteria 64397
179 Ga0501067_0053466 3300049583 Bacteria 2238
180 Ga0501068_0004654 3300049584 Bacteria 7468
181 Ga0501068_0012275 3300049584 Bacteria 4849
182 Ga0501073_0000092 3300049589 Bacteria 56936
183 Ga0501073_0009751 3300049589 Bacteria 7070
184 Ga0501074_0133551 3300049590 Bacteria 1775
185 Ga0501076_0750668 3300049592 Bacteria 805
186 Ga0501077_0002153 3300049593 Bacteria 11901
187 Ga0501080_0004801 3300049742 Bacteria 12055
188 Ga0501080_0013554 3300049742 Bacteria 7503
189 Ga0501080_0060511 3300049742 Bacteria 3526
190 Ga0501080_0703748 3300049742 Bacteria 891
191 Ga0501083_0009870 3300049744 Bacteria 6741
192 Ga0501083_0685696 3300049744 Bacteria 666
193 Ga0501035_0212369 3300049822 Bacteria 1655
194 Ga0501044_0011155 3300049823 Bacteria 9745
195 Ga0501044_0136782 3300049823 Bacteria 2441
196 Ga0501044_0365763 3300049823 Bacteria 1360
197 Ga0501044_0393207 3300049823 Bacteria 1300
198 Ga0501044_0480139 3300049823 Bacteria 1146
199 nmdc:mga03683_273108_c1 3300050489 Bacteria 789
200 nmdc:mga03n38_167604_c1 3300050490 Bacteria 1116
201 nmdc:mga0yw44_938953_c1 3300050492 Bacteria 586
202 Ga0500650_0307012 3300053098 Bacteria 701
203 Ga0500597_259656 3300053120 Bacteria 708
204 Ga0500559_0158364 3300053136 Bacteria 1064
205 Ga0500590_027758 3300053148 Bacteria 2937
206 Ga0500645_002066 3300053730 Bacteria 9311
207 Ga0501084_0020521 3300054114 Bacteria 5511
208 Ga0501082_0051414 3300060353 Bacteria 3552
209 Ga0501082_0176344 3300060353 Bacteria 1858
210 Ga0436361_0057286
211 Ga0065165_1000171
212 Ga0070670_100299791
213 Ga0070666_10435270
214 Ga0070680_100018418
215 Ga0070680_100037522
216 Ga0068868_100539223
217 Ga0070691_10182750
218 Ga0070661_100213209
219 Ga0070671_100026227
220 Ga0070671_100102033
221 Ga0070659_100012877
222 Ga0070667_100189836
223 Ga0070714_100921093
224 Ga0070678_100029073
225 Ga0070681_10129141
226 Ga0068853_100088773
227 Ga0068853_100161457
228 Ga0070665_100000622
229 Ga0070665_100581340
230 Ga0068855_100064771
231 Ga0068862_100030843
232 Ga0075365_10892054
233 Ga0075363_100033880
234 Ga0075364_10000712
235 Ga0070712_100040907
236 Ga0075367_10019407
237 Ga0075367_10396892
238 Ga0097620_100432155
239 Ga0105251_10331906
240 Ga0105240_10393891
241 Ga0105240_10747598
242 Ga0105248_10287452
243 Ga0105238_10776367
244 Ga0105238_10899331
245 Ga0105238_11189443
246 Ga0105238_12136073
247 Ga0105249_10271208
248 Ga0163162_10104015
249 Ga0163163_10246806
250 Ga0213874_10023006
251 Ga0213876_10000391
252 Ga0209148_1043371
253 Ga0207680_10306360
254 Ga0207705_10008259
255 Ga0207707_10117990
256 Ga0207695_10001379
257 Ga0207695_10608466
258 Ga0207693_10149482
259 Ga0207660_10051773
260 Ga0207660_10572330
261 Ga0207657_10003963
262 Ga0207649_10201946
263 Ga0207652_10220448
264 Ga0207694_10177775
265 Ga0207694_10351453
266 Ga0207650_10067195
267 Ga0207690_10722855
268 Ga0207706_10030719
269 Ga0207667_10094694
270 Ga0207640_10619660
271 Ga0207658_10194171
272 Ga0207677_10453712
273 Ga0207639_10129568
274 Ga0207639_10465797
275 Ga0207676_10019096
276 Ga0207683_10040931
277 Ga0268266_10000621
278 Ga0268266_10055286
279 Ga0268266_10770072
280 Ga0265337_1026642
281 Ga0265326_10012781
282 Ga0265334_10038942
283 Ga0307517_10002263
284 Ga0307517_10056380
285 Ga0265338_10023375
286 Ga0265338_10076535
287 Ga0265338_10498281
288 Ga0265327_10059462
289 Ga0307513_10005398
290 Ga0307513_10022294
291 Ga0307513_10816434
292 Ga0307513_10949632
293 Ga0265314_10226314
294 Ga0307516_10000001
295 Ga0307413_10089587
296 Ga0307413_10336556
297 Ga0307410_10352907
298 Ga0307409_100166655
299 Ga0307411_10024375
300 Ga0307411_10151933
301 Ga0307510_10127068
302 Ga0373926_0151850
303 Ga0373927_0000010
304 Ga0373937_0341567
305 Ga0373937_1013001
306 Ga0373937_1387633
307 Ga0316582_0036984
308 Ga0316584_0111783
309 Ga0395899_0023516
310 Ga0395900_0130444
311 Ga0395900_0201733
312 Ga0395900_0290044
313 Ga0395900_0545625
314 Ga0395898_0031266
315 Ga0395898_0397374
316 Ga0395898_1176303
317 Ga0395905_0299831
318 Ga0395905_0847273
319 Ga0436364_0532820
320 Ga0395901_0121403
321 Ga0395901_0195384
322 Ga0395901_0614855
323 Ga0395901_1123019
324 Ga0395901_1203173
325 Ga0436365_0439594
326 Ga0436365_1276611
327 Ga0436365_1723541
328 Ga0436361_0809022
329 Ga0436363_1074935
330 Ga0451577_0000441
331 Ga0451577_0949006
332 Ga0466972_0167760
333 Ga0466965_0133665
334 Ga0466961_0554291
335 Ga0453684_0000177
336 Ga0453684_0003576
337 Ga0495651_0341614
338 Ga0495650_0035207
339 Ga0495620_0125711
340 Ga0495643_0235648
341 Ga0495642_0063868
342 Ga0495652_0424767
343 Ga0495587_0131355
344 Ga0495621_0166511
345 Ga0495668_0096364
346 Ga0495668_0107455
347 Ga0495668_0189826
348 Ga0495625_0018350
349 Ga0495625_0204266
350 Ga0495659_0298306
351 Ga0495669_0059567
352 Ga0495669_0201702
353 Ga0495613_0001433
354 Ga0495677_0033381
355 Ga0495677_0196625
356 Ga0495686_0381730
357 Ga0496101_0035181
358 Ga0496106_0371934
359 Ga0496107_0085763
360 Ga0496107_0142736
361 Ga0496108_0135402
362 Ga0496109_0063449
363 Ga0496110_0394926
364 Ga0496115_0460416
365 Ga0501032_0110000
366 Ga0501033_0002682
367 Ga0501033_0210901
368 Ga0501034_0003664
369 Ga0501034_0029833
370 Ga0501034_0273440
371 Ga0501036_0050700
372 Ga0501036_0093917
373 Ga0501036_0195223
374 Ga0501037_0076984
375 Ga0501037_0131804
376 Ga0501038_0000014
377 Ga0501038_0019132
378 Ga0501039_0399501
379 Ga0501043_0007413
380 Ga0501046_0039643
381 Ga0501046_0324097
382 Ga0501047_0001827
383 Ga0501047_0023006
384 Ga0501047_0124132
385 Ga0501047_0371409
386 Ga0501047_0378203
387 Ga0501067_0000058
388 Ga0501067_0053466
389 Ga0501068_0004654
390 Ga0501068_0012275
391 Ga0501073_0000092
392 Ga0501073_0009751
393 Ga0501074_0133551
394 Ga0501076_0750668
395 Ga0501077_0002153
396 Ga0501080_0004801
397 Ga0501080_0013554
398 Ga0501080_0060511
399 Ga0501080_0703748
400 Ga0501083_0009870
401 Ga0501083_0685696
402 Ga0501035_0212369
403 Ga0501044_0011155
404 Ga0501044_0136782
405 Ga0501044_0365763
406 Ga0501044_0393207
407 Ga0501044_0480139
408 nmdc:mga03683_273108_c1
409 nmdc:mga03n38_167604_c1
410 nmdc:mga0yw44_938953_c1
411 Ga0500650_0307012
412 Ga0500597_259656
413 Ga0500559_0158364
414 Ga0500590_027758
415 Ga0500645_002066
416 Ga0501084_0020521
417 Ga0501082_0051414
418 Ga0501082_0176344

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00383

dCMP_cyt_deam_1

Cytidine and deoxycytidylate deaminase zinc-binding region

13

116

0.97

PF14437

MafB19-deam

MafB19-like deaminase

14

163

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2a8n-assembly1.cif.gz_B biochemical and structural studies of a-to-i editing by trna:a34 deaminases at the wobble position of transfer rna 0.9876 1 136
3ocq-assembly1.cif.gz_A-2 crystal structure of trna-specific adenosine deaminase from salmonella enterica 0.9865 1 141
2a8n-assembly1.cif.gz_A biochemical and structural studies of a-to-i editing by trna:a34 deaminases at the wobble position of transfer rna 0.9852 1 126
1z3a-assembly1.cif.gz_B crystal structure of trna adenosine deaminase tada from escherichia coli 0.9841 2 146
2b3j-assembly2.cif.gz_D crystal structure of staphylococcus aureus trna adenosine deaminase, tada, in complex with rna 0.9815 2 145
ID Description Score Start End Superfamily
2a8nA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9852 1 126 3.40.140.10
2b3jA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9821 2 146 3.40.140.10
af_A0A1D6PV52_1_75_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9795 38 97 3.40.140.10
1wwrD00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.976 2 146 3.40.140.10
2nx8A00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9744 2 145 3.40.140.10
ID Description Score Start End GO Terms
AF-A0A328AZQ7-F1-model_v4 tRNA-specific adenosine deaminase (EC 3.5.4.33) 1.004 1 146 GO:0002100
GO:0008270
GO:0052717
AF-A0A258H141-F1-model_v4 tRNA-specific adenosine deaminase (EC 3.5.4.33) 1.002 1 143 GO:0002100
GO:0008270
GO:0052717
AF-R6IPM5-F1-model_v4 deleted 1.002 1 145
AF-A0A4Q3SMP6-F1-model_v4 tRNA(adenine(34)) deaminase (EC 3.5.4.33) 1.002 19 145 GO:0002100
GO:0008270
GO:0052717
AF-A0A2Z3I018-F1-model_v4 tRNA-specific adenosine deaminase (EC 3.5.4.33) 1.001 1 145 GO:0002100
GO:0008270
GO:0052717

Map