F318623

General Info

Members Datasets Scaffolds Average Seq Length
209 151 418 178

Family's Representative Sequence

Representative Sequence 3300005293|Ga0065715_10167950|Ga0065715_101679502
Length 195
Sequence MKKTVLTFGVISGLIIAALMSITLPFSHQIGLNRAMVIGYTTMVLAFLLVFFGIRSYRENVGNGSISFGRALSVGFLIMLISCCFYVATWEVIYHTFLPNFADEYMTIASEQMRTSGKPPQQIEAEIANMQSMMQMYKNNILFNIAFTFLEPLPVGLVMTLISALILRKRRRGERDLQDYQDGVKENPVNLRNPV

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
101 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
102 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
103 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
104 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
105 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
106 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
107 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
108 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
109 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
110 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
111 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
112 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
113 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
114 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
115 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
116 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
117 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
118 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
119 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
120 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
121 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
122 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
123 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
124 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
125 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
129 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
130 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
131 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
132 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
133 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
134 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
135 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
136 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
137 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
138 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
139 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
140 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
141 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
142 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
143 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
144 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
145 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
146 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
147 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
148 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
149 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
150 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
151 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.91
Rhizosphere 97.13
Stem 0
Stem Tuber 0
Unclassified 36.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10167950 3300005293 Bacteria 1570
2 MBSR1b_contig_3108144 2162886012 Bacteria 1081
3 LJNas_1003358 3300000546 Bacteria 1845
4 Ga0065715_10132931 3300005293 Unclassified 1981
5 Ga0065707_10507158 3300005295 Bacteria 752
6 Ga0070676_10723486 3300005328 Unclassified 728
7 Ga0068869_100254783 3300005334 Bacteria 1403
8 Ga0070689_100285145 3300005340 Bacteria 1371
9 Ga0070689_100507226 3300005340 Bacteria 1034
10 Ga0070661_101305746 3300005344 Unclassified 609
11 Ga0070692_10239030 3300005345 Bacteria 1082
12 Ga0070671_100819332 3300005355 Bacteria 811
13 Ga0070714_100102840 3300005435 Bacteria 2519
14 Ga0070713_100134031 3300005436 Bacteria 2187
15 Ga0070701_10282803 3300005438 Unclassified 1014
16 Ga0070701_10994432 3300005438 Unclassified 585
17 Ga0070700_100110790 3300005441 Unclassified 1824
18 Ga0070700_100200630 3300005441 Bacteria 1401
19 Ga0070694_100125353 3300005444 Unclassified 1848
20 Ga0070694_100284433 3300005444 Unclassified 1262
21 Ga0070694_100323926 3300005444 Unclassified 1187
22 Ga0070662_100208720 3300005457 Bacteria 1553
23 Ga0070681_10057602 3300005458 Unclassified 3866
24 Ga0070681_10563896 3300005458 Unclassified 1052
25 Ga0068867_100352780 3300005459 Unclassified 1228
26 Ga0068867_100482627 3300005459 Unclassified 1062
27 Ga0070706_100000216 3300005467 Bacteria 71047
28 Ga0070706_100202383 3300005467 Unclassified 1855
29 Ga0070707_100133093 3300005468 Bacteria 2418
30 Ga0070707_100572132 3300005468 Unclassified 1092
31 Ga0070698_100095666 3300005471 Unclassified 2947
32 Ga0070699_100252900 3300005518 Bacteria 1575
33 Ga0070699_100288235 3300005518 Bacteria 1471
34 Ga0070699_101090936 3300005518 Unclassified 732
35 Ga0070679_100001228 3300005530 Bacteria 22505
36 Ga0070679_100086295 3300005530 Bacteria 3125
37 Ga0070679_101094831 3300005530 Bacteria 741
38 Ga0070697_101420998 3300005536 Unclassified 620
39 Ga0068853_100016587 3300005539 Bacteria 6065
40 Ga0070686_100975096 3300005544 Bacteria 694
41 Ga0070695_100198260 3300005545 Bacteria 1433
42 Ga0070695_100387702 3300005545 Unclassified 1056
43 Ga0070695_100729046 3300005545 Unclassified 789
44 Ga0070695_100955051 3300005545 Bacteria 695
45 Ga0070693_100358029 3300005547 Bacteria 1001
46 Ga0068855_100062314 3300005563 Unclassified 4354
47 Ga0070664_101567297 3300005564 Unclassified 624
48 Ga0068857_100397087 3300005577 Bacteria 1283
49 Ga0068854_100036317 3300005578 Bacteria 3454
50 Ga0068854_100120781 3300005578 Bacteria 1989
51 Ga0068854_100410439 3300005578 Bacteria 1123
52 Ga0068854_100808071 3300005578 Unclassified 818
53 Ga0068856_100075965 3300005614 Bacteria 3328
54 Ga0068852_100022938 3300005616 Bacteria 5015
55 Ga0068859_100018210 3300005617 Bacteria 7061
56 Ga0068859_100376715 3300005617 Bacteria 1515
57 Ga0068859_101061627 3300005617 Bacteria 890
58 Ga0068859_101210477 3300005617 Unclassified 832
59 Ga0068864_100297290 3300005618 Bacteria 1511
60 Ga0068861_100163586 3300005719 Unclassified 1838
61 Ga0068870_10770505 3300005840 Unclassified 670
62 Ga0068858_100231795 3300005842 Bacteria 1751
63 Ga0068862_100268792 3300005844 Bacteria 1559
64 Ga0081539_10001600 3300005985 Bacteria 37341
65 Ga0081539_10052788 3300005985 Bacteria 2280
66 Ga0070717_10295036 3300006028 Unclassified 1440
67 Ga0070717_11165572 3300006028 Bacteria 701
68 Ga0070712_100006895 3300006175 Bacteria 7080
69 Ga0097621_100887744 3300006237 Unclassified 830
70 Ga0075430_100002258 3300006846 Bacteria 15985
71 Ga0075430_100004090 3300006846 Bacteria 12308
72 Ga0075430_100222840 3300006846 Bacteria 1565
73 Ga0075431_100121798 3300006847 Bacteria 2691
74 Ga0075431_100149879 3300006847 Bacteria 2402
75 Ga0075433_10011804 3300006852 Bacteria 7037
76 Ga0075433_10045283 3300006852 Bacteria 3824
77 Ga0075434_100020673 3300006871 Bacteria 6390
78 Ga0075434_100201543 3300006871 Unclassified 2010
79 Ga0075429_100161914 3300006880 Unclassified 1960
80 Ga0097620_100018209 3300006931 Bacteria 7061
81 Ga0097620_100376695 3300006931 Bacteria 1515
82 Ga0097620_101061544 3300006931 Bacteria 890
83 Ga0097620_101210723 3300006931 Unclassified 832
84 Ga0105240_10085884 3300009093 Unclassified 3855
85 Ga0105245_10814284 3300009098 Unclassified 972
86 Ga0105247_10150785 3300009101 Bacteria 1532
87 Ga0114129_10008450 3300009147 Bacteria 14670
88 Ga0105243_10281945 3300009148 Bacteria 1497
89 Ga0105241_10108792 3300009174 Bacteria 2216
90 Ga0105241_10172501 3300009174 Bacteria 1787
91 Ga0105248_10024670 3300009177 Bacteria 6686
92 Ga0105248_10678674 3300009177 Bacteria 1162
93 Ga0105237_10753635 3300009545 Bacteria 980
94 Ga0105238_10045746 3300009551 Bacteria 4421
95 Ga0105238_10084164 3300009551 Unclassified 3170
96 Ga0105249_10110321 3300009553 Bacteria 2600
97 Ga0105249_11139588 3300009553 Bacteria 850
98 Ga0157370_10070196 3300013104 Bacteria 3307
99 Ga0157369_10059973 3300013105 Unclassified 4103
100 Ga0157378_10018602 3300013297 Bacteria 6108
101 Ga0163162_10478109 3300013306 Unclassified 1377
102 Ga0157372_10248849 3300013307 Bacteria 2063
103 Ga0157372_11370218 3300013307 Unclassified 816
104 Ga0157377_10010398 3300014745 Unclassified 4602
105 Ga0157379_10075780 3300014968 Bacteria 3012
106 Ga0182007_10056914 3300015262 Bacteria 1284
107 Ga0163161_10014269 3300017792 Bacteria 5532
108 Ga0207647_10127637 3300025904 Unclassified 1496
109 Ga0207684_10000117 3300025910 Bacteria 148207
110 Ga0207684_10164553 3300025910 Bacteria 1911
111 Ga0207684_10554089 3300025910 Unclassified 983
112 Ga0207654_10118494 3300025911 Bacteria 1658
113 Ga0207707_10010363 3300025912 Bacteria 8088
114 Ga0207693_10119580 3300025915 Unclassified 2069
115 Ga0207660_10015092 3300025917 Bacteria 5093
116 Ga0207649_10132908 3300025920 Bacteria 1693
117 Ga0207652_10145868 3300025921 Bacteria 2118
118 Ga0207646_10409129 3300025922 Bacteria 1225
119 Ga0207646_10539182 3300025922 Unclassified 1050
120 Ga0207694_10013708 3300025924 Bacteria 6109
121 Ga0207694_10122973 3300025924 Unclassified 2073
122 Ga0207700_10008813 3300025928 Bacteria 6268
123 Ga0207700_10978776 3300025928 Bacteria 757
124 Ga0207664_10594941 3300025929 Bacteria 993
125 Ga0207706_10125146 3300025933 Bacteria 2261
126 Ga0207665_10022584 3300025939 Unclassified 4140
127 Ga0207711_10017942 3300025941 Bacteria 5881
128 Ga0207689_10208502 3300025942 Bacteria 1614
129 Ga0207667_10079697 3300025949 Bacteria 3394
130 Ga0207712_10002526 3300025961 Bacteria 11769
131 Ga0207640_10124337 3300025981 Bacteria 1855
132 Ga0207677_10188418 3300026023 Bacteria 1629
133 Ga0207703_10134650 3300026035 Unclassified 2138
134 Ga0207703_10435162 3300026035 Unclassified 1223
135 Ga0207678_10122697 3300026067 Bacteria 2217
136 Ga0207708_10000057 3300026075 Bacteria 97103
137 Ga0207708_10109817 3300026075 Unclassified 2140
138 Ga0207708_10339053 3300026075 Unclassified 1231
139 Ga0207648_10091481 3300026089 Unclassified 2659
140 Ga0207648_10484353 3300026089 Unclassified 1130
141 Ga0207676_10191326 3300026095 Bacteria 1801
142 Ga0207674_10154271 3300026116 Bacteria 2252
143 Ga0207675_100170210 3300026118 Unclassified 2082
144 Ga0207698_11202182 3300026142 Unclassified 772
145 Ga0268265_10185538 3300028380 Bacteria 1791
146 Ga0268265_10801336 3300028380 Bacteria 918
147 Ga0268264_10219606 3300028381 Unclassified 1749
148 Ga0268264_10746495 3300028381 Bacteria 975
149 Ga0307405_10547142 3300031731 Bacteria 936
150 Ga0307410_10090292 3300031852 Bacteria 2173
151 Ga0307416_101416024 3300032002 Unclassified 801
152 Ga0307411_10110213 3300032005 Bacteria 1968
153 Ga0307415_100638802 3300032126 Unclassified 953
154 Ga0307415_100717418 3300032126 Bacteria 904
155 Ga0307507_10054248 3300033179 Bacteria 3817
156 Ga0373951_0001184 3300035091 Bacteria 6897
157 Ga0395900_0493878 3300037418 Bacteria 1175
158 Ga0395905_0554594 3300037471 Unclassified 1050
159 Ga0242422_01591 3300038699 Bacteria 1567
160 Ga0242420_069821 3300038996 Unclassified 712
161 Ga0439444_0039858 3300042437 Unclassified 918
162 Ga0466969_0338166 3300044656 Bacteria 681
163 Ga0466961_0013970 3300044693 Bacteria 5146
164 Ga0451576_0942929 3300045051 Unclassified 905
165 Ga0495586_0311583 3300046535 Bacteria 902
166 Ga0495624_0342147 3300046690 Bacteria 900
167 Ga0496102_1194389 3300048905 Unclassified 680
168 Ga0496107_0330086 3300048910 Unclassified 1135
169 Ga0496108_0251031 3300048911 Bacteria 1539
170 Ga0496112_0578281 3300048915 Bacteria 1056
171 Ga0496123_0198891 3300048926 Unclassified 1029
172 Ga0501291_002657 3300049514 Bacteria 2164
173 Ga0501292_129581 3300049515 Unclassified 520
174 Ga0501298_001550 3300049521 Unclassified 3393
175 Ga0501038_0010790 3300049574 Bacteria 8350
176 Ga0501040_0197964 3300049576 Bacteria 1426
177 Ga0501042_0593963 3300049578 Unclassified 805
178 Ga0501067_0333301 3300049583 Bacteria 845
179 Ga0501072_0276054 3300049588 Bacteria 1337
180 Ga0501073_0004187 3300049589 Bacteria 10819
181 Ga0501075_0067367 3300049591 Bacteria 2704
182 Ga0501227_117105 3300049665 Unclassified 717
183 Ga0501228_012361 3300049666 Bacteria 877
184 Ga0501230_060610 3300049667 Unclassified 766
185 Ga0501233_021574 3300049668 Bacteria 1384
186 Ga0501235_060263 3300049669 Unclassified 888
187 Ga0501249_118714 3300049679 Unclassified 644
188 Ga0501221_083455 3300049704 Unclassified 772
189 Ga0501225_0017099 3300049705 Bacteria 2014
190 Ga0501079_0528444 3300049741 Unclassified 927
191 Ga0501080_0471242 3300049742 Bacteria 1124
192 Ga0501270_008957 3300049767 Bacteria 1281
193 Ga0501283_001247 3300049779 Unclassified 3354
194 Ga0501212_057672 3300049851 Unclassified 667
195 nmdc:mga05p37_323903_c1 3300050507 Bacteria 1823
196 nmdc:mga09592_1321738_c1 3300050508 Unclassified 592
197 nmdc:mga09592_334244_c1 3300050508 Bacteria 1312
198 nmdc:mga0qj67_22525_c1 3300050509 Bacteria 4839
199 nmdc:mga0qj67_33259_c1 3300050509 Unclassified 4023
200 nmdc:mga0qj67_5596_c1 3300050509 Bacteria 9180
201 nmdc:mga06r32_168427_c1 3300050510 Bacteria 2174
202 nmdc:mga06r32_298548_c1 3300050510 Bacteria 1597
203 nmdc:mga06r32_35893_c1 3300050510 Bacteria 4679
204 nmdc:mga0n895_301604_c1 3300050512 Bacteria 1624
205 nmdc:mga0n895_74936_c1 3300050512 Bacteria 3363
206 nmdc:mga0a205_12414_c1 3300050515 Bacteria 7878
207 nmdc:mga0a205_137299_c1 3300050515 Unclassified 2346
208 nmdc:mga0a205_14259_c1 3300050515 Bacteria 7410
209 Ga0501082_0454193 3300060353 Unclassified 1120
210 Ga0065715_10167950
211 MBSR1b_contig_3108144
212 LJNas_1003358
213 Ga0065715_10132931
214 Ga0065707_10507158
215 Ga0070676_10723486
216 Ga0068869_100254783
217 Ga0070689_100285145
218 Ga0070689_100507226
219 Ga0070661_101305746
220 Ga0070692_10239030
221 Ga0070671_100819332
222 Ga0070714_100102840
223 Ga0070713_100134031
224 Ga0070701_10282803
225 Ga0070701_10994432
226 Ga0070700_100110790
227 Ga0070700_100200630
228 Ga0070694_100125353
229 Ga0070694_100284433
230 Ga0070694_100323926
231 Ga0070662_100208720
232 Ga0070681_10057602
233 Ga0070681_10563896
234 Ga0068867_100352780
235 Ga0068867_100482627
236 Ga0070706_100000216
237 Ga0070706_100202383
238 Ga0070707_100133093
239 Ga0070707_100572132
240 Ga0070698_100095666
241 Ga0070699_100252900
242 Ga0070699_100288235
243 Ga0070699_101090936
244 Ga0070679_100001228
245 Ga0070679_100086295
246 Ga0070679_101094831
247 Ga0070697_101420998
248 Ga0068853_100016587
249 Ga0070686_100975096
250 Ga0070695_100198260
251 Ga0070695_100387702
252 Ga0070695_100729046
253 Ga0070695_100955051
254 Ga0070693_100358029
255 Ga0068855_100062314
256 Ga0070664_101567297
257 Ga0068857_100397087
258 Ga0068854_100036317
259 Ga0068854_100120781
260 Ga0068854_100410439
261 Ga0068854_100808071
262 Ga0068856_100075965
263 Ga0068852_100022938
264 Ga0068859_100018210
265 Ga0068859_100376715
266 Ga0068859_101061627
267 Ga0068859_101210477
268 Ga0068864_100297290
269 Ga0068861_100163586
270 Ga0068870_10770505
271 Ga0068858_100231795
272 Ga0068862_100268792
273 Ga0081539_10001600
274 Ga0081539_10052788
275 Ga0070717_10295036
276 Ga0070717_11165572
277 Ga0070712_100006895
278 Ga0097621_100887744
279 Ga0075430_100002258
280 Ga0075430_100004090
281 Ga0075430_100222840
282 Ga0075431_100121798
283 Ga0075431_100149879
284 Ga0075433_10011804
285 Ga0075433_10045283
286 Ga0075434_100020673
287 Ga0075434_100201543
288 Ga0075429_100161914
289 Ga0097620_100018209
290 Ga0097620_100376695
291 Ga0097620_101061544
292 Ga0097620_101210723
293 Ga0105240_10085884
294 Ga0105245_10814284
295 Ga0105247_10150785
296 Ga0114129_10008450
297 Ga0105243_10281945
298 Ga0105241_10108792
299 Ga0105241_10172501
300 Ga0105248_10024670
301 Ga0105248_10678674
302 Ga0105237_10753635
303 Ga0105238_10045746
304 Ga0105238_10084164
305 Ga0105249_10110321
306 Ga0105249_11139588
307 Ga0157370_10070196
308 Ga0157369_10059973
309 Ga0157378_10018602
310 Ga0163162_10478109
311 Ga0157372_10248849
312 Ga0157372_11370218
313 Ga0157377_10010398
314 Ga0157379_10075780
315 Ga0182007_10056914
316 Ga0163161_10014269
317 Ga0207647_10127637
318 Ga0207684_10000117
319 Ga0207684_10164553
320 Ga0207684_10554089
321 Ga0207654_10118494
322 Ga0207707_10010363
323 Ga0207693_10119580
324 Ga0207660_10015092
325 Ga0207649_10132908
326 Ga0207652_10145868
327 Ga0207646_10409129
328 Ga0207646_10539182
329 Ga0207694_10013708
330 Ga0207694_10122973
331 Ga0207700_10008813
332 Ga0207700_10978776
333 Ga0207664_10594941
334 Ga0207706_10125146
335 Ga0207665_10022584
336 Ga0207711_10017942
337 Ga0207689_10208502
338 Ga0207667_10079697
339 Ga0207712_10002526
340 Ga0207640_10124337
341 Ga0207677_10188418
342 Ga0207703_10134650
343 Ga0207703_10435162
344 Ga0207678_10122697
345 Ga0207708_10000057
346 Ga0207708_10109817
347 Ga0207708_10339053
348 Ga0207648_10091481
349 Ga0207648_10484353
350 Ga0207676_10191326
351 Ga0207674_10154271
352 Ga0207675_100170210
353 Ga0207698_11202182
354 Ga0268265_10185538
355 Ga0268265_10801336
356 Ga0268264_10219606
357 Ga0268264_10746495
358 Ga0307405_10547142
359 Ga0307410_10090292
360 Ga0307416_101416024
361 Ga0307411_10110213
362 Ga0307415_100638802
363 Ga0307415_100717418
364 Ga0307507_10054248
365 Ga0373951_0001184
366 Ga0395900_0493878
367 Ga0395905_0554594
368 Ga0242422_01591
369 Ga0242420_069821
370 Ga0439444_0039858
371 Ga0466969_0338166
372 Ga0466961_0013970
373 Ga0451576_0942929
374 Ga0495586_0311583
375 Ga0495624_0342147
376 Ga0496102_1194389
377 Ga0496107_0330086
378 Ga0496108_0251031
379 Ga0496112_0578281
380 Ga0496123_0198891
381 Ga0501291_002657
382 Ga0501292_129581
383 Ga0501298_001550
384 Ga0501038_0010790
385 Ga0501040_0197964
386 Ga0501042_0593963
387 Ga0501067_0333301
388 Ga0501072_0276054
389 Ga0501073_0004187
390 Ga0501075_0067367
391 Ga0501227_117105
392 Ga0501228_012361
393 Ga0501230_060610
394 Ga0501233_021574
395 Ga0501235_060263
396 Ga0501249_118714
397 Ga0501221_083455
398 Ga0501225_0017099
399 Ga0501079_0528444
400 Ga0501080_0471242
401 Ga0501270_008957
402 Ga0501283_001247
403 Ga0501212_057672
404 nmdc:mga05p37_323903_c1
405 nmdc:mga09592_1321738_c1
406 nmdc:mga09592_334244_c1
407 nmdc:mga0qj67_22525_c1
408 nmdc:mga0qj67_33259_c1
409 nmdc:mga0qj67_5596_c1
410 nmdc:mga06r32_168427_c1
411 nmdc:mga06r32_298548_c1
412 nmdc:mga06r32_35893_c1
413 nmdc:mga0n895_301604_c1
414 nmdc:mga0n895_74936_c1
415 nmdc:mga0a205_12414_c1
416 nmdc:mga0a205_137299_c1
417 nmdc:mga0a205_14259_c1
418 Ga0501082_0454193

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13858

DUF4199

Protein of unknown function (DUF4199)

7

169

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
8fed-assembly1.cif.gz_K structure of mce1-lucb complex from mycobacterium smegmatis (map1) 0.6026 4 168
8fed-assembly1.cif.gz_K structure of mce1-lucb complex from mycobacterium smegmatis (map1) 0.565 4 168
5xu1-assembly1.cif.gz_M structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.5066 33 164
7mdy-assembly1.cif.gz_B lolcde nucleotide-bound 0.4587 20 167
8hd0-assembly1.cif.gz_D cell divisome spg hydrolysis machinery ftsex-envc 0.4575 26 165
ID Description Score Start End Superfamily
af_Q2QQD1_96_187_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.6583 102 156 1.10.287.110
af_Q9VDE6_561_704_1.20.58.670 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Dsl1p vesicle tethering complex, Tip20p subunit, domain D 0.438 16 88 1.20.58.670
af_Q2FYN3_1_133_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.4333 3 166 1.20.1070.10
af_I1JZ21_16_139_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.4316 5 119 1.10.10.1740
af_Q2FYN3_1_133_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.4252 3 166 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0A1Z5SDT7-F1-model_v4 DUF4199 domain-containing protein 0.9514 1 172 GO:0016020
AF-A0A2V7Z9F8-F1-model_v4 DUF4199 domain-containing protein 0.9348 2 173 GO:0016020
AF-A0A7V2RKI6-F1-model_v4 DUF4199 domain-containing protein 0.9258 1 172 GO:0016020
AF-A0A832BQY0-F1-model_v4 DUF4199 domain-containing protein 0.9249 1 171 GO:0016020
AF-A0A6N6KPA4-F1-model_v4 DUF4199 domain-containing protein 0.922 1 171 GO:0016020

Map