F318443

General Info

Members Datasets Scaffolds Average Seq Length
208 170 199 148

Family's Representative Sequence

Representative Sequence 3300053090|Ga0500646_0042419|Ga0500646_0042419_593_1108
Length 171
Sequence MAGYGSTEHALHFRNADSHGRTIVTVLFAFLHHLAAFTLVAAVAIEFVLLRGELTLWAARRLQVTDAVLGIAATVLLAAGLARVFWFEKGAAYYFHSHAFLGKFALFIIVGLLSIVPTREFLSWRKATKAGETPVVAAGQLKRVRMVVHIELAAIVLILLCAAIMAKGGWV

Samples

Sample ID Description Type Environment
1 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
2 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
3 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
4 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
5 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
6 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
7 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
8 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
9 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
37 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
38 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
62 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
63 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
64 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
65 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
66 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
87 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
89 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
90 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
91 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
92 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
93 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
94 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
95 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
96 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
97 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
98 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
99 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
100 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
101 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
102 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
103 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
104 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
105 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
106 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
107 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
108 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
109 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
110 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
111 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
112 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
113 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
114 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
115 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
116 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
117 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
118 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
119 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
120 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
121 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
122 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
123 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
124 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
125 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
126 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
127 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
128 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
129 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
130 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
131 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
132 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
139 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
140 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
141 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
142 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
143 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
144 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
146 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
147 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
148 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
149 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
150 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
151 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
152 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
153 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
154 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
155 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
156 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
157 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
158 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
159 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
160 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
161 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
162 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
163 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
164 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
165 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
166 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
167 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
168 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
169 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
170 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.67
Metatranscriptomes 0
Isolates 4.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.9
Nodule 3.85
Rhizoplane 5.77
Rhizosphere 70.67
Stem 0
Stem Tuber 0
Unclassified 4.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24742J22300_10043414 3300002244 Bacteria 804
2 JGI25406J46586_10021562 3300003203 Bacteria 2583
3 Ga0065712_10209626 3300005290 Bacteria 1077
4 Ga0070670_100109119 3300005331 Unclassified 2385
5 Ga0070670_100292023 3300005331 Bacteria 1425
6 Ga0070677_10032109 3300005333 Bacteria 2012
7 Ga0070682_100133450 3300005337 Bacteria 1683
8 Ga0070682_100321968 3300005337 Bacteria 1142
9 Ga0070661_101582681 3300005344 Unclassified 554
10 Ga0070675_100030649 3300005354 Bacteria 4343
11 Ga0070674_100050406 3300005356 Unclassified 2866
12 Ga0070673_100525718 3300005364 Bacteria 1073
13 Ga0070667_100893533 3300005367 Bacteria 827
14 Ga0070709_10029979 3300005434 Bacteria 3260
15 Ga0070713_100174106 3300005436 Bacteria 1930
16 Ga0070710_10040896 3300005437 Bacteria 2557
17 Ga0070710_10358680 3300005437 Bacteria 967
18 Ga0070711_100002836 3300005439 Bacteria 9957
19 Ga0070678_100039199 3300005456 Bacteria 3340
20 Ga0070681_10851593 3300005458 Bacteria 829
21 Ga0068867_100023535 3300005459 Bacteria 4409
22 Ga0068867_101924032 3300005459 Bacteria 558
23 Ga0070684_100061378 3300005535 Bacteria 3290
24 Ga0070672_100066410 3300005543 Bacteria 2856
25 Ga0070686_101077041 3300005544 Bacteria 663
26 Ga0070665_100213575 3300005548 Bacteria 1930
27 Ga0070665_102088050 3300005548 Unclassified 571
28 Ga0068859_101379923 3300005617 Unclassified 777
29 Ga0068866_10219822 3300005718 Bacteria 1145
30 Ga0068861_101075772 3300005719 Bacteria 772
31 Ga0068870_10191630 3300005840 Unclassified 1234
32 Ga0081539_10001839 3300005985 Bacteria 33474
33 Ga0075365_10542015 3300006038 Unclassified 823
34 Ga0075363_100018285 3300006048 Bacteria 3489
35 Ga0075363_100161829 3300006048 Bacteria 1268
36 Ga0075432_10021522 3300006058 Bacteria 2204
37 Ga0070715_10337416 3300006163 Bacteria 819
38 Ga0070716_100009137 3300006173 Bacteria 4933
39 Ga0070712_100160716 3300006175 Bacteria 1734
40 Ga0070712_100980883 3300006175 Bacteria 731
41 Ga0075367_10134949 3300006178 Unclassified 1526
42 Ga0075367_10225199 3300006178 Bacteria 1174
43 Ga0075367_10255177 3300006178 Unclassified 1100
44 Ga0075367_10311827 3300006178 Unclassified 991
45 Ga0075369_10083454 3300006186 Bacteria 1419
46 Ga0075366_10359562 3300006195 Unclassified 894
47 Ga0075430_100857225 3300006846 Bacteria 748
48 Ga0075434_100006055 3300006871 Bacteria 11062
49 Ga0068865_100332005 3300006881 Bacteria 1226
50 Ga0075436_100180645 3300006914 Bacteria 1491
51 Ga0097620_101380463 3300006931 Unclassified 777
52 Ga0099795_10185518 3300007788 Unclassified 871
53 Ga0111539_10218758 3300009094 Bacteria 2218
54 Ga0105237_10667027 3300009545 Unclassified 1047
55 Ga0105238_10266180 3300009551 Bacteria 1694
56 Ga0105238_12118551 3300009551 Bacteria 597
57 Ga0105239_13120487 3300010375 Bacteria 540
58 Ga0157374_10358025 3300013296 Bacteria 1451
59 Ga0157378_10382788 3300013297 Bacteria 1382
60 Ga0163162_10728250 3300013306 Bacteria 1112
61 Ga0157372_10187878 3300013307 Bacteria 2393
62 Ga0157375_10191213 3300013308 Bacteria 2201
63 Ga0163163_10250045 3300014325 Bacteria 1823
64 Ga0157380_11246305 3300014326 Bacteria 789
65 Ga0163161_10204064 3300017792 Unclassified 1524
66 Ga0213873_10151269 3300021358 Bacteria 699
67 Ga0213872_10001406 3300021361 Bacteria 15819
68 Ga0213876_10002435 3300021384 Bacteria 10949
69 Ga0207426_1039848 3300025302 Bacteria 1468
70 Ga0207682_10006072 3300025893 Bacteria 4886
71 Ga0207692_10058990 3300025898 Bacteria 1980
72 Ga0207692_10292533 3300025898 Bacteria 989
73 Ga0207642_10083244 3300025899 Unclassified 1559
74 Ga0207680_10271527 3300025903 Bacteria 1176
75 Ga0207685_10104050 3300025905 Bacteria 1219
76 Ga0207699_10068126 3300025906 Bacteria 2166
77 Ga0207671_10240009 3300025914 Bacteria 1423
78 Ga0207693_10009097 3300025915 Bacteria 8107
79 Ga0207693_10442195 3300025915 Bacteria 1016
80 Ga0207663_10018114 3300025916 Bacteria 3939
81 Ga0207694_10138293 3300025924 Bacteria 1957
82 Ga0207700_10256429 3300025928 Bacteria 1496
83 Ga0207664_10266940 3300025929 Bacteria 1498
84 Ga0207669_10273797 3300025937 Unclassified 1269
85 Ga0207665_10007205 3300025939 Bacteria 7358
86 Ga0207691_10048730 3300025940 Bacteria 3883
87 Ga0207661_10607026 3300025944 Unclassified 1004
88 Ga0207679_10913775 3300025945 Bacteria 803
89 Ga0207677_11734385 3300026023 Bacteria 579
90 Ga0207648_10064833 3300026089 Bacteria 3184
91 Ga0207683_10010710 3300026121 Bacteria 7817
92 Ga0207428_10040699 3300027907 Bacteria 3766
93 Ga0268266_10314519 3300028379 Bacteria 1464
94 Ga0268266_10531902 3300028379 Bacteria 1125
95 Ga0265334_10041227 3300028573 Bacteria 1805
96 Ga0265318_10021164 3300028577 Bacteria 2615
97 Ga0265330_10038247 3300031235 Bacteria 2133
98 Ga0265330_10137958 3300031235 Bacteria 1037
99 Ga0265320_10018261 3300031240 Bacteria 3868
100 Ga0265325_10058491 3300031241 Bacteria 1963
101 Ga0265325_10068494 3300031241 Bacteria 1786
102 Ga0265329_10094578 3300031242 Bacteria 949
103 Ga0265340_10023057 3300031247 Bacteria 3176
104 Ga0265340_10074544 3300031247 Bacteria 1604
105 Ga0265340_10365257 3300031247 Bacteria 637
106 Ga0265339_10065145 3300031249 Bacteria 1954
107 Ga0265339_10068740 3300031249 Bacteria 1892
108 Ga0265331_10098123 3300031250 Bacteria 1350
109 Ga0265331_10187813 3300031250 Bacteria 933
110 Ga0307513_10232996 3300031456 Unclassified 1653
111 Ga0307513_10409161 3300031456 Bacteria 1089
112 Ga0265313_10019489 3300031595 Bacteria 3771
113 Ga0307508_10002259 3300031616 Bacteria 20542
114 Ga0265314_10088082 3300031711 Bacteria 2028
115 Ga0265314_10174344 3300031711 Bacteria 1295
116 Ga0265342_10143138 3300031712 Bacteria 1333
117 Ga0265342_10157646 3300031712 Bacteria 1256
118 Ga0265342_10513063 3300031712 Bacteria 611
119 Ga0373940_0143815 3300035088 Bacteria 755
120 Ga0373949_0019061 3300035090 Bacteria 1560
121 Ga0373960_0058703 3300035121 Unclassified 1161
122 Ga0373931_0003478 3300035691 Bacteria 7078
123 Ga0373927_0027453 3300035695 Bacteria 3717
124 Ga0373937_0180564 3300036401 Bacteria 1982
125 Ga0373937_1947319 3300036401 Bacteria 534
126 Ga0436365_0356070 3300039437 Bacteria 14417
127 Ga0436361_0551509 3300039447 Bacteria 867
128 Ga0436361_1140559 3300039447 Bacteria 46473
129 Ga0436362_0577964 3300039453 Bacteria 7078
130 Ga0439435_0001310 3300042436 Bacteria 4533
131 Ga0439460_0035229 3300042461 Bacteria 1447
132 Ga0495638_0029804 3300046460 Bacteria 3518
133 Ga0495638_0045432 3300046460 Bacteria 2763
134 Ga0495651_0135179 3300046462 Bacteria 1795
135 Ga0495639_0646985 3300046475 Unclassified 545
136 Ga0495598_0023812 3300046537 Bacteria 1653
137 Ga0495621_0054860 3300046539 Bacteria 1433
138 Ga0495656_0682774 3300046615 Bacteria 552
139 Ga0495615_0027959 3300048090 Unclassified 1328
140 Ga0496102_0974656 3300048905 Bacteria 769
141 Ga0496104_0005489 3300048907 Bacteria 11106
142 Ga0496105_0017241 3300048908 Bacteria 5786
143 Ga0496108_0026792 3300048911 Bacteria 4757
144 Ga0496109_0001562 3300048912 Bacteria 19079
145 Ga0496110_0027794 3300048913 Bacteria 4852
146 Ga0496111_0002538 3300048914 Bacteria 11024
147 Ga0496111_0017386 3300048914 Bacteria 4973
148 Ga0496112_0048864 3300048915 Bacteria 4145
149 Ga0496112_1562594 3300048915 Bacteria 573
150 Ga0496113_0000917 3300048916 Bacteria 15578
151 Ga0496115_0209666 3300048918 Bacteria 1609
152 Ga0496121_0293680 3300048924 Bacteria 1106
153 Ga0496126_0380329 3300048929 Bacteria 1149
154 Ga0496126_0436846 3300048929 Bacteria 1056
155 Ga0496126_0505051 3300048929 Bacteria 966
156 Ga0501033_0360757 3300049570 Unclassified 1017
157 Ga0501034_0081646 3300049571 Bacteria 3235
158 Ga0501038_0070155 3300049574 Bacteria 2976
159 Ga0501041_0154005 3300049577 Bacteria 1436
160 Ga0501042_0998903 3300049578 Bacteria 610
161 Ga0501047_0348008 3300049581 Unclassified 1319
162 Ga0501067_0693199 3300049583 Bacteria 572
163 Ga0501072_0023530 3300049588 Bacteria 4786
164 Ga0501076_0356871 3300049592 Unclassified 1201
165 Ga0501080_0158605 3300049742 Bacteria 2090
166 Ga0501080_0888478 3300049742 Bacteria 777
167 Ga0501081_0111887 3300049743 Bacteria 1938
168 Ga0501083_0132909 3300049744 Bacteria 1631
169 Ga0501035_0682037 3300049822 Bacteria 830
170 Ga0501045_0140750 3300049824 Bacteria 1794
171 nmdc:mga03683_361141_c1 3300050489 Unclassified 689
172 nmdc:mga03n38_441143_c1 3300050490 Bacteria 723
173 nmdc:mga00v17_556023_c1 3300050491 Bacteria 742
174 nmdc:mga00v17_9998_c1 3300050491 Bacteria 5161
175 nmdc:mga0k408_341506_c1 3300050493 Unclassified 893
176 nmdc:mga06z11_260358_c1 3300050494 Unclassified 1023
177 nmdc:mga0qj67_908314_c1 3300050509 Unclassified 694
178 nmdc:mga08y16_240139_c1 3300050511 Bacteria 1873
179 nmdc:mga0n895_42928_c1 3300050512 Bacteria 4403
180 nmdc:mga08x19_162345_c1 3300050514 Bacteria 1518
181 nmdc:mga0sz30_307964_c1 3300050516 Unclassified 706
182 Ga0500643_020665 3300053087 Bacteria 2147
183 Ga0500646_0042419 3300053090 Bacteria 1285
184 Ga0500646_0177917 3300053090 Bacteria 719
185 Ga0500651_0032131 3300053093 Bacteria 3308
186 Ga0500641_0153831 3300053096 Bacteria 992
187 Ga0500654_118020 3300053099 Unclassified 1057
188 Ga0500555_058719 3300053103 Bacteria 1039
189 Ga0500594_0025923 3300053118 Bacteria 1507
190 Ga0500595_200359 3300053119 Unclassified 551
191 Ga0500595_215790 3300053119 Bacteria 528
192 Ga0500577_0218292 3300053142 Bacteria 825
193 Ga0500604_0084533 3300053151 Bacteria 1029
194 Ga0500616_0000006 3300053153 Bacteria 944738
195 Ga0500616_0012981 3300053153 Bacteria 4852
196 Ga0501084_0342205 3300054114 Bacteria 1263
197 Ga0501082_0000371 3300060353 Bacteria 39631
198 Ga0501082_0215351 3300060353 Bacteria 1671
199 Ga0501082_1781210 3300060353 Bacteria 537

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042436 Ga0439435_0001310 Ga0439435_0001310_438_839 133
2 3300042461 Ga0439460_0035229 Ga0439460_0035229_116_517 133
3 3300050509 nmdc:mga0qj67_908314_c1 nmdc:mga0qj67_908314_c1_173_574 133
4 3300006846 Ga0075430_100857225 Ga0075430_1008572251 136
5 3300006058 Ga0075432_10021522 Ga0075432_100215222 137
6 3300006195 Ga0075366_10359562 Ga0075366_103595622 137
7 3300027907 Ga0207428_10040699 Ga0207428_100406992 137
8 3300050493 nmdc:mga0k408_341506_c1 nmdc:mga0k408_341506_c1_114_566 137
9 3300005437 Ga0070710_10358680 Ga0070710_103586802 139
10 3300025898 Ga0207692_10292533 Ga0207692_102925332 139
11 iso_pu_bacteria 8004633249 8004639723 139
12 3300009094 Ga0111539_10218758 Ga0111539_102187584 141
13 3300010375 Ga0105239_13120487 Ga0105239_131204871 141
14 3300050511 nmdc:mga08y16_240139_c1 nmdc:mga08y16_240139_c1_619_1062 141
15 3300049577 Ga0501041_0154005 Ga0501041_0154005_790_1224 142
16 3300049578 Ga0501042_0998903 Ga0501042_0998903_152_586 142
17 3300049588 Ga0501072_0023530 Ga0501072_0023530_1052_1486 142
18 3300049743 Ga0501081_0111887 Ga0501081_0111887_1418_1852 142
19 3300049822 Ga0501035_0682037 Ga0501035_0682037_177_611 142
20 3300049824 Ga0501045_0140750 Ga0501045_0140750_1042_1476 142
21 3300013306 Ga0163162_10728250 Ga0163162_107282501 143
22 3300028577 Ga0265318_10021164 Ga0265318_100211644 143
23 3300031235 Ga0265330_10038247 Ga0265330_100382471 143
24 3300031240 Ga0265320_10018261 Ga0265320_100182616 143
25 3300031241 Ga0265325_10068494 Ga0265325_100684943 143
26 3300031242 Ga0265329_10094578 Ga0265329_100945781 143
27 3300031247 Ga0265340_10023057 Ga0265340_100230572 143
28 3300031247 Ga0265340_10074544 Ga0265340_100745442 143
29 3300031249 Ga0265339_10068740 Ga0265339_100687403 143
30 3300031250 Ga0265331_10098123 Ga0265331_100981232 143
31 3300031595 Ga0265313_10019489 Ga0265313_100194895 143
32 3300031711 Ga0265314_10088082 Ga0265314_100880822 143
33 3300031712 Ga0265342_10143138 Ga0265342_101431382 143
34 3300031712 Ga0265342_10157646 Ga0265342_101576462 143
35 3300048905 Ga0496102_0974656 Ga0496102_0974656_72_518 143
36 3300048918 Ga0496115_0209666 Ga0496115_0209666_672_1118 143
37 3300048929 Ga0496126_0380329 Ga0496126_0380329_123_569 143
38 3300006175 Ga0070712_100980883 Ga0070712_1009808831 146
39 3300025915 Ga0207693_10442195 Ga0207693_104421952 146
40 iso_pu_bacteria 2841734538 2841737577 146
41 iso_pu_bacteria 2871474448 2871474482 146
42 iso_pu_bacteria 2878788777 2878789251 146
43 iso_pu_bacteria 2885312484 2885313021 146
44 iso_pu_bacteria 2888343758 2888345496 146
45 iso_pu_bacteria 2937836603 2937840188 146
46 iso_pu_bacteria 2958071322 2958075282 146
47 iso_pu_bacteria 8055617313 8055619293 146
48 3300036401 Ga0373937_0180564 Ga0373937_0180564_561_1013 147
49 3300046475 Ga0495639_0646985 Ga0495639_0646985_23_466 147
50 3300002244 JGI24742J22300_10043414 JGI24742J22300_100434142 148
51 3300003203 JGI25406J46586_10021562 JGI25406J46586_100215623 148
52 3300005290 Ga0065712_10209626 Ga0065712_102096261 148
53 3300005331 Ga0070670_100109119 Ga0070670_1001091192 148
54 3300005331 Ga0070670_100292023 Ga0070670_1002920233 148
55 3300005333 Ga0070677_10032109 Ga0070677_100321091 148
56 3300005337 Ga0070682_100133450 Ga0070682_1001334502 148
57 3300005337 Ga0070682_100321968 Ga0070682_1003219682 148
58 3300005344 Ga0070661_101582681 Ga0070661_1015826811 148
59 3300005354 Ga0070675_100030649 Ga0070675_1000306492 148
60 3300005356 Ga0070674_100050406 Ga0070674_1000504067 148
61 3300005364 Ga0070673_100525718 Ga0070673_1005257181 148
62 3300005367 Ga0070667_100893533 Ga0070667_1008935331 148
63 3300005434 Ga0070709_10029979 Ga0070709_100299794 148
64 3300005436 Ga0070713_100174106 Ga0070713_1001741063 148
65 3300005437 Ga0070710_10040896 Ga0070710_100408963 148
66 3300005439 Ga0070711_100002836 Ga0070711_1000028362 148
67 3300005456 Ga0070678_100039199 Ga0070678_1000391995 148
68 3300005458 Ga0070681_10851593 Ga0070681_108515931 148
69 3300005459 Ga0068867_100023535 Ga0068867_1000235355 148
70 3300005459 Ga0068867_101924032 Ga0068867_1019240321 148
71 3300005535 Ga0070684_100061378 Ga0070684_1000613784 148
72 3300005543 Ga0070672_100066410 Ga0070672_1000664105 148
73 3300005544 Ga0070686_101077041 Ga0070686_1010770411 148
74 3300005548 Ga0070665_100213575 Ga0070665_1002135751 148
75 3300005548 Ga0070665_102088050 Ga0070665_1020880501 148
76 3300005617 Ga0068859_101379923 Ga0068859_1013799231 148
77 3300005718 Ga0068866_10219822 Ga0068866_102198222 148
78 3300005719 Ga0068861_101075772 Ga0068861_1010757721 148
79 3300005840 Ga0068870_10191630 Ga0068870_101916301 148
80 3300005985 Ga0081539_10001839 Ga0081539_1000183927 148
81 3300006038 Ga0075365_10542015 Ga0075365_105420152 148
82 3300006048 Ga0075363_100018285 Ga0075363_1000182854 148
83 3300006048 Ga0075363_100161829 Ga0075363_1001618292 148
84 3300006163 Ga0070715_10337416 Ga0070715_103374162 148
85 3300006173 Ga0070716_100009137 Ga0070716_10000913711 148
86 3300006175 Ga0070712_100160716 Ga0070712_1001607161 148
87 3300006178 Ga0075367_10134949 Ga0075367_101349492 148
88 3300006178 Ga0075367_10225199 Ga0075367_102251991 148
89 3300006178 Ga0075367_10255177 Ga0075367_102551771 148
90 3300006178 Ga0075367_10311827 Ga0075367_103118271 148
91 3300006186 Ga0075369_10083454 Ga0075369_100834541 148
92 3300006871 Ga0075434_100006055 Ga0075434_10000605512 148
93 3300006881 Ga0068865_100332005 Ga0068865_1003320052 148
94 3300006914 Ga0075436_100180645 Ga0075436_1001806453 148
95 3300006931 Ga0097620_101380463 Ga0097620_1013804631 148
96 3300007788 Ga0099795_10185518 Ga0099795_101855181 148
97 3300009545 Ga0105237_10667027 Ga0105237_106670272 148
98 3300009551 Ga0105238_10266180 Ga0105238_102661803 148
99 3300009551 Ga0105238_12118551 Ga0105238_121185511 148
100 3300013296 Ga0157374_10358025 Ga0157374_103580252 148
101 3300013297 Ga0157378_10382788 Ga0157378_103827881 148
102 3300013307 Ga0157372_10187878 Ga0157372_101878783 148
103 3300013308 Ga0157375_10191213 Ga0157375_101912134 148
104 3300014325 Ga0163163_10250045 Ga0163163_102500452 148
105 3300014326 Ga0157380_11246305 Ga0157380_112463052 148
106 3300017792 Ga0163161_10204064 Ga0163161_102040643 148
107 3300021358 Ga0213873_10151269 Ga0213873_101512691 148
108 3300021361 Ga0213872_10001406 Ga0213872_1000140610 148
109 3300021384 Ga0213876_10002435 Ga0213876_1000243512 148
110 3300025302 Ga0207426_1039848 Ga0207426_10398482 148
111 3300025893 Ga0207682_10006072 Ga0207682_100060726 148
112 3300025898 Ga0207692_10058990 Ga0207692_100589903 148
113 3300025899 Ga0207642_10083244 Ga0207642_100832442 148
114 3300025903 Ga0207680_10271527 Ga0207680_102715272 148
115 3300025905 Ga0207685_10104050 Ga0207685_101040501 148
116 3300025906 Ga0207699_10068126 Ga0207699_100681262 148
117 3300025914 Ga0207671_10240009 Ga0207671_102400092 148
118 3300025915 Ga0207693_10009097 Ga0207693_1000909716 148
119 3300025916 Ga0207663_10018114 Ga0207663_100181142 148
120 3300025924 Ga0207694_10138293 Ga0207694_101382932 148
121 3300025928 Ga0207700_10256429 Ga0207700_102564292 148
122 3300025929 Ga0207664_10266940 Ga0207664_102669402 148
123 3300025937 Ga0207669_10273797 Ga0207669_102737971 148
124 3300025939 Ga0207665_10007205 Ga0207665_100072054 148
125 3300025940 Ga0207691_10048730 Ga0207691_100487305 148
126 3300025944 Ga0207661_10607026 Ga0207661_106070262 148
127 3300025945 Ga0207679_10913775 Ga0207679_109137751 148
128 3300026023 Ga0207677_11734385 Ga0207677_117343851 148
129 3300026089 Ga0207648_10064833 Ga0207648_100648334 148
130 3300026121 Ga0207683_10010710 Ga0207683_100107102 148
131 3300028379 Ga0268266_10314519 Ga0268266_103145192 148
132 3300028379 Ga0268266_10531902 Ga0268266_105319023 148
133 3300028573 Ga0265334_10041227 Ga0265334_100412273 148
134 3300031235 Ga0265330_10137958 Ga0265330_101379582 148
135 3300031241 Ga0265325_10058491 Ga0265325_100584912 148
136 3300031247 Ga0265340_10365257 Ga0265340_103652571 148
137 3300031249 Ga0265339_10065145 Ga0265339_100651452 148
138 3300031250 Ga0265331_10187813 Ga0265331_101878132 148
139 3300031456 Ga0307513_10232996 Ga0307513_102329963 148
140 3300031456 Ga0307513_10409161 Ga0307513_104091612 148
141 3300031616 Ga0307508_10002259 Ga0307508_1000225915 148
142 3300031711 Ga0265314_10174344 Ga0265314_101743441 148
143 3300031712 Ga0265342_10513063 Ga0265342_105130631 148
144 3300035088 Ga0373940_0143815 Ga0373940_0143815_21_527 148
145 3300035090 Ga0373949_0019061 Ga0373949_0019061_325_831 148
146 3300035121 Ga0373960_0058703 Ga0373960_0058703_238_744 148
147 3300035691 Ga0373931_0003478 Ga0373931_0003478_2160_2606 148
148 3300035695 Ga0373927_0027453 Ga0373927_0027453_1657_2103 148
149 3300036401 Ga0373937_1947319 Ga0373937_1947319_73_519 148
150 3300039437 Ga0436365_0356070 Ga0436365_0356070_11441_11887 148
151 3300039447 Ga0436361_0551509 Ga0436361_0551509_128_574 148
152 3300039447 Ga0436361_1140559 Ga0436361_1140559_28940_29428 148
153 3300039453 Ga0436362_0577964 Ga0436362_0577964_1528_1974 148
154 3300046460 Ga0495638_0029804 Ga0495638_0029804_1532_1978 148
155 3300046460 Ga0495638_0045432 Ga0495638_0045432_1266_1712 148
156 3300046462 Ga0495651_0135179 Ga0495651_0135179_801_1247 148
157 3300046537 Ga0495598_0023812 Ga0495598_0023812_1005_1451 148
158 3300046539 Ga0495621_0054860 Ga0495621_0054860_654_1100 148
159 3300046615 Ga0495656_0682774 Ga0495656_0682774_88_534 148
160 3300048090 Ga0495615_0027959 Ga0495615_0027959_36_482 148
161 3300048907 Ga0496104_0005489 Ga0496104_0005489_1069_1521 148
162 3300048908 Ga0496105_0017241 Ga0496105_0017241_4718_5170 148
163 3300048911 Ga0496108_0026792 Ga0496108_0026792_4248_4700 148
164 3300048912 Ga0496109_0001562 Ga0496109_0001562_10063_10515 148
165 3300048913 Ga0496110_0027794 Ga0496110_0027794_4266_4718 148
166 3300048914 Ga0496111_0002538 Ga0496111_0002538_4994_5446 148
167 3300048914 Ga0496111_0017386 Ga0496111_0017386_4220_4666 148
168 3300048915 Ga0496112_0048864 Ga0496112_0048864_12_464 148
169 3300048915 Ga0496112_1562594 Ga0496112_1562594_78_524 148
170 3300048916 Ga0496113_0000917 Ga0496113_0000917_7112_7564 148
171 3300048924 Ga0496121_0293680 Ga0496121_0293680_480_926 148
172 3300048929 Ga0496126_0436846 Ga0496126_0436846_34_495 148
173 3300048929 Ga0496126_0505051 Ga0496126_0505051_349_795 148
174 3300049570 Ga0501033_0360757 Ga0501033_0360757_55_501 148
175 3300049571 Ga0501034_0081646 Ga0501034_0081646_2009_2455 148
176 3300049574 Ga0501038_0070155 Ga0501038_0070155_485_931 148
177 3300049581 Ga0501047_0348008 Ga0501047_0348008_452_898 148
178 3300049583 Ga0501067_0693199 Ga0501067_0693199_94_546 148
179 3300049592 Ga0501076_0356871 Ga0501076_0356871_393_845 148
180 3300049742 Ga0501080_0158605 Ga0501080_0158605_989_1435 148
181 3300049742 Ga0501080_0888478 Ga0501080_0888478_72_524 148
182 3300049744 Ga0501083_0132909 Ga0501083_0132909_1087_1533 148
183 3300050489 nmdc:mga03683_361141_c1 nmdc:mga03683_361141_c1_159_605 148
184 3300050490 nmdc:mga03n38_441143_c1 nmdc:mga03n38_441143_c1_99_545 148
185 3300050491 nmdc:mga00v17_556023_c1 nmdc:mga00v17_556023_c1_44_490 148
186 3300050491 nmdc:mga00v17_9998_c1 nmdc:mga00v17_9998_c1_3960_4412 148
187 3300050494 nmdc:mga06z11_260358_c1 nmdc:mga06z11_260358_c1_174_620 148
188 3300050512 nmdc:mga0n895_42928_c1 nmdc:mga0n895_42928_c1_1041_1487 148
189 3300050514 nmdc:mga08x19_162345_c1 nmdc:mga08x19_162345_c1_24_470 148
190 3300050516 nmdc:mga0sz30_307964_c1 nmdc:mga0sz30_307964_c1_118_564 148
191 3300053087 Ga0500643_020665 Ga0500643_020665_398_859 148
192 3300053090 Ga0500646_0042419 Ga0500646_0042419_593_1108 148
193 3300053090 Ga0500646_0177917 Ga0500646_0177917_149_595 148
194 3300053093 Ga0500651_0032131 Ga0500651_0032131_1931_2383 148
195 3300053096 Ga0500641_0153831 Ga0500641_0153831_292_738 148
196 3300053099 Ga0500654_118020 Ga0500654_118020_467_913 148
197 3300053103 Ga0500555_058719 Ga0500555_058719_418_876 148
198 3300053118 Ga0500594_0025923 Ga0500594_0025923_30_476 148
199 3300053119 Ga0500595_200359 Ga0500595_200359_56_502 148
200 3300053119 Ga0500595_215790 Ga0500595_215790_20_466 148
201 3300053142 Ga0500577_0218292 Ga0500577_0218292_20_466 148
202 3300053151 Ga0500604_0084533 Ga0500604_0084533_44_490 148
203 3300053153 Ga0500616_0000006 Ga0500616_0000006_602953_603414 148
204 3300053153 Ga0500616_0012981 Ga0500616_0012981_520_981 148
205 3300054114 Ga0501084_0342205 Ga0501084_0342205_410_856 148
206 3300060353 Ga0501082_0000371 Ga0501082_0000371_15127_15573 148
207 3300060353 Ga0501082_0215351 Ga0501082_0215351_146_598 148
208 3300060353 Ga0501082_1781210 Ga0501082_1781210_58_510 148

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09980

DUF2214

Predicted membrane protein (DUF2214)

24

169

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7w9u-assembly3.cif.gz_C crystal structure of zn bound human focal adhesion targeting (fat) domain of the focal adhesion kinase 0.7041 9 138
1ow8-assembly1.cif.gz_A paxillin ld2 motif bound to the focal adhesion targeting (fat) domain of the focal adhesion kinase 0.698 9 138
1ktm-assembly1.cif.gz_A solution structure of fat domain of focal adhesion kinase 0.6895 5 136
4r32-assembly1.cif.gz_A crystal structure analysis of pyk2 and paxillin ld motifs 0.666 8 138
6xz3-assembly1.cif.gz_A-2 crystal structure of tlnrd1 4-helix bundle 0.6641 12 138
ID Description Score Start End Superfamily
af_Q55C03_152_358_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7272 2 137 1.20.120.1770
af_Q6H474_2_116_1.20.120.290 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Oxygen-evolving enhancer protein 3 (PsbQ), four-helix up-down bundle 0.6969 3 137 1.20.120.290
3gm3A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases 0.6803 8 138 1.20.120.330
af_A0A1D8PHX8_14_378_1.50.10.150 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase;Voltage-dependent anion channel 0.679 12 99 1.50.10.150
af_Q6H474_2_116_1.20.120.290 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Oxygen-evolving enhancer protein 3 (PsbQ), four-helix up-down bundle 0.6726 3 137 1.20.120.290
ID Description Score Start End GO Terms
AF-A0A6N7GQF0-F1-model_v4 DUF2214 family protein 0.9907 1 146 GO:0016020
AF-A0A537RY20-F1-model_v4 DUF2214 family protein 0.9885 1 146 GO:0016020
AF-A0A6N7GQF0-F1-model_v4 DUF2214 family protein 0.984 1 146 GO:0016020
AF-A0A537RY20-F1-model_v4 DUF2214 family protein 0.9818 1 146 GO:0016020
AF-A0A8A7VZM2-F1-model_v4 deleted 0.9814 1 145

Feature Viewer

pLDDT pTM Quality
94.53 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map