F318420

General Info

Members Datasets Scaffolds Average Seq Length
208 114 416 184

Family's Representative Sequence

Representative Sequence 3300050510|nmdc:mga06r32_493968_c1|nmdc:mga06r32_493968_c1_480_1097
Length 205
Sequence VIVGFTTSPPGAWVGGSFTAMAAPGGTGPIGPFPSDVETPDQQEEYDRLRRRVLWTMPYGLYVVGSRAGERRNLMTLNFATQVSFDPKLVGIGVEKTALTHELIAEGGSFVVNTVSREDRAIVRKFTKPVEEGPDGTLNGFAVHDGRTGAPVLDQAVAWIDCEVRNPVDCGGHTFFIGEVVDTGFQQAEDTPVLRMEDTRMSYGG

Samples

Sample ID Description Type Environment
1 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
2 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
3 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
4 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
5 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
6 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
7 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
8 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
9 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
10 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
11 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
12 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
13 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
14 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
15 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
16 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
17 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
18 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
19 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
20 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
21 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
22 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
23 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
24 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
25 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
26 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
33 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
34 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
35 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
36 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
37 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
38 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
39 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
40 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
41 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
42 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
43 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
44 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
45 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
46 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
47 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
48 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
49 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
50 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
51 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
52 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
53 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
54 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
55 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
56 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
57 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
58 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
59 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
60 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
61 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
62 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
63 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
64 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
65 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
66 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
67 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
68 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
69 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
70 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
71 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
72 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
73 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
74 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
75 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
76 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
77 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
78 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
79 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
81 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
82 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
86 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
87 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
88 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
89 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
90 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
91 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
92 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
93 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
94 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
95 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
96 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
97 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
98 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
100 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
101 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
102 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
103 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
104 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
105 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
106 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
107 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
108 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
109 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
110 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
111 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
112 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
113 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
114 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.44
Nodule 0
Rhizoplane 4.33
Rhizosphere 93.75
Stem 0
Stem Tuber 0
Unclassified 10.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga06r32_493968_c1 3300050510 Bacteria 1201
2 Ga0070682_100568728 3300005337 Bacteria 890
3 Ga0070688_100505411 3300005365 Unclassified 912
4 Ga0070705_100013666 3300005440 Bacteria 4156
5 Ga0070708_100308616 3300005445 Unclassified 1490
6 Ga0070708_100392254 3300005445 Bacteria 1309
7 Ga0070681_10007127 3300005458 Bacteria 10892
8 Ga0070681_10059371 3300005458 Bacteria 3804
9 Ga0070706_100103606 3300005467 Bacteria 2645
10 Ga0070707_100190225 3300005468 Bacteria 2001
11 Ga0070698_100805112 3300005471 Bacteria 884
12 Ga0070702_100846156 3300005615 Unclassified 711
13 Ga0081455_10003696 3300005937 Bacteria 17516
14 Ga0081455_10048062 3300005937 Bacteria 3689
15 Ga0081455_10106035 3300005937 Bacteria 2244
16 Ga0081538_10000333 3300005981 Bacteria 53542
17 Ga0081538_10003175 3300005981 Bacteria 15626
18 Ga0081538_10080484 3300005981 Bacteria 1737
19 Ga0081538_10090425 3300005981 Bacteria 1585
20 Ga0075428_100001476 3300006844 Bacteria 25154
21 Ga0075428_100019241 3300006844 Bacteria 7552
22 Ga0075428_100522590 3300006844 Unclassified 1269
23 Ga0075428_100821200 3300006844 Bacteria 988
24 Ga0075430_100007168 3300006846 Bacteria 9408
25 Ga0075430_100010362 3300006846 Bacteria 7894
26 Ga0075430_100029488 3300006846 Bacteria 4657
27 Ga0075430_100081362 3300006846 Bacteria 2713
28 Ga0075430_100088163 3300006846 Bacteria 2596
29 Ga0075430_100238584 3300006846 Bacteria 1507
30 Ga0075430_100242917 3300006846 Bacteria 1492
31 Ga0075430_100253533 3300006846 Bacteria 1458
32 Ga0075431_100000285 3300006847 Bacteria 39649
33 Ga0075431_100030597 3300006847 Bacteria 5546
34 Ga0075431_100057117 3300006847 Bacteria 4025
35 Ga0075431_100259811 3300006847 Unclassified 1762
36 Ga0075431_100282813 3300006847 Bacteria 1679
37 Ga0075431_100390166 3300006847 Bacteria 1395
38 Ga0075433_10003698 3300006852 Bacteria 11834
39 Ga0075434_100019560 3300006871 Bacteria 6555
40 Ga0075429_100000318 3300006880 Bacteria 34563
41 Ga0075429_100006366 3300006880 Bacteria 10215
42 Ga0075429_100063171 3300006880 Bacteria 3226
43 Ga0075429_100086321 3300006880 Bacteria 2735
44 Ga0075429_100129716 3300006880 Bacteria 2205
45 Ga0075429_101290979 3300006880 Bacteria 637
46 Ga0068865_100489874 3300006881 Bacteria 1023
47 Ga0111539_10148913 3300009094 Bacteria 2740
48 Ga0111539_10205219 3300009094 Bacteria 2297
49 Ga0111539_10486606 3300009094 Bacteria 1437
50 Ga0114129_10000100 3300009147 Bacteria 84154
51 Ga0114129_10057927 3300009147 Bacteria 5420
52 Ga0114129_10092904 3300009147 Bacteria 4180
53 Ga0114129_10282668 3300009147 Bacteria 2217
54 Ga0114129_10537233 3300009147 Bacteria 1522
55 Ga0114129_10852088 3300009147 Bacteria 1158
56 Ga0114129_10920310 3300009147 Bacteria 1107
57 Ga0114129_11130771 3300009147 Bacteria 979
58 Ga0105237_10830457 3300009545 Bacteria 931
59 Ga0157369_10521361 3300013105 Bacteria 1229
60 Ga0163162_11393217 3300013306 Archaea 798
61 Ga0157380_10343606 3300014326 Bacteria 1393
62 Ga0207684_10073376 3300025910 Bacteria 2906
63 Ga0207707_10010705 3300025912 Bacteria 7969
64 Ga0207646_10182393 3300025922 Bacteria 1896
65 Ga0207691_10449825 3300025940 Bacteria 1096
66 Ga0207711_10659360 3300025941 Bacteria 976
67 Ga0207677_10606761 3300026023 Bacteria 961
68 Ga0307413_10712919 3300031824 Bacteria 835
69 Ga0307410_10127033 3300031852 Bacteria 1868
70 Ga0307410_10869202 3300031852 Bacteria 771
71 Ga0307407_10251072 3300031903 Unclassified 1212
72 Ga0307407_10584334 3300031903 Bacteria 830
73 Ga0307412_10307353 3300031911 Bacteria 1256
74 Ga0307409_100009835 3300031995 Bacteria 5901
75 Ga0307416_100152752 3300032002 Bacteria 2120
76 Ga0307414_10189112 3300032004 Bacteria 1664
77 Ga0307411_10058063 3300032005 Bacteria 2559
78 Ga0307415_100187454 3300032126 Bacteria 1629
79 Ga0395898_0735657 3300037466 Bacteria 928
80 Ga0395898_0904041 3300037466 Bacteria 821
81 Ga0436361_0294006 3300039447 Bacteria 3659
82 Ga0436362_0460872 3300039453 Bacteria 1746
83 Ga0439438_054651 3300041405 Bacteria 1009
84 Ga0439466_0049760 3300041411 Bacteria 1376
85 Ga0451837_1365057 3300041494 Bacteria 2641
86 Ga0439448_0023571 3300042005 Bacteria 1921
87 Ga0439450_005846 3300042008 Bacteria 2186
88 Ga0439451_011378 3300042009 Bacteria 1796
89 Ga0439452_027105 3300042010 Unclassified 1441
90 Ga0439454_083221 3300042011 Bacteria 583
91 Ga0439463_005983 3300042016 Bacteria 3021
92 Ga0439464_0017666 3300042439 Bacteria 1936
93 Ga0439460_0054075 3300042461 Unclassified 1210
94 Ga0466966_0511081 3300044684 Unclassified 723
95 Ga0466961_0094952 3300044693 Bacteria 1881
96 Ga0466959_0419204 3300045049 Bacteria 909
97 Ga0466958_0688985 3300045836 Bacteria 665
98 Ga0466967_1113388 3300045976 Bacteria 787
99 Ga0466967_1336116 3300045976 Bacteria 714
100 Ga0495651_0109190 3300046462 Bacteria 2048
101 Ga0495584_0041409 3300046491 Bacteria 2326
102 Ga0495628_0140509 3300046516 Bacteria 1843
103 Ga0495630_0659232 3300046517 Unclassified 801
104 Ga0495586_0387820 3300046535 Bacteria 804
105 Ga0495667_0115542 3300046559 Bacteria 1734
106 Ga0495661_0283796 3300046665 Bacteria 834
107 Ga0495669_0440296 3300046684 Bacteria 633
108 Ga0496102_0408350 3300048905 Bacteria 1276
109 Ga0496108_0106203 3300048911 Unclassified 2398
110 Ga0496108_1061864 3300048911 Bacteria 689
111 Ga0496108_1218746 3300048911 Unclassified 636
112 Ga0496109_0045442 3300048912 Bacteria 3986
113 Ga0496109_0605527 3300048912 Bacteria 1032
114 Ga0496110_0017756 3300048913 Bacteria 5953
115 Ga0496110_0558350 3300048913 Unclassified 1040
116 Ga0496112_0853411 3300048915 Bacteria 834
117 Ga0501033_0038234 3300049570 Bacteria 3589
118 Ga0501034_0000257 3300049571 Bacteria 96799
119 Ga0501034_0003436 3300049571 Bacteria 18087
120 Ga0501034_0160492 3300049571 Bacteria 2219
121 Ga0501036_0000837 3300049572 Bacteria 22884
122 Ga0501036_0191918 3300049572 Bacteria 1718
123 Ga0501037_0101174 3300049573 Bacteria 2080
124 Ga0501038_0123349 3300049574 Bacteria 2134
125 Ga0501039_0027749 3300049575 Bacteria 4354
126 Ga0501040_0037394 3300049576 Bacteria 3297
127 Ga0501040_0051904 3300049576 Bacteria 2806
128 Ga0501041_0021821 3300049577 Bacteria 3835
129 Ga0501041_0038275 3300049577 Bacteria 2908
130 Ga0501042_0040409 3300049578 Bacteria 3316
131 Ga0501042_0069946 3300049578 Bacteria 2510
132 Ga0501043_0095924 3300049579 Bacteria 2331
133 Ga0501043_0197835 3300049579 Bacteria 1561
134 Ga0501046_0006100 3300049580 Bacteria 10714
135 Ga0501046_0330472 3300049580 Bacteria 1109
136 Ga0501048_0009562 3300049582 Bacteria 7279
137 Ga0501068_0034863 3300049584 Bacteria 3003
138 Ga0501068_0192732 3300049584 Bacteria 1291
139 Ga0501068_0231561 3300049584 Bacteria 1175
140 Ga0501069_0150727 3300049585 Bacteria 1336
141 Ga0501070_0421439 3300049586 Bacteria 1078
142 Ga0501070_0499646 3300049586 Unclassified 977
143 Ga0501071_0004222 3300049587 Bacteria 9098
144 Ga0501071_0121680 3300049587 Unclassified 1935
145 Ga0501071_0252271 3300049587 Bacteria 1332
146 Ga0501072_0005115 3300049588 Bacteria 9973
147 Ga0501072_0041764 3300049588 Bacteria 3602
148 Ga0501072_0493806 3300049588 Bacteria 968
149 Ga0501074_0247355 3300049590 Bacteria 1268
150 Ga0501075_0054638 3300049591 Bacteria 3004
151 Ga0501075_0127188 3300049591 Bacteria 1940
152 Ga0501075_0297020 3300049591 Bacteria 1231
153 Ga0501076_0001259 3300049592 Bacteria 16878
154 Ga0501076_0081365 3300049592 Bacteria 2600
155 Ga0501076_0207986 3300049592 Bacteria 1599
156 Ga0501077_0002114 3300049593 Bacteria 11985
157 Ga0501077_0057974 3300049593 Bacteria 2459
158 Ga0501079_0008109 3300049741 Bacteria 7957
159 Ga0501079_0191249 3300049741 Bacteria 1597
160 Ga0501080_0896750 3300049742 Bacteria 773
161 Ga0501081_0029390 3300049743 Bacteria 3714
162 Ga0501081_0031072 3300049743 Bacteria 3618
163 Ga0501081_0142032 3300049743 Unclassified 1721
164 Ga0501083_0100064 3300049744 Bacteria 1912
165 Ga0501083_0998058 3300049744 Bacteria 545
166 Ga0501035_0699457 3300049822 Bacteria 818
167 Ga0501045_0001770 3300049824 Bacteria 14584
168 nmdc:mga05p37_279246_c1 3300050507 Bacteria 1993
169 nmdc:mga05p37_34760_c1 3300050507 Bacteria 6175
170 nmdc:mga05p37_458833_c1 3300050507 Bacteria 1473
171 nmdc:mga05p37_530493_c1 3300050507 Bacteria 1344
172 nmdc:mga05p37_60939_c1 3300050507 Bacteria 4646
173 nmdc:mga09592_25380_c1 3300050508 Bacteria 4905
174 nmdc:mga09592_49108_c1 3300050508 Bacteria 3558
175 nmdc:mga09592_510968_c1 3300050508 Unclassified 1034
176 nmdc:mga0qj67_25933_c1 3300050509 Bacteria 4534
177 nmdc:mga0qj67_555526_c1 3300050509 Bacteria 921
178 nmdc:mga0qj67_86951_c1 3300050509 Unclassified 2508
179 nmdc:mga06r32_154881_c1 3300050510 Bacteria 2272
180 nmdc:mga06r32_1953_c1 3300050510 Bacteria 18383
181 nmdc:mga06r32_342285_c1 3300050510 Unclassified 1480
182 nmdc:mga06r32_369437_c1 3300050510 Bacteria 1418
183 nmdc:mga06r32_47612_c1 3300050510 Bacteria 4096
184 nmdc:mga06r32_532_c1 3300050510 Bacteria 32919
185 nmdc:mga06r32_646780_c1 3300050510 Bacteria 1026
186 nmdc:mga06r32_759008_c1 3300050510 Bacteria 933
187 nmdc:mga08y16_145381_c1 3300050511 Bacteria 2465
188 nmdc:mga08y16_64168_c1 3300050511 Bacteria 3835
189 nmdc:mga0n895_114894_c1 3300050512 Bacteria 2710
190 nmdc:mga0rr50_12303_c1 3300050513 Bacteria 5524
191 nmdc:mga0rr50_834548_c1 3300050513 Bacteria 786
192 nmdc:mga08x19_250191_c1 3300050514 Bacteria 1223
193 Ga0495601_0370557 3300053077 Bacteria 930
194 Ga0495619_0035759 3300053085 Bacteria 3232
195 Ga0500568_0000067 3300053139 Bacteria 104480
196 Ga0500616_0001674 3300053153 Bacteria 20429
197 Ga0500616_0318925 3300053153 Bacteria 640
198 Ga0501084_0000010 3300054114 Bacteria 187712
199 Ga0501084_0034179 3300054114 Bacteria 4251
200 Ga0501084_0063519 3300054114 Bacteria 3091
201 Ga0590075_049227 3300059424 Bacteria 1080
202 Ga0501082_0001886 3300060353 Bacteria 18454
203 Ga0501082_0059386 3300060353 Bacteria 3296
204 Ga0501082_0126014 3300060353 Unclassified 2221
205 Ga0530510_0003099 3300061734 Bacteria 11405
206 Ga0530510_0017841 3300061734 Bacteria 5031
207 Ga0530510_0020670 3300061734 Bacteria 4680
208 Ga0530510_0902450 3300061734 Unclassified 675
209 nmdc:mga06r32_493968_c1
210 Ga0070682_100568728
211 Ga0070688_100505411
212 Ga0070705_100013666
213 Ga0070708_100308616
214 Ga0070708_100392254
215 Ga0070681_10007127
216 Ga0070681_10059371
217 Ga0070706_100103606
218 Ga0070707_100190225
219 Ga0070698_100805112
220 Ga0070702_100846156
221 Ga0081455_10003696
222 Ga0081455_10048062
223 Ga0081455_10106035
224 Ga0081538_10000333
225 Ga0081538_10003175
226 Ga0081538_10080484
227 Ga0081538_10090425
228 Ga0075428_100001476
229 Ga0075428_100019241
230 Ga0075428_100522590
231 Ga0075428_100821200
232 Ga0075430_100007168
233 Ga0075430_100010362
234 Ga0075430_100029488
235 Ga0075430_100081362
236 Ga0075430_100088163
237 Ga0075430_100238584
238 Ga0075430_100242917
239 Ga0075430_100253533
240 Ga0075431_100000285
241 Ga0075431_100030597
242 Ga0075431_100057117
243 Ga0075431_100259811
244 Ga0075431_100282813
245 Ga0075431_100390166
246 Ga0075433_10003698
247 Ga0075434_100019560
248 Ga0075429_100000318
249 Ga0075429_100006366
250 Ga0075429_100063171
251 Ga0075429_100086321
252 Ga0075429_100129716
253 Ga0075429_101290979
254 Ga0068865_100489874
255 Ga0111539_10148913
256 Ga0111539_10205219
257 Ga0111539_10486606
258 Ga0114129_10000100
259 Ga0114129_10057927
260 Ga0114129_10092904
261 Ga0114129_10282668
262 Ga0114129_10537233
263 Ga0114129_10852088
264 Ga0114129_10920310
265 Ga0114129_11130771
266 Ga0105237_10830457
267 Ga0157369_10521361
268 Ga0163162_11393217
269 Ga0157380_10343606
270 Ga0207684_10073376
271 Ga0207707_10010705
272 Ga0207646_10182393
273 Ga0207691_10449825
274 Ga0207711_10659360
275 Ga0207677_10606761
276 Ga0307413_10712919
277 Ga0307410_10127033
278 Ga0307410_10869202
279 Ga0307407_10251072
280 Ga0307407_10584334
281 Ga0307412_10307353
282 Ga0307409_100009835
283 Ga0307416_100152752
284 Ga0307414_10189112
285 Ga0307411_10058063
286 Ga0307415_100187454
287 Ga0395898_0735657
288 Ga0395898_0904041
289 Ga0436361_0294006
290 Ga0436362_0460872
291 Ga0439438_054651
292 Ga0439466_0049760
293 Ga0451837_1365057
294 Ga0439448_0023571
295 Ga0439450_005846
296 Ga0439451_011378
297 Ga0439452_027105
298 Ga0439454_083221
299 Ga0439463_005983
300 Ga0439464_0017666
301 Ga0439460_0054075
302 Ga0466966_0511081
303 Ga0466961_0094952
304 Ga0466959_0419204
305 Ga0466958_0688985
306 Ga0466967_1113388
307 Ga0466967_1336116
308 Ga0495651_0109190
309 Ga0495584_0041409
310 Ga0495628_0140509
311 Ga0495630_0659232
312 Ga0495586_0387820
313 Ga0495667_0115542
314 Ga0495661_0283796
315 Ga0495669_0440296
316 Ga0496102_0408350
317 Ga0496108_0106203
318 Ga0496108_1061864
319 Ga0496108_1218746
320 Ga0496109_0045442
321 Ga0496109_0605527
322 Ga0496110_0017756
323 Ga0496110_0558350
324 Ga0496112_0853411
325 Ga0501033_0038234
326 Ga0501034_0000257
327 Ga0501034_0003436
328 Ga0501034_0160492
329 Ga0501036_0000837
330 Ga0501036_0191918
331 Ga0501037_0101174
332 Ga0501038_0123349
333 Ga0501039_0027749
334 Ga0501040_0037394
335 Ga0501040_0051904
336 Ga0501041_0021821
337 Ga0501041_0038275
338 Ga0501042_0040409
339 Ga0501042_0069946
340 Ga0501043_0095924
341 Ga0501043_0197835
342 Ga0501046_0006100
343 Ga0501046_0330472
344 Ga0501048_0009562
345 Ga0501068_0034863
346 Ga0501068_0192732
347 Ga0501068_0231561
348 Ga0501069_0150727
349 Ga0501070_0421439
350 Ga0501070_0499646
351 Ga0501071_0004222
352 Ga0501071_0121680
353 Ga0501071_0252271
354 Ga0501072_0005115
355 Ga0501072_0041764
356 Ga0501072_0493806
357 Ga0501074_0247355
358 Ga0501075_0054638
359 Ga0501075_0127188
360 Ga0501075_0297020
361 Ga0501076_0001259
362 Ga0501076_0081365
363 Ga0501076_0207986
364 Ga0501077_0002114
365 Ga0501077_0057974
366 Ga0501079_0008109
367 Ga0501079_0191249
368 Ga0501080_0896750
369 Ga0501081_0029390
370 Ga0501081_0031072
371 Ga0501081_0142032
372 Ga0501083_0100064
373 Ga0501083_0998058
374 Ga0501035_0699457
375 Ga0501045_0001770
376 nmdc:mga05p37_279246_c1
377 nmdc:mga05p37_34760_c1
378 nmdc:mga05p37_458833_c1
379 nmdc:mga05p37_530493_c1
380 nmdc:mga05p37_60939_c1
381 nmdc:mga09592_25380_c1
382 nmdc:mga09592_49108_c1
383 nmdc:mga09592_510968_c1
384 nmdc:mga0qj67_25933_c1
385 nmdc:mga0qj67_555526_c1
386 nmdc:mga0qj67_86951_c1
387 nmdc:mga06r32_154881_c1
388 nmdc:mga06r32_1953_c1
389 nmdc:mga06r32_342285_c1
390 nmdc:mga06r32_369437_c1
391 nmdc:mga06r32_47612_c1
392 nmdc:mga06r32_532_c1
393 nmdc:mga06r32_646780_c1
394 nmdc:mga06r32_759008_c1
395 nmdc:mga08y16_145381_c1
396 nmdc:mga08y16_64168_c1
397 nmdc:mga0n895_114894_c1
398 nmdc:mga0rr50_12303_c1
399 nmdc:mga0rr50_834548_c1
400 nmdc:mga08x19_250191_c1
401 Ga0495601_0370557
402 Ga0495619_0035759
403 Ga0500568_0000067
404 Ga0500616_0001674
405 Ga0500616_0318925
406 Ga0501084_0000010
407 Ga0501084_0034179
408 Ga0501084_0063519
409 Ga0590075_049227
410 Ga0501082_0001886
411 Ga0501082_0059386
412 Ga0501082_0126014
413 Ga0530510_0003099
414 Ga0530510_0017841
415 Ga0530510_0020670
416 Ga0530510_0902450

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01613

Flavin_Reduct

Flavin reductase like domain

54

204

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3zoe-assembly1.cif.gz_B crystal structure of fmn-binding protein (yp_005476) from thermus thermophilus with bound p-hydroxybenzaldehyde 0.8694 37 172
1wgb-assembly1.cif.gz_A crystal structure of a probable flavoprotein from thermus thermophilus hb8 0.8583 28 175
3bnk-assembly1.cif.gz_A x-ray crystal structure of flavoredoxin from methanosarcina acetivorans 0.855 40 165
1i0s-assembly1.cif.gz_A archaeoglobus fulgidus ferric reductase complex with nadp+ 0.8518 31 180
5zc2-assembly1.cif.gz_B acinetobacter baumannii p-hydroxyphenylacetate 3-hydroxylase (hpah), reductase component (c1) 0.8401 30 167
ID Description Score Start End Superfamily
1wgbA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9168 40 175 2.30.110.10
2qckA01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8843 40 175 2.30.110.10
3zoeB00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8694 37 172 2.30.110.10
3bnkA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.855 40 165 2.30.110.10
1i0sA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8518 31 180 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A537LZT2-F1-model_v4 Flavin reductase family protein 0.9282 40 187 GO:0010181
GO:0042602
AF-A0A7Z9XN02-F1-model_v4 Flavin reductase 0.9232 40 187 GO:0010181
GO:0042602
AF-A0A7C5YR19-F1-model_v4 Flavin reductase 0.9193 40 180 GO:0010181
GO:0042602
AF-A0A7C1Q0K2-F1-model_v4 Flavin reductase 0.9181 40 187 GO:0010181
GO:0042602
AF-A0A1J5AH82-F1-model_v4 Flavin reductase like domain-containing protein 0.9108 40 187 GO:0010181
GO:0042602

Map