F318274

General Info

Members Datasets Scaffolds Average Seq Length
208 171 416 396

Family's Representative Sequence

Representative Sequence 3300046615|Ga0495656_0007134|Ga0495656_0007134_2240_3514
Length 424
Sequence LLLRRKQLKEDVEMQTLAIVGASLAGLSAARAARAQGFTGRLVIIGDEPHRPYDRPPLSKEFLLGAITAEDLFLEADADELDAEWVLDAEAVSLDASSRTIRLKDGRTVQADGIVIATGARARQLPTLAGLSNVFTLRTLADAQSLAPELVPGSRMAVIGAGFIGAEVASAAASRGMEVTMIDTKPVPFAAQLGTEMGAVVAGLHAANGVELISSAVIEDFYSGESNVTGLRLGCGRYVPADIVVVGIGAEPNTGWLDGSGLELRGGVLCDAMGRTGVPGIVAVGDCAAWFDQVAGTHRRLEHWTGALERAALAVEALLDADAASRPAKPHYFWSDQYGVKLQFAGHCAGYDRLEIEVGDVLTHSCLAVYYRGDVPVAVLGMNQPRLFTKWRRLLAAPARPLGQPSGQAACSDASALVGAALVS

Samples

Sample ID Description Type Environment
1 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
26 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
27 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
28 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
29 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
30 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
31 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
32 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
33 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
34 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
35 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
51 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
52 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
53 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
54 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
55 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
56 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
57 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
58 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
59 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
60 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
61 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
62 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
63 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
64 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
65 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
66 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
67 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
68 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
69 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
70 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
71 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
72 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
73 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
74 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
75 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
76 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
77 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
78 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
79 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
80 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
81 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
82 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
83 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
84 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
85 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
86 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
87 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
88 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
89 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
90 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
91 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
92 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
93 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
94 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
95 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
96 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
97 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
98 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
99 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
100 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
101 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
102 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
103 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
104 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
105 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
106 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
107 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
108 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
109 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
110 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
111 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
112 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
113 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
114 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
120 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
121 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
122 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
123 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
124 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
125 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
126 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
127 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
128 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
129 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
130 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
131 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
132 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
133 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
134 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
135 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
136 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
137 2558860280 Kutzneria sp. 744 Isolate Unclassified
138 2643221576 Nocardioides sp. Root614 Isolate Unclassified
139 2643221590 Nocardioides sp. Root682 Isolate Unclassified
140 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
141 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
142 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
143 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
144 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
145 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
146 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
147 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
148 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
149 2867369537 Streptomyces sp. Z26 Isolate Unclassified
150 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
151 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
152 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
153 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
154 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
155 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
156 2920879853 Kocuria salina CV6 Isolate Unclassified
157 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
158 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
159 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
160 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
161 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
162 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
163 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
164 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
165 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
166 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
167 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
168 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
169 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
170 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
171 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.25
Metatranscriptomes 0.96
Isolates 17.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.17
Nodule 0
Rhizoplane 5.77
Rhizosphere 68.27
Stem 0
Stem Tuber 0.48
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495656_0007134 3300046615 Bacteria 3943
2 JGI25152J39213_1001412 3300002773 Bacteria 10391
3 rootH1_10028129 3300003316 Bacteria 4733
4 rootH2_10072363 3300003320 Bacteria 3137
5 rootH2_10203845 3300003320 Bacteria 1484
6 rootH1_10062666 3300003323 Bacteria 2438
7 Ga0065714_10003532 3300005288 Bacteria 7848
8 Ga0070676_10076471 3300005328 Bacteria 2021
9 Ga0070683_100075770 3300005329 Bacteria 3144
10 Ga0070670_100035141 3300005331 Bacteria 4314
11 Ga0070677_10035780 3300005333 Bacteria 1927
12 Ga0070666_10005548 3300005335 Bacteria 7742
13 Ga0070668_100000251 3300005347 Bacteria 35641
14 Ga0070675_100022854 3300005354 Bacteria 4996
15 Ga0070673_100334085 3300005364 Bacteria 1341
16 Ga0070700_100000060 3300005441 Bacteria 82198
17 Ga0070678_100006672 3300005456 Bacteria 6791
18 Ga0070684_100017171 3300005535 Bacteria 5932
19 Ga0070684_100370369 3300005535 Bacteria 1319
20 Ga0068853_100051268 3300005539 Bacteria 3552
21 Ga0070672_100001302 3300005543 Bacteria 15381
22 Ga0070665_100030940 3300005548 Bacteria 5387
23 Ga0070665_100226070 3300005548 Bacteria 1872
24 Ga0070664_100106078 3300005564 Bacteria 2447
25 Ga0068852_100097438 3300005616 Bacteria 2646
26 Ga0068862_100029735 3300005844 Bacteria 4604
27 Ga0081539_10000843 3300005985 Bacteria 58718
28 Ga0105251_10010427 3300009011 Bacteria 5392
29 Ga0105251_10026631 3300009011 Bacteria 2943
30 Ga0105244_10008611 3300009036 Bacteria 6352
31 Ga0105243_10007947 3300009148 Bacteria 8148
32 Ga0105246_10006681 3300011119 Bacteria 7050
33 Ga0105246_10033133 3300011119 Bacteria 3432
34 Ga0157371_10098040 3300013102 Bacteria 2078
35 Ga0163162_10016569 3300013306 Bacteria 7203
36 Ga0182008_10000573 3300014497 Bacteria 27236
37 Ga0207425_1008788 3300025245 Bacteria 2557
38 Ga0209129_1000448 3300025258 Bacteria 30833
39 Ga0209025_1007718 3300025294 Bacteria 7937
40 Ga0207697_10011972 3300025315 Bacteria 3652
41 Ga0207655_1060852 3300025728 Bacteria 1462
42 Ga0207688_10047947 3300025901 Bacteria 2386
43 Ga0207680_10047741 3300025903 Bacteria 2539
44 Ga0207645_10024589 3300025907 Bacteria 3902
45 Ga0207681_10107633 3300025923 Bacteria 2022
46 Ga0207659_10100697 3300025926 Bacteria 2177
47 Ga0207691_10004085 3300025940 Bacteria 14164
48 Ga0207661_10004341 3300025944 Bacteria 9927
49 Ga0207679_10069045 3300025945 Bacteria 2657
50 Ga0207668_10001777 3300025972 Bacteria 12584
51 Ga0207708_10000011 3300026075 Bacteria 214227
52 Ga0207683_10005744 3300026121 Bacteria 10641
53 Ga0268266_10095892 3300028379 Bacteria 2606
54 Ga0268265_10022645 3300028380 Bacteria 4417
55 Ga0307517_10005154 3300028786 Bacteria 19834
56 Ga0307515_10150842 3300028794 Bacteria 2430
57 Ga0307511_10001274 3300030521 Bacteria 26705
58 Ga0307511_10038173 3300030521 Bacteria 4131
59 Ga0307512_10009397 3300030522 Bacteria 9425
60 Ga0307513_10000671 3300031456 Bacteria 49068
61 Ga0307509_10242637 3300031507 Bacteria 1593
62 Ga0307408_100065425 3300031548 Bacteria 2666
63 Ga0307408_100133161 3300031548 Bacteria 1941
64 Ga0307408_100201385 3300031548 Bacteria 1611
65 Ga0307508_10015492 3300031616 Bacteria 6944
66 Ga0307516_10057863 3300031730 Bacteria 3775
67 Ga0307405_10026677 3300031731 Bacteria 3336
68 Ga0307405_10048738 3300031731 Bacteria 2614
69 Ga0307413_10019943 3300031824 Bacteria 3555
70 Ga0307413_10092856 3300031824 Bacteria 1971
71 Ga0307413_10216876 3300031824 Bacteria 1394
72 Ga0307410_10049921 3300031852 Bacteria 2810
73 Ga0307410_10080222 3300031852 Bacteria 2288
74 Ga0307410_10183813 3300031852 Bacteria 1584
75 Ga0307410_10191007 3300031852 Bacteria 1557
76 Ga0307406_10158562 3300031901 Bacteria 1624
77 Ga0307406_10205426 3300031901 Bacteria 1453
78 Ga0307407_10098336 3300031903 Bacteria 1810
79 Ga0307412_10032573 3300031911 Bacteria 3305
80 Ga0307412_10153124 3300031911 Bacteria 1704
81 Ga0307412_10210418 3300031911 Bacteria 1483
82 Ga0307409_100043320 3300031995 Bacteria 3378
83 Ga0307409_100106814 3300031995 Bacteria 2337
84 Ga0307409_100159973 3300031995 Bacteria 1968
85 Ga0307409_100206623 3300031995 Bacteria 1761
86 Ga0307416_100225557 3300032002 Bacteria 1801
87 Ga0307416_100262726 3300032002 Bacteria 1688
88 Ga0307416_100281663 3300032002 Bacteria 1639
89 Ga0307414_10057108 3300032004 Bacteria 2742
90 Ga0307414_10126292 3300032004 Bacteria 1977
91 Ga0307415_100041174 3300032126 Bacteria 3065
92 Ga0307415_100072142 3300032126 Bacteria 2431
93 Ga0316214_1000738 3300033545 Bacteria 3510
94 Ga0373942_0000108 3300035207 Bacteria 18755
95 Ga0373962_0000520 3300035242 Bacteria 8601
96 Ga0372808_003195 3300036459 Bacteria 1983
97 Ga0373925_0106076 3300037068 Bacteria 2166
98 Ga0395900_0011212 3300037418 Bacteria 9166
99 Ga0395900_0031812 3300037418 Bacteria 5423
100 Ga0395900_0078454 3300037418 Bacteria 3393
101 Ga0395900_0176470 3300037418 Bacteria 2173
102 Ga0395898_0036432 3300037466 Bacteria 4884
103 Ga0395898_0039048 3300037466 Bacteria 4701
104 Ga0395901_0017764 3300038443 Bacteria 7261
105 Ga0395901_0030134 3300038443 Bacteria 5589
106 Ga0395901_0038337 3300038443 Bacteria 4956
107 Ga0451853_0180028 3300041512 Bacteria 3071
108 Ga0439442_000387 3300042002 Bacteria 10324
109 Ga0439449_0004014 3300042007 Bacteria 5693
110 Ga0439449_0004915 3300042007 Bacteria 5147
111 Ga0439449_0022761 3300042007 Bacteria 2346
112 Ga0450896_009699 3300042133 Bacteria 1345
113 Ga0450906_000569 3300042145 Bacteria 7812
114 Ga0466972_0046031 3300044658 Bacteria 2113
115 Ga0466966_0002202 3300044684 Bacteria 12663
116 Ga0466963_0023881 3300044694 Bacteria 3888
117 Ga0466963_0030574 3300044694 Bacteria 3477
118 Ga0466971_0041763 3300044719 Bacteria 2060
119 Ga0466970_0060679 3300044765 Bacteria 2025
120 Ga0466967_0080828 3300045976 Bacteria 2934
121 Ga0495638_0011228 3300046460 Bacteria 6181
122 Ga0495585_0043792 3300046492 Bacteria 2502
123 Ga0495652_0073588 3300046529 Bacteria 2845
124 Ga0495622_0015793 3300046557 Bacteria 3511
125 Ga0495659_0008713 3300046664 Bacteria 3230
126 Ga0495588_0005110 3300046674 Bacteria 5830
127 Ga0495670_0005667 3300046691 Bacteria 6123
128 Ga0495670_0039022 3300046691 Bacteria 2368
129 Ga0495660_0027731 3300046810 Bacteria 3202
130 Ga0495581_0005545 3300047315 Bacteria 7311
131 Ga0495636_0004345 3300047318 Bacteria 5562
132 Ga0495687_005397 3300047443 Bacteria 8159
133 Ga0495685_000217 3300047447 Bacteria 19537
134 Ga0495681_0000539 3300047470 Bacteria 29033
135 Ga0495681_0020184 3300047470 Bacteria 3620
136 Ga0496100_0140970 3300048903 Bacteria 1708
137 Ga0496102_0095175 3300048905 Bacteria 2760
138 Ga0496102_0110398 3300048905 Bacteria 2563
139 Ga0496103_0022395 3300048906 Bacteria 3804
140 Ga0496104_0007707 3300048907 Bacteria 9533
141 Ga0496109_0094527 3300048912 Bacteria 2767
142 Ga0496110_0069648 3300048913 Bacteria 3115
143 Ga0496111_0159468 3300048914 Bacteria 1674
144 Ga0496112_0238388 3300048915 Bacteria 1772
145 Ga0496113_0009225 3300048916 Bacteria 6470
146 Ga0496114_0037437 3300048917 Bacteria 4012
147 Ga0496115_0027222 3300048918 Bacteria 4470
148 Ga0496119_0113744 3300048922 Bacteria 1498
149 Ga0496124_0064304 3300048927 Bacteria 3063
150 Ga0501324_000560 3300049540 Bacteria 2072
151 Ga0501033_0050237 3300049570 Bacteria 3094
152 Ga0501034_0035195 3300049571 Bacteria 5078
153 Ga0501036_0073776 3300049572 Bacteria 2885
154 Ga0501038_0019978 3300049574 Bacteria 6030
155 Ga0501038_0029188 3300049574 Bacteria 4891
156 Ga0501249_000208 3300049679 Bacteria 17938
157 Ga0501035_0097295 3300049822 Bacteria 2585
158 Ga0495612_0010840 3300053078 Bacteria 3682
159 Ga0500610_0084401 3300053079 Bacteria 1654
160 Ga0500644_0006656 3300053088 Bacteria 2973
161 Ga0500566_0028649 3300053094 Bacteria 3254
162 Ga0500660_054619 3300053100 Bacteria 1957
163 Ga0500569_000907 3300053109 Bacteria 5311
164 Ga0500628_006374 3300053129 Bacteria 1995
165 Ga0500652_002208 3300053131 Bacteria 5850
166 Ga0500658_0009993 3300053134 Bacteria 3501
167 Ga0500561_0002263 3300053137 Bacteria 3219
168 Ga0500579_037485 3300053143 Bacteria 3070
169 Ga0500600_0008016 3300053149 Bacteria 6365
170 Ga0500616_0011294 3300053153 Bacteria 5287
171 Ga0500633_0011210 3300053160 Bacteria 2429
172 2523384364 2523231044 Bacteria 6434991
173 2537898940 2537561592 Bacteria 4348607
174 2559431389 2558860280 Bacteria 11429938
175 2643889539 2643221576 Bacteria 5214352
176 2643958595 2643221590 Bacteria 5214697
177 2731907418 2731639228 Bacteria 4187555
178 2739365923 2738543034 Bacteria 6084756
179 2753035165 2751185725 Bacteria 5740550
180 2753323682 2751185792 Bacteria 5739090
181 2785366822 2784746768 Bacteria 10036182
182 2786667868 2786546132 Bacteria 10419719
183 2808846571 2808606359 Bacteria 9866990
184 2811842706 2808606982 Bacteria 7791042
185 2863410847 2863404153 Bacteria 9672205
186 2867371256 2867369537 Bacteria 6501581
187 2877683724 2877676314 Bacteria 9512378
188 2887445545 2887443736 Bacteria 4426037
189 2891396668 2891395885 Bacteria 9251614
190 2891555717 2891554331 Bacteria 8812224
191 2899370614 2899370129 Bacteria 6781179
192 2919395793 2919391150 Bacteria 4884741
193 2920880120 2920879853 Bacteria 4216831
194 2945941384 2945941187 Bacteria 4682474
195 2954389018 2954380949 Bacteria 10050426
196 2954674008 2954673503 Bacteria 9685905
197 2954689980 2954682443 Bacteria 9862841
198 2954691880 2954691527 Bacteria 10720516
199 2954706990 2954701450 Bacteria 10834262
200 2954718697 2954711539 Bacteria 10867210
201 2954728668 2954721474 Bacteria 10456478
202 2954733144 2954731030 Bacteria 10243860
203 2954747564 2954740390 Bacteria 10229294
204 2954752024 2954749733 Bacteria 10366972
205 2954766681 2954759201 Bacteria 9358192
206 2990064630 2990059506 Bacteria 9321252
207 8004026620 8004025490 Bacteria 4327753
208 8056830733 8056829672 Bacteria 9045328
209 Ga0495656_0007134
210 JGI25152J39213_1001412
211 rootH1_10028129
212 rootH2_10072363
213 rootH2_10203845
214 rootH1_10062666
215 Ga0065714_10003532
216 Ga0070676_10076471
217 Ga0070683_100075770
218 Ga0070670_100035141
219 Ga0070677_10035780
220 Ga0070666_10005548
221 Ga0070668_100000251
222 Ga0070675_100022854
223 Ga0070673_100334085
224 Ga0070700_100000060
225 Ga0070678_100006672
226 Ga0070684_100017171
227 Ga0070684_100370369
228 Ga0068853_100051268
229 Ga0070672_100001302
230 Ga0070665_100030940
231 Ga0070665_100226070
232 Ga0070664_100106078
233 Ga0068852_100097438
234 Ga0068862_100029735
235 Ga0081539_10000843
236 Ga0105251_10010427
237 Ga0105251_10026631
238 Ga0105244_10008611
239 Ga0105243_10007947
240 Ga0105246_10006681
241 Ga0105246_10033133
242 Ga0157371_10098040
243 Ga0163162_10016569
244 Ga0182008_10000573
245 Ga0207425_1008788
246 Ga0209129_1000448
247 Ga0209025_1007718
248 Ga0207697_10011972
249 Ga0207655_1060852
250 Ga0207688_10047947
251 Ga0207680_10047741
252 Ga0207645_10024589
253 Ga0207681_10107633
254 Ga0207659_10100697
255 Ga0207691_10004085
256 Ga0207661_10004341
257 Ga0207679_10069045
258 Ga0207668_10001777
259 Ga0207708_10000011
260 Ga0207683_10005744
261 Ga0268266_10095892
262 Ga0268265_10022645
263 Ga0307517_10005154
264 Ga0307515_10150842
265 Ga0307511_10001274
266 Ga0307511_10038173
267 Ga0307512_10009397
268 Ga0307513_10000671
269 Ga0307509_10242637
270 Ga0307408_100065425
271 Ga0307408_100133161
272 Ga0307408_100201385
273 Ga0307508_10015492
274 Ga0307516_10057863
275 Ga0307405_10026677
276 Ga0307405_10048738
277 Ga0307413_10019943
278 Ga0307413_10092856
279 Ga0307413_10216876
280 Ga0307410_10049921
281 Ga0307410_10080222
282 Ga0307410_10183813
283 Ga0307410_10191007
284 Ga0307406_10158562
285 Ga0307406_10205426
286 Ga0307407_10098336
287 Ga0307412_10032573
288 Ga0307412_10153124
289 Ga0307412_10210418
290 Ga0307409_100043320
291 Ga0307409_100106814
292 Ga0307409_100159973
293 Ga0307409_100206623
294 Ga0307416_100225557
295 Ga0307416_100262726
296 Ga0307416_100281663
297 Ga0307414_10057108
298 Ga0307414_10126292
299 Ga0307415_100041174
300 Ga0307415_100072142
301 Ga0316214_1000738
302 Ga0373942_0000108
303 Ga0373962_0000520
304 Ga0372808_003195
305 Ga0373925_0106076
306 Ga0395900_0011212
307 Ga0395900_0031812
308 Ga0395900_0078454
309 Ga0395900_0176470
310 Ga0395898_0036432
311 Ga0395898_0039048
312 Ga0395901_0017764
313 Ga0395901_0030134
314 Ga0395901_0038337
315 Ga0451853_0180028
316 Ga0439442_000387
317 Ga0439449_0004014
318 Ga0439449_0004915
319 Ga0439449_0022761
320 Ga0450896_009699
321 Ga0450906_000569
322 Ga0466972_0046031
323 Ga0466966_0002202
324 Ga0466963_0023881
325 Ga0466963_0030574
326 Ga0466971_0041763
327 Ga0466970_0060679
328 Ga0466967_0080828
329 Ga0495638_0011228
330 Ga0495585_0043792
331 Ga0495652_0073588
332 Ga0495622_0015793
333 Ga0495659_0008713
334 Ga0495588_0005110
335 Ga0495670_0005667
336 Ga0495670_0039022
337 Ga0495660_0027731
338 Ga0495581_0005545
339 Ga0495636_0004345
340 Ga0495687_005397
341 Ga0495685_000217
342 Ga0495681_0000539
343 Ga0495681_0020184
344 Ga0496100_0140970
345 Ga0496102_0095175
346 Ga0496102_0110398
347 Ga0496103_0022395
348 Ga0496104_0007707
349 Ga0496109_0094527
350 Ga0496110_0069648
351 Ga0496111_0159468
352 Ga0496112_0238388
353 Ga0496113_0009225
354 Ga0496114_0037437
355 Ga0496115_0027222
356 Ga0496119_0113744
357 Ga0496124_0064304
358 Ga0501324_000560
359 Ga0501033_0050237
360 Ga0501034_0035195
361 Ga0501036_0073776
362 Ga0501038_0019978
363 Ga0501038_0029188
364 Ga0501249_000208
365 Ga0501035_0097295
366 Ga0495612_0010840
367 Ga0500610_0084401
368 Ga0500644_0006656
369 Ga0500566_0028649
370 Ga0500660_054619
371 Ga0500569_000907
372 Ga0500628_006374
373 Ga0500652_002208
374 Ga0500658_0009993
375 Ga0500561_0002263
376 Ga0500579_037485
377 Ga0500600_0008016
378 Ga0500616_0011294
379 Ga0500633_0011210
380 2523384364
381 2537898940
382 2559431389
383 2643889539
384 2643958595
385 2731907418
386 2739365923
387 2753035165
388 2753323682
389 2785366822
390 2786667868
391 2808846571
392 2811842706
393 2863410847
394 2867371256
395 2877683724
396 2887445545
397 2891396668
398 2891555717
399 2899370614
400 2919395793
401 2920880120
402 2945941384
403 2954389018
404 2954674008
405 2954689980
406 2954691880
407 2954706990
408 2954718697
409 2954728668
410 2954733144
411 2954747564
412 2954752024
413 2954766681
414 2990064630
415 8004026620
416 8056830733

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

15

311

0.94

PF00070

Pyr_redox

Pyridine nucleotide-disulphide oxidoreductase

155

234

0.93

PF02737

3HCDH_N

3-hydroxyacyl-CoA dehydrogenase, NAD binding domain

155

202

0.91

PF14759

Reductase_C

Reductase C-terminal

332

414

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4b7x-assembly3.cif.gz_K crystal structure of hypothetical protein pa1648 from pseudomonas aeruginosa. 0.966 138 169
3gf4-assembly1.cif.gz_A structure of udp-galactopyranose mutase bound to udp-glucose 0.9575 139 175
8i5z-assembly1.cif.gz_A ldh mutant p101q-(an unexpected single-point mutation triggers the unleashing of catalytic potential of a nadh-dependent dehydrogenase) 0.9528 139 170
4h4z-assembly1.cif.gz_A crystal structure of ferredoxin reductase, bpha4 e175q/t176r/q177g mutant (oxidized form) 0.9516 4 384
4h4p-assembly1.cif.gz_A crystal structure of ferredoxin reductase, bpha4 e175q/q177k mutant (oxidized form) 0.9509 4 384
ID Description Score Start End Superfamily
5gudE02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9963 139 166 3.40.50.720
af_I6XF25_1_136_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9854 142 171 3.40.50.720
af_A0A0R0H2V7_155_331_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9736 138 170 3.40.50.720
af_Q2G2C7_146_286_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9725 138 169 3.40.50.720
4b7xK02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.966 138 169 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7I7Q7X7-F1-model_v4 FAD/NAD(P)-binding domain-containing protein 0.9735 118 282 GO:0016491
AF-A0A0K2RGD8-F1-model_v4 Rhodocoxin reductase 0.9717 66 394 GO:0005737
GO:0016651
AF-A0A368ET29-F1-model_v4 NAD(P)/FAD-dependent oxidoreductase 0.9698 1 177 GO:0005737
GO:0016651
AF-A0A381PG25-F1-model_v4 FAD/NAD(P)-binding domain-containing protein 0.9673 4 382 GO:0005737
GO:0016651
AF-A0A239NKZ7-F1-model_v4 Pyridine nucleotide-disulphide oxidoreductase 0.9653 1 384 GO:0005737
GO:0016651

Map