F317993
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 208 | 157 | 207 | 298 |
Family's Representative Sequence
| Representative Sequence | 3300031090|Ga0265760_10010568|Ga0265760_100105682 |
| Length | 304 |
| Sequence | MTKQAKLGGAFMFSGTGMTVNRMGYGAMQLAGPGVWGPPRDREAAVSVLREAVAAGVNHIDTSDYYGPHVTNQIIKEALHPYADGLVIVTKVGARRGPDKSWLHARSRQDVIDAVHDNLRNLGVEAIDVVNLRVGGMMGPEEGSIEEPMTALAELKGKGLIRQLGLSNVNRKQLAEAQAITEIVCVQNFYNVAHREDDGFIDALAKQGIAYVPFFPLGGFTPLQSSVLDEAAATLGVTAMQVALAWLLQRSPNVLLIPGTSSVKHLRENLAAATLKIPEGILGELNSIGSAHGEGKHSPVAVAK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 2 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 3 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 4 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 5 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 6 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 7 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 8 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 9 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 28 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 33 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 35 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 36 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 37 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 38 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 39 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 41 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 43 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 44 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 45 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 46 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 47 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 48 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 50 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 65 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 66 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 67 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 68 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 69 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 70 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 77 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 78 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 80 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 106 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 109 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 110 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 111 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 112 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 113 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 114 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 115 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 116 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 117 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 118 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 119 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 120 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 121 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 122 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 123 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 124 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 125 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 126 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 127 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 128 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 129 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 130 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 131 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 132 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 133 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 134 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 135 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 136 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 137 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 138 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 139 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 140 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 141 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 142 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 143 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 144 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 145 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 146 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 147 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 148 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 149 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 150 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 151 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 152 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 153 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 154 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 155 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 156 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 157 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.08 |
| Metatranscriptomes | 1.44 |
| Isolates | 0.48 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.58 |
| Nodule | 0 |
| Rhizoplane | 3.37 |
| Rhizosphere | 75.96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25162J39368_1000255 | 3300002737 | Bacteria | 50867 |
| 2 | JGI25157J39369_1000456 | 3300002741 | Bacteria | 25889 |
| 3 | JGI25163J39215_1000635 | 3300002771 | Bacteria | 9555 |
| 4 | JGI25164J39214_1000388 | 3300002772 | Bacteria | 25913 |
| 5 | JGI25165J46597_1000144 | 3300003214 | Bacteria | 117624 |
| 6 | Ga0055535_1000061 | 3300003761 | Bacteria | 117624 |
| 7 | Ga0055542_1000099 | 3300003762 | Bacteria | 117624 |
| 8 | Ga0055529_1000117 | 3300003763 | Bacteria | 117613 |
| 9 | Ga0065165_1000383 | 3300005262 | Bacteria | 71804 |
| 10 | Ga0070658_10215019 | 3300005327 | Bacteria | 1624 |
| 11 | Ga0068869_100355625 | 3300005334 | Bacteria | 1195 |
| 12 | Ga0068868_100016785 | 3300005338 | Bacteria | 5445 |
| 13 | Ga0070689_100305301 | 3300005340 | Bacteria | 1325 |
| 14 | Ga0070668_100012879 | 3300005347 | Bacteria | 6227 |
| 15 | Ga0070675_100230815 | 3300005354 | Bacteria | 1614 |
| 16 | Ga0070673_100181682 | 3300005364 | Bacteria | 1801 |
| 17 | Ga0070709_10000004 | 3300005434 | Bacteria | 214262 |
| 18 | Ga0070713_100596636 | 3300005436 | Bacteria | 1049 |
| 19 | Ga0070708_100024226 | 3300005445 | Bacteria | 5173 |
| 20 | Ga0070706_100003347 | 3300005467 | Bacteria | 15809 |
| 21 | Ga0070707_100165498 | 3300005468 | Bacteria | 2155 |
| 22 | Ga0070707_100348346 | 3300005468 | Bacteria | 1439 |
| 23 | Ga0070698_100062534 | 3300005471 | Bacteria | 3756 |
| 24 | Ga0070698_100121572 | 3300005471 | Bacteria | 2571 |
| 25 | Ga0070699_100097717 | 3300005518 | Bacteria | 2572 |
| 26 | Ga0070679_100005317 | 3300005530 | Bacteria | 11917 |
| 27 | Ga0070697_100118102 | 3300005536 | Bacteria | 2216 |
| 28 | Ga0068853_100000487 | 3300005539 | Bacteria | 27038 |
| 29 | Ga0068853_100061359 | 3300005539 | Bacteria | 3252 |
| 30 | Ga0070672_100002856 | 3300005543 | Bacteria | 11086 |
| 31 | Ga0070686_100002262 | 3300005544 | Bacteria | 10618 |
| 32 | Ga0070686_100136991 | 3300005544 | Bacteria | 1700 |
| 33 | Ga0070665_100000024 | 3300005548 | Bacteria | 374559 |
| 34 | Ga0070665_100357526 | 3300005548 | Bacteria | 1466 |
| 35 | Ga0070704_100081590 | 3300005549 | Bacteria | 2382 |
| 36 | Ga0068855_100017683 | 3300005563 | Bacteria | 8574 |
| 37 | Ga0068855_100685868 | 3300005563 | Bacteria | 1097 |
| 38 | Ga0070702_100204480 | 3300005615 | Bacteria | 1310 |
| 39 | Ga0068859_100548158 | 3300005617 | Bacteria | 1251 |
| 40 | Ga0068863_100625213 | 3300005841 | Bacteria | 1067 |
| 41 | Ga0068860_100655640 | 3300005843 | Bacteria | 1058 |
| 42 | Ga0081455_10005321 | 3300005937 | Bacteria | 14133 |
| 43 | Ga0081539_10004666 | 3300005985 | Bacteria | 14895 |
| 44 | Ga0070716_100348805 | 3300006173 | Bacteria | 1047 |
| 45 | Ga0075366_10088342 | 3300006195 | Bacteria | 1856 |
| 46 | Ga0097621_100049399 | 3300006237 | Bacteria | 3417 |
| 47 | Ga0068871_100041771 | 3300006358 | Unclassified | 3679 |
| 48 | Ga0068871_100414744 | 3300006358 | Bacteria | 1201 |
| 49 | Ga0075428_100143143 | 3300006844 | Bacteria | 2599 |
| 50 | Ga0075431_100120550 | 3300006847 | Bacteria | 2706 |
| 51 | Ga0075431_100289157 | 3300006847 | Bacteria | 1658 |
| 52 | Ga0075431_100360424 | 3300006847 | Bacteria | 1460 |
| 53 | Ga0075433_10031635 | 3300006852 | Bacteria | 4524 |
| 54 | Ga0075433_10309490 | 3300006852 | Bacteria | 1398 |
| 55 | Ga0075434_100046141 | 3300006871 | Bacteria | 4324 |
| 56 | Ga0075434_100087373 | 3300006871 | Bacteria | 3118 |
| 57 | Ga0075434_100154116 | 3300006871 | Bacteria | 2318 |
| 58 | Ga0075434_100215652 | 3300006871 | Bacteria | 1939 |
| 59 | Ga0075436_100011307 | 3300006914 | Bacteria | 6123 |
| 60 | Ga0075436_100359039 | 3300006914 | Bacteria | 1051 |
| 61 | Ga0097620_100548229 | 3300006931 | Bacteria | 1251 |
| 62 | Ga0075435_100071994 | 3300007076 | Bacteria | 2823 |
| 63 | Ga0075435_100243207 | 3300007076 | Bacteria | 1531 |
| 64 | Ga0075435_100478964 | 3300007076 | Bacteria | 1075 |
| 65 | Ga0105240_10261040 | 3300009093 | Bacteria | 1998 |
| 66 | Ga0111539_10459229 | 3300009094 | Bacteria | 1483 |
| 67 | Ga0105245_10000977 | 3300009098 | Bacteria | 26118 |
| 68 | Ga0105245_10060639 | 3300009098 | Bacteria | 3407 |
| 69 | Ga0105242_10059416 | 3300009176 | Bacteria | 3137 |
| 70 | Ga0105237_10000419 | 3300009545 | Bacteria | 60567 |
| 71 | Ga0105238_10138608 | 3300009551 | Bacteria | 2410 |
| 72 | Ga0105238_10261965 | 3300009551 | Bacteria | 1708 |
| 73 | Ga0105238_10788926 | 3300009551 | Bacteria | 965 |
| 74 | Ga0105249_10000245 | 3300009553 | Bacteria | 60260 |
| 75 | Ga0105249_10245456 | 3300009553 | Bacteria | 1772 |
| 76 | Ga0105249_10268608 | 3300009553 | Bacteria | 1698 |
| 77 | Ga0105239_10357471 | 3300010375 | Bacteria | 1649 |
| 78 | Ga0105246_10149752 | 3300011119 | Bacteria | 1765 |
| 79 | Ga0157374_10000216 | 3300013296 | Bacteria | 53208 |
| 80 | Ga0163162_10053098 | 3300013306 | Bacteria | 4072 |
| 81 | Ga0163163_10324570 | 3300014325 | Bacteria | 1593 |
| 82 | Ga0163163_10427611 | 3300014325 | Bacteria | 1383 |
| 83 | Ga0157379_10066822 | 3300014968 | Bacteria | 3215 |
| 84 | Ga0157379_10328020 | 3300014968 | Bacteria | 1398 |
| 85 | Ga0157376_10000416 | 3300014969 | Bacteria | 27769 |
| 86 | Ga0157376_10327390 | 3300014969 | Bacteria | 1459 |
| 87 | Ga0183361_10002 | 3300016635 | Bacteria | 907642 |
| 88 | Ga0213872_10019769 | 3300021361 | Bacteria | 3102 |
| 89 | Ga0213876_10013284 | 3300021384 | Bacteria | 4376 |
| 90 | Ga0213875_10019478 | 3300021388 | Bacteria | 3264 |
| 91 | Ga0224712_10020525 | 3300022467 | Bacteria | 2245 |
| 92 | Ga0209435_103176 | 3300025206 | Bacteria | 1884 |
| 93 | Ga0209760_100503 | 3300025207 | Bacteria | 8243 |
| 94 | Ga0209784_100043 | 3300025224 | Bacteria | 217823 |
| 95 | Ga0209672_105974 | 3300025228 | Bacteria | 2031 |
| 96 | Ga0207427_100087 | 3300025231 | Bacteria | 140098 |
| 97 | Ga0209437_100173 | 3300025233 | Bacteria | 140098 |
| 98 | Ga0209258_100092 | 3300025242 | Bacteria | 226544 |
| 99 | Ga0209646_1000439 | 3300025246 | Bacteria | 22592 |
| 100 | Ga0209026_1000112 | 3300025250 | Bacteria | 140098 |
| 101 | Ga0209148_1000047 | 3300025254 | Bacteria | 434369 |
| 102 | Ga0209759_1000597 | 3300025256 | Bacteria | 34955 |
| 103 | Ga0209233_1000179 | 3300025261 | Bacteria | 140518 |
| 104 | Ga0209455_1000056 | 3300025272 | Bacteria | 349821 |
| 105 | Ga0209130_1004650 | 3300025284 | Bacteria | 5100 |
| 106 | Ga0209050_1001860 | 3300025298 | Bacteria | 20346 |
| 107 | Ga0207426_1000004 | 3300025302 | Bacteria | 1047900 |
| 108 | Ga0207684_10000705 | 3300025910 | Bacteria | 39440 |
| 109 | Ga0207684_10125067 | 3300025910 | Bacteria | 2206 |
| 110 | Ga0207684_10431351 | 3300025910 | Bacteria | 1132 |
| 111 | Ga0207654_10001730 | 3300025911 | Bacteria | 11358 |
| 112 | Ga0207695_10000505 | 3300025913 | Bacteria | 82918 |
| 113 | Ga0207695_10068870 | 3300025913 | Bacteria | 3624 |
| 114 | Ga0207671_10000089 | 3300025914 | Bacteria | 140114 |
| 115 | Ga0207663_10299947 | 3300025916 | Bacteria | 1200 |
| 116 | Ga0207652_10029481 | 3300025921 | Bacteria | 4589 |
| 117 | Ga0207646_10056740 | 3300025922 | Bacteria | 3500 |
| 118 | Ga0207687_10001767 | 3300025927 | Bacteria | 14869 |
| 119 | Ga0207669_10250297 | 3300025937 | Bacteria | 1319 |
| 120 | Ga0207665_10075622 | 3300025939 | Bacteria | 2307 |
| 121 | Ga0207691_10003645 | 3300025940 | Bacteria | 14936 |
| 122 | Ga0207667_10003622 | 3300025949 | Bacteria | 19060 |
| 123 | Ga0207667_10044098 | 3300025949 | Bacteria | 4728 |
| 124 | Ga0207651_10373836 | 3300025960 | Bacteria | 1206 |
| 125 | Ga0207712_10000086 | 3300025961 | Bacteria | 107484 |
| 126 | Ga0207712_10248930 | 3300025961 | Bacteria | 1435 |
| 127 | Ga0207668_10011180 | 3300025972 | Bacteria | 5448 |
| 128 | Ga0207677_10009600 | 3300026023 | Bacteria | 5445 |
| 129 | Ga0207639_10000357 | 3300026041 | Bacteria | 31603 |
| 130 | Ga0207639_10175569 | 3300026041 | Bacteria | 1818 |
| 131 | Ga0207678_10002107 | 3300026067 | Bacteria | 18018 |
| 132 | Ga0207708_10227778 | 3300026075 | Bacteria | 1495 |
| 133 | Ga0207641_10001826 | 3300026088 | Bacteria | 20485 |
| 134 | Ga0207428_10056007 | 3300027907 | Bacteria | 3133 |
| 135 | Ga0268266_10000019 | 3300028379 | Bacteria | 556465 |
| 136 | Ga0268266_10309237 | 3300028379 | Bacteria | 1476 |
| 137 | Ga0268264_10179120 | 3300028381 | Bacteria | 1923 |
| 138 | Ga0265337_1000083 | 3300028556 | Bacteria | 45573 |
| 139 | Ga0265326_10001797 | 3300028558 | Bacteria | 7396 |
| 140 | Ga0265319_1034292 | 3300028563 | Bacteria | 1747 |
| 141 | Ga0265318_10015058 | 3300028577 | Bacteria | 3228 |
| 142 | Ga0265318_10043131 | 3300028577 | Bacteria | 1710 |
| 143 | Ga0265336_10060744 | 3300028666 | Bacteria | 1134 |
| 144 | Ga0265338_10006810 | 3300028800 | Bacteria | 14396 |
| 145 | Ga0265338_10048853 | 3300028800 | Bacteria | 3844 |
| 146 | Ga0265760_10002063 | 3300031090 | Bacteria | 5914 |
| 147 | Ga0265760_10010568 | 3300031090 | Bacteria | 2637 |
| 148 | Ga0265320_10075598 | 3300031240 | Bacteria | 1580 |
| 149 | Ga0265316_10007212 | 3300031344 | Bacteria | 10499 |
| 150 | Ga0265316_10152083 | 3300031344 | Bacteria | 1733 |
| 151 | Ga0265314_10016728 | 3300031711 | Bacteria | 5780 |
| 152 | Ga0265342_10070339 | 3300031712 | Bacteria | 2042 |
| 153 | Ga0373935_0057759 | 3300035692 | Bacteria | 2476 |
| 154 | Ga0373947_0244610 | 3300035725 | Bacteria | 1185 |
| 155 | Ga0373925_0068193 | 3300037068 | Bacteria | 2684 |
| 156 | Ga0436364_0519106 | 3300037853 | Bacteria | 8345 |
| 157 | Ga0436365_0098766 | 3300039437 | Bacteria | 9872 |
| 158 | Ga0436365_0598358 | 3300039437 | Bacteria | 3949 |
| 159 | Ga0436365_0722592 | 3300039437 | Bacteria | 22222 |
| 160 | Ga0436365_1157171 | 3300039437 | Bacteria | 4814 |
| 161 | Ga0436365_1893862 | 3300039437 | Bacteria | 1867 |
| 162 | Ga0436361_0186542 | 3300039447 | Bacteria | 2019 |
| 163 | Ga0436361_0957178 | 3300039447 | Bacteria | 3104 |
| 164 | Ga0466969_0015191 | 3300044656 | Bacteria | 4036 |
| 165 | Ga0466966_0013527 | 3300044684 | Bacteria | 5402 |
| 166 | Ga0466961_0176588 | 3300044693 | Bacteria | 1327 |
| 167 | Ga0466960_0016970 | 3300044901 | Bacteria | 3167 |
| 168 | Ga0466959_0010752 | 3300045049 | Bacteria | 6557 |
| 169 | Ga0466959_0046414 | 3300045049 | Bacteria | 3197 |
| 170 | Ga0466958_0108122 | 3300045836 | Bacteria | 1735 |
| 171 | Ga0496100_0000020 | 3300048903 | Bacteria | 147250 |
| 172 | Ga0496101_0000045 | 3300048904 | Bacteria | 157340 |
| 173 | Ga0496102_0000589 | 3300048905 | Bacteria | 38406 |
| 174 | Ga0496103_0000264 | 3300048906 | Bacteria | 50288 |
| 175 | Ga0496110_0218565 | 3300048913 | Bacteria | 1733 |
| 176 | Ga0496112_0184830 | 3300048915 | Bacteria | 2048 |
| 177 | Ga0496114_0029166 | 3300048917 | Bacteria | 4533 |
| 178 | Ga0496116_0074789 | 3300048919 | Bacteria | 2129 |
| 179 | Ga0496117_0000293 | 3300048920 | Bacteria | 89946 |
| 180 | Ga0496118_0000411 | 3300048921 | Bacteria | 71545 |
| 181 | Ga0496119_0013344 | 3300048922 | Bacteria | 6560 |
| 182 | Ga0496121_0000765 | 3300048924 | Bacteria | 59004 |
| 183 | Ga0496126_0060181 | 3300048929 | Bacteria | 3417 |
| 184 | Ga0496126_0232551 | 3300048929 | Bacteria | 1544 |
| 185 | Ga0501067_0029494 | 3300049583 | Bacteria | 3041 |
| 186 | Ga0501067_0070872 | 3300049583 | Bacteria | 1930 |
| 187 | Ga0501083_0139143 | 3300049744 | Bacteria | 1590 |
| 188 | Ga0501035_0082184 | 3300049822 | Bacteria | 2843 |
| 189 | Ga0501044_0300640 | 3300049823 | Bacteria | 1534 |
| 190 | nmdc:mga05p37_125109_c1 | 3300050507 | Bacteria | 3157 |
| 191 | nmdc:mga05p37_648607_c1 | 3300050507 | Bacteria | 1183 |
| 192 | nmdc:mga09592_89188_c1 | 3300050508 | Bacteria | 2634 |
| 193 | nmdc:mga06r32_126793_c1 | 3300050510 | Bacteria | 2522 |
| 194 | nmdc:mga06r32_226118_c1 | 3300050510 | Bacteria | 1860 |
| 195 | nmdc:mga06r32_4186_c1 | 3300050510 | Bacteria | 12924 |
| 196 | nmdc:mga08y16_50671_c1 | 3300050511 | Bacteria | 4345 |
| 197 | nmdc:mga0n895_10504_c1 | 3300050512 | Bacteria | 8189 |
| 198 | nmdc:mga0n895_279583_c1 | 3300050512 | Bacteria | 1693 |
| 199 | nmdc:mga0n895_344950_c1 | 3300050512 | Bacteria | 1508 |
| 200 | nmdc:mga0n895_432099_c1 | 3300050512 | Bacteria | 1330 |
| 201 | nmdc:mga0rr50_345592_c1 | 3300050513 | Bacteria | 1250 |
| 202 | nmdc:mga08x19_56723_c1 | 3300050514 | Bacteria | 2529 |
| 203 | nmdc:mga0a205_250044_c1 | 3300050515 | Bacteria | 1653 |
| 204 | nmdc:mga0a205_67781_c1 | 3300050515 | Bacteria | 3447 |
| 205 | Ga0500555_005419 | 3300053103 | Bacteria | 3618 |
| 206 | Ga0501084_0073204 | 3300054114 | Bacteria | 2869 |
| 207 | Ga0501084_0373874 | 3300054114 | Bacteria | 1204 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050512 | nmdc:mga0n895_344950_c1 | nmdc:mga0n895_344950_c1_716_1495 | 258 |
| 2 | 3300005338 | Ga0068868_100016785 | Ga0068868_1000167852 | 277 |
| 3 | 3300006358 | Ga0068871_100041771 | Ga0068871_1000417712 | 277 |
| 4 | 3300009176 | Ga0105242_10059416 | Ga0105242_100594163 | 277 |
| 5 | 3300026023 | Ga0207677_10009600 | Ga0207677_100096002 | 277 |
| 6 | 3300006847 | Ga0075431_100360424 | Ga0075431_1003604242 | 280 |
| 7 | 3300006852 | Ga0075433_10309490 | Ga0075433_103094901 | 280 |
| 8 | 3300022467 | Ga0224712_10020525 | Ga0224712_100205252 | 280 |
| 9 | 3300049583 | Ga0501067_0070872 | Ga0501067_0070872_936_1814 | 280 |
| 10 | 3300005434 | Ga0070709_10000004 | Ga0070709_100000045 | 282 |
| 11 | 3300005436 | Ga0070713_100596636 | Ga0070713_1005966361 | 282 |
| 12 | 3300005539 | Ga0068853_100061359 | Ga0068853_1000613594 | 283 |
| 13 | 3300009551 | Ga0105238_10788926 | Ga0105238_107889261 | 283 |
| 14 | 3300025939 | Ga0207665_10075622 | Ga0207665_100756223 | 283 |
| 15 | 3300026041 | Ga0207639_10175569 | Ga0207639_101755692 | 283 |
| 16 | 3300026088 | Ga0207641_10001826 | Ga0207641_1000182618 | 283 |
| 17 | 3300039437 | Ga0436365_0722592 | Ga0436365_0722592_17604_18479 | 283 |
| 18 | 3300048917 | Ga0496114_0029166 | Ga0496114_0029166_2084_2965 | 284 |
| 19 | iso_pu_bacteria | 2751185821 | 2753459353 | 284 |
| 20 | 3300006173 | Ga0070716_100348805 | Ga0070716_1003488051 | 285 |
| 21 | 3300006358 | Ga0068871_100414744 | Ga0068871_1004147442 | 285 |
| 22 | 3300009098 | Ga0105245_10000977 | Ga0105245_100009774 | 285 |
| 23 | 3300021361 | Ga0213872_10019769 | Ga0213872_100197693 | 285 |
| 24 | 3300025927 | Ga0207687_10001767 | Ga0207687_100017674 | 285 |
| 25 | 3300028556 | Ga0265337_1000083 | Ga0265337_100008330 | 285 |
| 26 | 3300031090 | Ga0265760_10002063 | Ga0265760_100020633 | 285 |
| 27 | 3300039447 | Ga0436361_0957178 | Ga0436361_0957178_560_1465 | 285 |
| 28 | 3300045049 | Ga0466959_0046414 | Ga0466959_0046414_749_1642 | 285 |
| 29 | 3300005530 | Ga0070679_100005317 | Ga0070679_1000053173 | 286 |
| 30 | 3300005548 | Ga0070665_100000024 | Ga0070665_100000024206 | 286 |
| 31 | 3300005937 | Ga0081455_10005321 | Ga0081455_100053216 | 286 |
| 32 | 3300005985 | Ga0081539_10004666 | Ga0081539_100046663 | 286 |
| 33 | 3300006844 | Ga0075428_100143143 | Ga0075428_1001431431 | 286 |
| 34 | 3300006847 | Ga0075431_100120550 | Ga0075431_1001205503 | 286 |
| 35 | 3300006871 | Ga0075434_100046141 | Ga0075434_1000461411 | 286 |
| 36 | 3300009545 | Ga0105237_10000419 | Ga0105237_1000041935 | 286 |
| 37 | 3300009551 | Ga0105238_10138608 | Ga0105238_101386081 | 286 |
| 38 | 3300021384 | Ga0213876_10013284 | Ga0213876_100132844 | 286 |
| 39 | 3300021388 | Ga0213875_10019478 | Ga0213875_100194784 | 286 |
| 40 | 3300025914 | Ga0207671_10000089 | Ga0207671_10000089100 | 286 |
| 41 | 3300025916 | Ga0207663_10299947 | Ga0207663_102999472 | 286 |
| 42 | 3300025921 | Ga0207652_10029481 | Ga0207652_100294817 | 286 |
| 43 | 3300028379 | Ga0268266_10000019 | Ga0268266_10000019159 | 286 |
| 44 | 3300028563 | Ga0265319_1034292 | Ga0265319_10342922 | 286 |
| 45 | 3300028577 | Ga0265318_10015058 | Ga0265318_100150582 | 286 |
| 46 | 3300028800 | Ga0265338_10048853 | Ga0265338_100488531 | 286 |
| 47 | 3300031344 | Ga0265316_10152083 | Ga0265316_101520831 | 286 |
| 48 | 3300031712 | Ga0265342_10070339 | Ga0265342_100703391 | 286 |
| 49 | 3300037853 | Ga0436364_0519106 | Ga0436364_0519106_3777_4667 | 286 |
| 50 | 3300039437 | Ga0436365_0598358 | Ga0436365_0598358_2794_3678 | 286 |
| 51 | 3300039437 | Ga0436365_1157171 | Ga0436365_1157171_310_1194 | 286 |
| 52 | 3300049822 | Ga0501035_0082184 | Ga0501035_0082184_736_1620 | 286 |
| 53 | 3300050510 | nmdc:mga06r32_226118_c1 | nmdc:mga06r32_226118_c1_854_1753 | 286 |
| 54 | 3300050510 | nmdc:mga06r32_4186_c1 | nmdc:mga06r32_4186_c1_2053_2952 | 286 |
| 55 | 3300050512 | nmdc:mga0n895_10504_c1 | nmdc:mga0n895_10504_c1_7196_8095 | 286 |
| 56 | 3300050512 | nmdc:mga0n895_432099_c1 | nmdc:mga0n895_432099_c1_213_1103 | 286 |
| 57 | 3300050515 | nmdc:mga0a205_67781_c1 | nmdc:mga0a205_67781_c1_840_1739 | 286 |
| 58 | 3300053103 | Ga0500555_005419 | Ga0500555_005419_898_1797 | 286 |
| 59 | 3300054114 | Ga0501084_0073204 | Ga0501084_0073204_188_1087 | 286 |
| 60 | 3300005340 | Ga0070689_100305301 | Ga0070689_1003053012 | 287 |
| 61 | 3300005445 | Ga0070708_100024226 | Ga0070708_1000242262 | 287 |
| 62 | 3300005467 | Ga0070706_100003347 | Ga0070706_1000033471 | 287 |
| 63 | 3300005471 | Ga0070698_100062534 | Ga0070698_1000625343 | 287 |
| 64 | 3300005471 | Ga0070698_100121572 | Ga0070698_1001215722 | 287 |
| 65 | 3300005518 | Ga0070699_100097717 | Ga0070699_1000977172 | 287 |
| 66 | 3300005536 | Ga0070697_100118102 | Ga0070697_1001181023 | 287 |
| 67 | 3300005549 | Ga0070704_100081590 | Ga0070704_1000815902 | 287 |
| 68 | 3300005617 | Ga0068859_100548158 | Ga0068859_1005481581 | 287 |
| 69 | 3300006237 | Ga0097621_100049399 | Ga0097621_1000493992 | 287 |
| 70 | 3300006847 | Ga0075431_100289157 | Ga0075431_1002891573 | 287 |
| 71 | 3300006852 | Ga0075433_10031635 | Ga0075433_100316354 | 287 |
| 72 | 3300006871 | Ga0075434_100087373 | Ga0075434_1000873732 | 287 |
| 73 | 3300006871 | Ga0075434_100154116 | Ga0075434_1001541161 | 287 |
| 74 | 3300006871 | Ga0075434_100215652 | Ga0075434_1002156523 | 287 |
| 75 | 3300006931 | Ga0097620_100548229 | Ga0097620_1005482291 | 287 |
| 76 | 3300007076 | Ga0075435_100071994 | Ga0075435_1000719942 | 287 |
| 77 | 3300007076 | Ga0075435_100243207 | Ga0075435_1002432072 | 287 |
| 78 | 3300009094 | Ga0111539_10459229 | Ga0111539_104592292 | 287 |
| 79 | 3300009098 | Ga0105245_10060639 | Ga0105245_100606393 | 287 |
| 80 | 3300009553 | Ga0105249_10245456 | Ga0105249_102454561 | 287 |
| 81 | 3300013296 | Ga0157374_10000216 | Ga0157374_1000021636 | 287 |
| 82 | 3300013306 | Ga0163162_10053098 | Ga0163162_100530982 | 287 |
| 83 | 3300014968 | Ga0157379_10328020 | Ga0157379_103280201 | 287 |
| 84 | 3300014969 | Ga0157376_10000416 | Ga0157376_1000041624 | 287 |
| 85 | 3300025910 | Ga0207684_10000705 | Ga0207684_1000070516 | 287 |
| 86 | 3300025910 | Ga0207684_10125067 | Ga0207684_101250673 | 287 |
| 87 | 3300025910 | Ga0207684_10431351 | Ga0207684_104313511 | 287 |
| 88 | 3300025913 | Ga0207695_10000505 | Ga0207695_1000050524 | 287 |
| 89 | 3300025922 | Ga0207646_10056740 | Ga0207646_100567402 | 287 |
| 90 | 3300025961 | Ga0207712_10248930 | Ga0207712_102489301 | 287 |
| 91 | 3300026075 | Ga0207708_10227778 | Ga0207708_102277782 | 287 |
| 92 | 3300027907 | Ga0207428_10056007 | Ga0207428_100560075 | 287 |
| 93 | 3300028381 | Ga0268264_10179120 | Ga0268264_101791201 | 287 |
| 94 | 3300028558 | Ga0265326_10001797 | Ga0265326_100017973 | 287 |
| 95 | 3300028577 | Ga0265318_10043131 | Ga0265318_100431312 | 287 |
| 96 | 3300028666 | Ga0265336_10060744 | Ga0265336_100607441 | 287 |
| 97 | 3300028800 | Ga0265338_10006810 | Ga0265338_100068106 | 287 |
| 98 | 3300031090 | Ga0265760_10010568 | Ga0265760_100105682 | 287 |
| 99 | 3300031240 | Ga0265320_10075598 | Ga0265320_100755981 | 287 |
| 100 | 3300031344 | Ga0265316_10007212 | Ga0265316_100072128 | 287 |
| 101 | 3300035692 | Ga0373935_0057759 | Ga0373935_0057759_1280_2173 | 287 |
| 102 | 3300035725 | Ga0373947_0244610 | Ga0373947_0244610_159_1052 | 287 |
| 103 | 3300039437 | Ga0436365_0098766 | Ga0436365_0098766_8293_9180 | 287 |
| 104 | 3300044684 | Ga0466966_0013527 | Ga0466966_0013527_841_1731 | 287 |
| 105 | 3300044901 | Ga0466960_0016970 | Ga0466960_0016970_1143_2033 | 287 |
| 106 | 3300045836 | Ga0466958_0108122 | Ga0466958_0108122_393_1283 | 287 |
| 107 | 3300048929 | Ga0496126_0232551 | Ga0496126_0232551_352_1245 | 287 |
| 108 | 3300049823 | Ga0501044_0300640 | Ga0501044_0300640_603_1496 | 287 |
| 109 | 3300050507 | nmdc:mga05p37_125109_c1 | nmdc:mga05p37_125109_c1_1317_2210 | 287 |
| 110 | 3300050508 | nmdc:mga09592_89188_c1 | nmdc:mga09592_89188_c1_1480_2388 | 287 |
| 111 | 3300050510 | nmdc:mga06r32_126793_c1 | nmdc:mga06r32_126793_c1_66_974 | 287 |
| 112 | 3300050511 | nmdc:mga08y16_50671_c1 | nmdc:mga08y16_50671_c1_3148_4035 | 287 |
| 113 | 3300050512 | nmdc:mga0n895_279583_c1 | nmdc:mga0n895_279583_c1_260_1168 | 287 |
| 114 | 3300050513 | nmdc:mga0rr50_345592_c1 | nmdc:mga0rr50_345592_c1_306_1199 | 287 |
| 115 | 3300050515 | nmdc:mga0a205_250044_c1 | nmdc:mga0a205_250044_c1_343_1251 | 287 |
| 116 | 3300005334 | Ga0068869_100355625 | Ga0068869_1003556251 | 288 |
| 117 | 3300005468 | Ga0070707_100348346 | Ga0070707_1003483462 | 288 |
| 118 | 3300005539 | Ga0068853_100000487 | Ga0068853_10000048735 | 288 |
| 119 | 3300005544 | Ga0070686_100136991 | Ga0070686_1001369912 | 288 |
| 120 | 3300005615 | Ga0070702_100204480 | Ga0070702_1002044802 | 288 |
| 121 | 3300005841 | Ga0068863_100625213 | Ga0068863_1006252131 | 288 |
| 122 | 3300005843 | Ga0068860_100655640 | Ga0068860_1006556401 | 288 |
| 123 | 3300006914 | Ga0075436_100359039 | Ga0075436_1003590392 | 288 |
| 124 | 3300007076 | Ga0075435_100478964 | Ga0075435_1004789642 | 288 |
| 125 | 3300009093 | Ga0105240_10261040 | Ga0105240_102610402 | 288 |
| 126 | 3300009551 | Ga0105238_10261965 | Ga0105238_102619652 | 288 |
| 127 | 3300009553 | Ga0105249_10268608 | Ga0105249_102686082 | 288 |
| 128 | 3300011119 | Ga0105246_10149752 | Ga0105246_101497521 | 288 |
| 129 | 3300014325 | Ga0163163_10427611 | Ga0163163_104276112 | 288 |
| 130 | 3300014968 | Ga0157379_10066822 | Ga0157379_100668223 | 288 |
| 131 | 3300025911 | Ga0207654_10001730 | Ga0207654_100017302 | 288 |
| 132 | 3300025913 | Ga0207695_10068870 | Ga0207695_100688702 | 288 |
| 133 | 3300025937 | Ga0207669_10250297 | Ga0207669_102502972 | 288 |
| 134 | 3300026041 | Ga0207639_10000357 | Ga0207639_1000035738 | 288 |
| 135 | 3300039447 | Ga0436361_0186542 | Ga0436361_0186542_65_967 | 288 |
| 136 | 3300048913 | Ga0496110_0218565 | Ga0496110_0218565_548_1462 | 288 |
| 137 | 3300049583 | Ga0501067_0029494 | Ga0501067_0029494_486_1385 | 288 |
| 138 | 3300005347 | Ga0070668_100012879 | Ga0070668_1000128795 | 289 |
| 139 | 3300005354 | Ga0070675_100230815 | Ga0070675_1002308151 | 289 |
| 140 | 3300005364 | Ga0070673_100181682 | Ga0070673_1001816822 | 289 |
| 141 | 3300005468 | Ga0070707_100165498 | Ga0070707_1001654982 | 289 |
| 142 | 3300005543 | Ga0070672_100002856 | Ga0070672_1000028562 | 289 |
| 143 | 3300005544 | Ga0070686_100002262 | Ga0070686_1000022624 | 289 |
| 144 | 3300005548 | Ga0070665_100357526 | Ga0070665_1003575262 | 289 |
| 145 | 3300006195 | Ga0075366_10088342 | Ga0075366_100883422 | 289 |
| 146 | 3300009553 | Ga0105249_10000245 | Ga0105249_1000024520 | 289 |
| 147 | 3300014969 | Ga0157376_10327390 | Ga0157376_103273902 | 289 |
| 148 | 3300016635 | Ga0183361_10002 | Ga0183361_10002707 | 289 |
| 149 | 3300025940 | Ga0207691_10003645 | Ga0207691_100036458 | 289 |
| 150 | 3300025960 | Ga0207651_10373836 | Ga0207651_103738361 | 289 |
| 151 | 3300025961 | Ga0207712_10000086 | Ga0207712_1000008638 | 289 |
| 152 | 3300025972 | Ga0207668_10011180 | Ga0207668_100111803 | 289 |
| 153 | 3300028379 | Ga0268266_10309237 | Ga0268266_103092372 | 289 |
| 154 | 3300006914 | Ga0075436_100011307 | Ga0075436_1000113076 | 290 |
| 155 | 3300014325 | Ga0163163_10324570 | Ga0163163_103245702 | 290 |
| 156 | 3300025298 | Ga0209050_1001860 | Ga0209050_100186010 | 290 |
| 157 | 3300044656 | Ga0466969_0015191 | Ga0466969_0015191_259_1137 | 290 |
| 158 | 3300050507 | nmdc:mga05p37_648607_c1 | nmdc:mga05p37_648607_c1_225_1133 | 290 |
| 159 | 3300050514 | nmdc:mga08x19_56723_c1 | nmdc:mga08x19_56723_c1_1602_2480 | 290 |
| 160 | 3300002737 | JGI25162J39368_1000255 | JGI25162J39368_100025523 | 291 |
| 161 | 3300002741 | JGI25157J39369_1000456 | JGI25157J39369_10004566 | 291 |
| 162 | 3300002771 | JGI25163J39215_1000635 | JGI25163J39215_10006356 | 291 |
| 163 | 3300002772 | JGI25164J39214_1000388 | JGI25164J39214_100038823 | 291 |
| 164 | 3300003214 | JGI25165J46597_1000144 | JGI25165J46597_100014423 | 291 |
| 165 | 3300003761 | Ga0055535_1000061 | Ga0055535_100006180 | 291 |
| 166 | 3300003762 | Ga0055542_1000099 | Ga0055542_100009923 | 291 |
| 167 | 3300003763 | Ga0055529_1000117 | Ga0055529_100011723 | 291 |
| 168 | 3300005262 | Ga0065165_1000383 | Ga0065165_100038330 | 291 |
| 169 | 3300005327 | Ga0070658_10215019 | Ga0070658_102150192 | 291 |
| 170 | 3300005563 | Ga0068855_100017683 | Ga0068855_1000176834 | 291 |
| 171 | 3300005563 | Ga0068855_100685868 | Ga0068855_1006858682 | 291 |
| 172 | 3300010375 | Ga0105239_10357471 | Ga0105239_103574711 | 291 |
| 173 | 3300025206 | Ga0209435_103176 | Ga0209435_1031762 | 291 |
| 174 | 3300025207 | Ga0209760_100503 | Ga0209760_1005034 | 291 |
| 175 | 3300025224 | Ga0209784_100043 | Ga0209784_10004399 | 291 |
| 176 | 3300025228 | Ga0209672_105974 | Ga0209672_1059741 | 291 |
| 177 | 3300025231 | Ga0207427_100087 | Ga0207427_10008799 | 291 |
| 178 | 3300025233 | Ga0209437_100173 | Ga0209437_10017399 | 291 |
| 179 | 3300025242 | Ga0209258_100092 | Ga0209258_100092170 | 291 |
| 180 | 3300025246 | Ga0209646_1000439 | Ga0209646_100043911 | 291 |
| 181 | 3300025250 | Ga0209026_1000112 | Ga0209026_100011299 | 291 |
| 182 | 3300025254 | Ga0209148_1000047 | Ga0209148_1000047367 | 291 |
| 183 | 3300025256 | Ga0209759_1000597 | Ga0209759_100059723 | 291 |
| 184 | 3300025261 | Ga0209233_1000179 | Ga0209233_1000179100 | 291 |
| 185 | 3300025272 | Ga0209455_1000056 | Ga0209455_1000056291 | 291 |
| 186 | 3300025284 | Ga0209130_1004650 | Ga0209130_10046504 | 291 |
| 187 | 3300025302 | Ga0207426_1000004 | Ga0207426_1000004394 | 291 |
| 188 | 3300025949 | Ga0207667_10003622 | Ga0207667_100036224 | 291 |
| 189 | 3300025949 | Ga0207667_10044098 | Ga0207667_100440982 | 291 |
| 190 | 3300026067 | Ga0207678_10002107 | Ga0207678_100021079 | 291 |
| 191 | 3300031711 | Ga0265314_10016728 | Ga0265314_100167283 | 291 |
| 192 | 3300037068 | Ga0373925_0068193 | Ga0373925_0068193_644_1528 | 291 |
| 193 | 3300039437 | Ga0436365_1893862 | Ga0436365_1893862_171_1094 | 291 |
| 194 | 3300044693 | Ga0466961_0176588 | Ga0466961_0176588_211_1089 | 291 |
| 195 | 3300045049 | Ga0466959_0010752 | Ga0466959_0010752_2893_3771 | 291 |
| 196 | 3300048903 | Ga0496100_0000020 | Ga0496100_0000020_31133_32014 | 291 |
| 197 | 3300048904 | Ga0496101_0000045 | Ga0496101_0000045_125334_126215 | 291 |
| 198 | 3300048905 | Ga0496102_0000589 | Ga0496102_0000589_6430_7311 | 291 |
| 199 | 3300048906 | Ga0496103_0000264 | Ga0496103_0000264_30553_31434 | 291 |
| 200 | 3300048915 | Ga0496112_0184830 | Ga0496112_0184830_395_1276 | 291 |
| 201 | 3300048919 | Ga0496116_0074789 | Ga0496116_0074789_1091_1972 | 291 |
| 202 | 3300048920 | Ga0496117_0000293 | Ga0496117_0000293_31202_32083 | 291 |
| 203 | 3300048921 | Ga0496118_0000411 | Ga0496118_0000411_31206_32087 | 291 |
| 204 | 3300048922 | Ga0496119_0013344 | Ga0496119_0013344_1666_2547 | 291 |
| 205 | 3300048924 | Ga0496121_0000765 | Ga0496121_0000765_29826_30707 | 291 |
| 206 | 3300048929 | Ga0496126_0060181 | Ga0496126_0060181_2250_3131 | 291 |
| 207 | 3300049744 | Ga0501083_0139143 | Ga0501083_0139143_516_1397 | 291 |
| 208 | 3300054114 | Ga0501084_0373874 | Ga0501084_0373874_31_942 | 291 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8hnq-assembly1.cif.gz_A | the structure of a alcohol dehydrogenase akr13b2 with nadp | 0.8972 | 2 | 281 |
| 8hnq-assembly1.cif.gz_A | the structure of a alcohol dehydrogenase akr13b2 with nadp | 0.876 | 2 | 281 |
| 4xap-assembly1.cif.gz_A | crystal structure of aldo-keto reductase from sinorhizobium meliloti 1021 | 0.8604 | 1 | 283 |
| 3up8-assembly2.cif.gz_B | crystal structure of a putative 2,5-diketo-d-gluconic acid reductase b | 0.8523 | 6 | 284 |
| 3v0u-assembly1.cif.gz_A | crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding | 0.8509 | 11 | 284 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P25906_7_286_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9771 | 9 | 286 | 3.20.20.100 |
| af_P25906_7_286_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9668 | 9 | 286 | 3.20.20.100 |
| af_O94315_19_306_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.8979 | 15 | 290 | 3.20.20.100 |
| af_F4HPY8_8_325_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.8661 | 14 | 288 | 3.20.20.100 |
| 4xapA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.8604 | 1 | 283 | 3.20.20.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4P1ALL5-F1-model_v4 | deleted | 0.9906 | 159 | 284 |
|
| AF-A0A379LU18-F1-model_v4 | Oxidoreductase YdbC (EC 1.-.-.-) | 0.9904 | 45 | 283 |
GO:0005829
GO:0016491 |
| AF-A0A3A8J7T9-F1-model_v4 | Oxidoreductase | 0.9878 | 63 | 190 |
GO:0005829
|
| AF-A0A0K4T6T7-F1-model_v4 | deleted | 0.986 | 51 | 286 |
|
| AF-A0A529NSE1-F1-model_v4 | Oxidoreductase | 0.9856 | 63 | 265 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar