F317993

General Info

Members Datasets Scaffolds Average Seq Length
208 157 207 298

Family's Representative Sequence

Representative Sequence 3300031090|Ga0265760_10010568|Ga0265760_100105682
Length 304
Sequence MTKQAKLGGAFMFSGTGMTVNRMGYGAMQLAGPGVWGPPRDREAAVSVLREAVAAGVNHIDTSDYYGPHVTNQIIKEALHPYADGLVIVTKVGARRGPDKSWLHARSRQDVIDAVHDNLRNLGVEAIDVVNLRVGGMMGPEEGSIEEPMTALAELKGKGLIRQLGLSNVNRKQLAEAQAITEIVCVQNFYNVAHREDDGFIDALAKQGIAYVPFFPLGGFTPLQSSVLDEAAATLGVTAMQVALAWLLQRSPNVLLIPGTSSVKHLRENLAAATLKIPEGILGELNSIGSAHGEGKHSPVAVAK

Samples

Sample ID Description Type Environment
1 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
4 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
5 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
8 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
9 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
65 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
66 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
67 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
68 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
70 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
71 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
74 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
75 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
77 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
78 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
80 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
81 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
83 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
85 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
109 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
110 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
111 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
112 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
113 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
114 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
116 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
117 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
118 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
119 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
120 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
121 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
123 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
124 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
125 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
126 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
127 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
128 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
129 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
130 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
131 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
132 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
133 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
134 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
135 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
136 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
137 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
138 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
139 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
140 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
141 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
142 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
143 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
144 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
145 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
146 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
148 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
149 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
150 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
151 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
152 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
153 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
154 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
155 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
156 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
157 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.08
Metatranscriptomes 1.44
Isolates 0.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.58
Nodule 0
Rhizoplane 3.37
Rhizosphere 75.96
Stem 0
Stem Tuber 0
Unclassified 10.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000255 3300002737 Bacteria 50867
2 JGI25157J39369_1000456 3300002741 Bacteria 25889
3 JGI25163J39215_1000635 3300002771 Bacteria 9555
4 JGI25164J39214_1000388 3300002772 Bacteria 25913
5 JGI25165J46597_1000144 3300003214 Bacteria 117624
6 Ga0055535_1000061 3300003761 Bacteria 117624
7 Ga0055542_1000099 3300003762 Bacteria 117624
8 Ga0055529_1000117 3300003763 Bacteria 117613
9 Ga0065165_1000383 3300005262 Bacteria 71804
10 Ga0070658_10215019 3300005327 Bacteria 1624
11 Ga0068869_100355625 3300005334 Bacteria 1195
12 Ga0068868_100016785 3300005338 Bacteria 5445
13 Ga0070689_100305301 3300005340 Bacteria 1325
14 Ga0070668_100012879 3300005347 Bacteria 6227
15 Ga0070675_100230815 3300005354 Bacteria 1614
16 Ga0070673_100181682 3300005364 Bacteria 1801
17 Ga0070709_10000004 3300005434 Bacteria 214262
18 Ga0070713_100596636 3300005436 Bacteria 1049
19 Ga0070708_100024226 3300005445 Bacteria 5173
20 Ga0070706_100003347 3300005467 Bacteria 15809
21 Ga0070707_100165498 3300005468 Bacteria 2155
22 Ga0070707_100348346 3300005468 Bacteria 1439
23 Ga0070698_100062534 3300005471 Bacteria 3756
24 Ga0070698_100121572 3300005471 Bacteria 2571
25 Ga0070699_100097717 3300005518 Bacteria 2572
26 Ga0070679_100005317 3300005530 Bacteria 11917
27 Ga0070697_100118102 3300005536 Bacteria 2216
28 Ga0068853_100000487 3300005539 Bacteria 27038
29 Ga0068853_100061359 3300005539 Bacteria 3252
30 Ga0070672_100002856 3300005543 Bacteria 11086
31 Ga0070686_100002262 3300005544 Bacteria 10618
32 Ga0070686_100136991 3300005544 Bacteria 1700
33 Ga0070665_100000024 3300005548 Bacteria 374559
34 Ga0070665_100357526 3300005548 Bacteria 1466
35 Ga0070704_100081590 3300005549 Bacteria 2382
36 Ga0068855_100017683 3300005563 Bacteria 8574
37 Ga0068855_100685868 3300005563 Bacteria 1097
38 Ga0070702_100204480 3300005615 Bacteria 1310
39 Ga0068859_100548158 3300005617 Bacteria 1251
40 Ga0068863_100625213 3300005841 Bacteria 1067
41 Ga0068860_100655640 3300005843 Bacteria 1058
42 Ga0081455_10005321 3300005937 Bacteria 14133
43 Ga0081539_10004666 3300005985 Bacteria 14895
44 Ga0070716_100348805 3300006173 Bacteria 1047
45 Ga0075366_10088342 3300006195 Bacteria 1856
46 Ga0097621_100049399 3300006237 Bacteria 3417
47 Ga0068871_100041771 3300006358 Unclassified 3679
48 Ga0068871_100414744 3300006358 Bacteria 1201
49 Ga0075428_100143143 3300006844 Bacteria 2599
50 Ga0075431_100120550 3300006847 Bacteria 2706
51 Ga0075431_100289157 3300006847 Bacteria 1658
52 Ga0075431_100360424 3300006847 Bacteria 1460
53 Ga0075433_10031635 3300006852 Bacteria 4524
54 Ga0075433_10309490 3300006852 Bacteria 1398
55 Ga0075434_100046141 3300006871 Bacteria 4324
56 Ga0075434_100087373 3300006871 Bacteria 3118
57 Ga0075434_100154116 3300006871 Bacteria 2318
58 Ga0075434_100215652 3300006871 Bacteria 1939
59 Ga0075436_100011307 3300006914 Bacteria 6123
60 Ga0075436_100359039 3300006914 Bacteria 1051
61 Ga0097620_100548229 3300006931 Bacteria 1251
62 Ga0075435_100071994 3300007076 Bacteria 2823
63 Ga0075435_100243207 3300007076 Bacteria 1531
64 Ga0075435_100478964 3300007076 Bacteria 1075
65 Ga0105240_10261040 3300009093 Bacteria 1998
66 Ga0111539_10459229 3300009094 Bacteria 1483
67 Ga0105245_10000977 3300009098 Bacteria 26118
68 Ga0105245_10060639 3300009098 Bacteria 3407
69 Ga0105242_10059416 3300009176 Bacteria 3137
70 Ga0105237_10000419 3300009545 Bacteria 60567
71 Ga0105238_10138608 3300009551 Bacteria 2410
72 Ga0105238_10261965 3300009551 Bacteria 1708
73 Ga0105238_10788926 3300009551 Bacteria 965
74 Ga0105249_10000245 3300009553 Bacteria 60260
75 Ga0105249_10245456 3300009553 Bacteria 1772
76 Ga0105249_10268608 3300009553 Bacteria 1698
77 Ga0105239_10357471 3300010375 Bacteria 1649
78 Ga0105246_10149752 3300011119 Bacteria 1765
79 Ga0157374_10000216 3300013296 Bacteria 53208
80 Ga0163162_10053098 3300013306 Bacteria 4072
81 Ga0163163_10324570 3300014325 Bacteria 1593
82 Ga0163163_10427611 3300014325 Bacteria 1383
83 Ga0157379_10066822 3300014968 Bacteria 3215
84 Ga0157379_10328020 3300014968 Bacteria 1398
85 Ga0157376_10000416 3300014969 Bacteria 27769
86 Ga0157376_10327390 3300014969 Bacteria 1459
87 Ga0183361_10002 3300016635 Bacteria 907642
88 Ga0213872_10019769 3300021361 Bacteria 3102
89 Ga0213876_10013284 3300021384 Bacteria 4376
90 Ga0213875_10019478 3300021388 Bacteria 3264
91 Ga0224712_10020525 3300022467 Bacteria 2245
92 Ga0209435_103176 3300025206 Bacteria 1884
93 Ga0209760_100503 3300025207 Bacteria 8243
94 Ga0209784_100043 3300025224 Bacteria 217823
95 Ga0209672_105974 3300025228 Bacteria 2031
96 Ga0207427_100087 3300025231 Bacteria 140098
97 Ga0209437_100173 3300025233 Bacteria 140098
98 Ga0209258_100092 3300025242 Bacteria 226544
99 Ga0209646_1000439 3300025246 Bacteria 22592
100 Ga0209026_1000112 3300025250 Bacteria 140098
101 Ga0209148_1000047 3300025254 Bacteria 434369
102 Ga0209759_1000597 3300025256 Bacteria 34955
103 Ga0209233_1000179 3300025261 Bacteria 140518
104 Ga0209455_1000056 3300025272 Bacteria 349821
105 Ga0209130_1004650 3300025284 Bacteria 5100
106 Ga0209050_1001860 3300025298 Bacteria 20346
107 Ga0207426_1000004 3300025302 Bacteria 1047900
108 Ga0207684_10000705 3300025910 Bacteria 39440
109 Ga0207684_10125067 3300025910 Bacteria 2206
110 Ga0207684_10431351 3300025910 Bacteria 1132
111 Ga0207654_10001730 3300025911 Bacteria 11358
112 Ga0207695_10000505 3300025913 Bacteria 82918
113 Ga0207695_10068870 3300025913 Bacteria 3624
114 Ga0207671_10000089 3300025914 Bacteria 140114
115 Ga0207663_10299947 3300025916 Bacteria 1200
116 Ga0207652_10029481 3300025921 Bacteria 4589
117 Ga0207646_10056740 3300025922 Bacteria 3500
118 Ga0207687_10001767 3300025927 Bacteria 14869
119 Ga0207669_10250297 3300025937 Bacteria 1319
120 Ga0207665_10075622 3300025939 Bacteria 2307
121 Ga0207691_10003645 3300025940 Bacteria 14936
122 Ga0207667_10003622 3300025949 Bacteria 19060
123 Ga0207667_10044098 3300025949 Bacteria 4728
124 Ga0207651_10373836 3300025960 Bacteria 1206
125 Ga0207712_10000086 3300025961 Bacteria 107484
126 Ga0207712_10248930 3300025961 Bacteria 1435
127 Ga0207668_10011180 3300025972 Bacteria 5448
128 Ga0207677_10009600 3300026023 Bacteria 5445
129 Ga0207639_10000357 3300026041 Bacteria 31603
130 Ga0207639_10175569 3300026041 Bacteria 1818
131 Ga0207678_10002107 3300026067 Bacteria 18018
132 Ga0207708_10227778 3300026075 Bacteria 1495
133 Ga0207641_10001826 3300026088 Bacteria 20485
134 Ga0207428_10056007 3300027907 Bacteria 3133
135 Ga0268266_10000019 3300028379 Bacteria 556465
136 Ga0268266_10309237 3300028379 Bacteria 1476
137 Ga0268264_10179120 3300028381 Bacteria 1923
138 Ga0265337_1000083 3300028556 Bacteria 45573
139 Ga0265326_10001797 3300028558 Bacteria 7396
140 Ga0265319_1034292 3300028563 Bacteria 1747
141 Ga0265318_10015058 3300028577 Bacteria 3228
142 Ga0265318_10043131 3300028577 Bacteria 1710
143 Ga0265336_10060744 3300028666 Bacteria 1134
144 Ga0265338_10006810 3300028800 Bacteria 14396
145 Ga0265338_10048853 3300028800 Bacteria 3844
146 Ga0265760_10002063 3300031090 Bacteria 5914
147 Ga0265760_10010568 3300031090 Bacteria 2637
148 Ga0265320_10075598 3300031240 Bacteria 1580
149 Ga0265316_10007212 3300031344 Bacteria 10499
150 Ga0265316_10152083 3300031344 Bacteria 1733
151 Ga0265314_10016728 3300031711 Bacteria 5780
152 Ga0265342_10070339 3300031712 Bacteria 2042
153 Ga0373935_0057759 3300035692 Bacteria 2476
154 Ga0373947_0244610 3300035725 Bacteria 1185
155 Ga0373925_0068193 3300037068 Bacteria 2684
156 Ga0436364_0519106 3300037853 Bacteria 8345
157 Ga0436365_0098766 3300039437 Bacteria 9872
158 Ga0436365_0598358 3300039437 Bacteria 3949
159 Ga0436365_0722592 3300039437 Bacteria 22222
160 Ga0436365_1157171 3300039437 Bacteria 4814
161 Ga0436365_1893862 3300039437 Bacteria 1867
162 Ga0436361_0186542 3300039447 Bacteria 2019
163 Ga0436361_0957178 3300039447 Bacteria 3104
164 Ga0466969_0015191 3300044656 Bacteria 4036
165 Ga0466966_0013527 3300044684 Bacteria 5402
166 Ga0466961_0176588 3300044693 Bacteria 1327
167 Ga0466960_0016970 3300044901 Bacteria 3167
168 Ga0466959_0010752 3300045049 Bacteria 6557
169 Ga0466959_0046414 3300045049 Bacteria 3197
170 Ga0466958_0108122 3300045836 Bacteria 1735
171 Ga0496100_0000020 3300048903 Bacteria 147250
172 Ga0496101_0000045 3300048904 Bacteria 157340
173 Ga0496102_0000589 3300048905 Bacteria 38406
174 Ga0496103_0000264 3300048906 Bacteria 50288
175 Ga0496110_0218565 3300048913 Bacteria 1733
176 Ga0496112_0184830 3300048915 Bacteria 2048
177 Ga0496114_0029166 3300048917 Bacteria 4533
178 Ga0496116_0074789 3300048919 Bacteria 2129
179 Ga0496117_0000293 3300048920 Bacteria 89946
180 Ga0496118_0000411 3300048921 Bacteria 71545
181 Ga0496119_0013344 3300048922 Bacteria 6560
182 Ga0496121_0000765 3300048924 Bacteria 59004
183 Ga0496126_0060181 3300048929 Bacteria 3417
184 Ga0496126_0232551 3300048929 Bacteria 1544
185 Ga0501067_0029494 3300049583 Bacteria 3041
186 Ga0501067_0070872 3300049583 Bacteria 1930
187 Ga0501083_0139143 3300049744 Bacteria 1590
188 Ga0501035_0082184 3300049822 Bacteria 2843
189 Ga0501044_0300640 3300049823 Bacteria 1534
190 nmdc:mga05p37_125109_c1 3300050507 Bacteria 3157
191 nmdc:mga05p37_648607_c1 3300050507 Bacteria 1183
192 nmdc:mga09592_89188_c1 3300050508 Bacteria 2634
193 nmdc:mga06r32_126793_c1 3300050510 Bacteria 2522
194 nmdc:mga06r32_226118_c1 3300050510 Bacteria 1860
195 nmdc:mga06r32_4186_c1 3300050510 Bacteria 12924
196 nmdc:mga08y16_50671_c1 3300050511 Bacteria 4345
197 nmdc:mga0n895_10504_c1 3300050512 Bacteria 8189
198 nmdc:mga0n895_279583_c1 3300050512 Bacteria 1693
199 nmdc:mga0n895_344950_c1 3300050512 Bacteria 1508
200 nmdc:mga0n895_432099_c1 3300050512 Bacteria 1330
201 nmdc:mga0rr50_345592_c1 3300050513 Bacteria 1250
202 nmdc:mga08x19_56723_c1 3300050514 Bacteria 2529
203 nmdc:mga0a205_250044_c1 3300050515 Bacteria 1653
204 nmdc:mga0a205_67781_c1 3300050515 Bacteria 3447
205 Ga0500555_005419 3300053103 Bacteria 3618
206 Ga0501084_0073204 3300054114 Bacteria 2869
207 Ga0501084_0373874 3300054114 Bacteria 1204

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050512 nmdc:mga0n895_344950_c1 nmdc:mga0n895_344950_c1_716_1495 258
2 3300005338 Ga0068868_100016785 Ga0068868_1000167852 277
3 3300006358 Ga0068871_100041771 Ga0068871_1000417712 277
4 3300009176 Ga0105242_10059416 Ga0105242_100594163 277
5 3300026023 Ga0207677_10009600 Ga0207677_100096002 277
6 3300006847 Ga0075431_100360424 Ga0075431_1003604242 280
7 3300006852 Ga0075433_10309490 Ga0075433_103094901 280
8 3300022467 Ga0224712_10020525 Ga0224712_100205252 280
9 3300049583 Ga0501067_0070872 Ga0501067_0070872_936_1814 280
10 3300005434 Ga0070709_10000004 Ga0070709_100000045 282
11 3300005436 Ga0070713_100596636 Ga0070713_1005966361 282
12 3300005539 Ga0068853_100061359 Ga0068853_1000613594 283
13 3300009551 Ga0105238_10788926 Ga0105238_107889261 283
14 3300025939 Ga0207665_10075622 Ga0207665_100756223 283
15 3300026041 Ga0207639_10175569 Ga0207639_101755692 283
16 3300026088 Ga0207641_10001826 Ga0207641_1000182618 283
17 3300039437 Ga0436365_0722592 Ga0436365_0722592_17604_18479 283
18 3300048917 Ga0496114_0029166 Ga0496114_0029166_2084_2965 284
19 iso_pu_bacteria 2751185821 2753459353 284
20 3300006173 Ga0070716_100348805 Ga0070716_1003488051 285
21 3300006358 Ga0068871_100414744 Ga0068871_1004147442 285
22 3300009098 Ga0105245_10000977 Ga0105245_100009774 285
23 3300021361 Ga0213872_10019769 Ga0213872_100197693 285
24 3300025927 Ga0207687_10001767 Ga0207687_100017674 285
25 3300028556 Ga0265337_1000083 Ga0265337_100008330 285
26 3300031090 Ga0265760_10002063 Ga0265760_100020633 285
27 3300039447 Ga0436361_0957178 Ga0436361_0957178_560_1465 285
28 3300045049 Ga0466959_0046414 Ga0466959_0046414_749_1642 285
29 3300005530 Ga0070679_100005317 Ga0070679_1000053173 286
30 3300005548 Ga0070665_100000024 Ga0070665_100000024206 286
31 3300005937 Ga0081455_10005321 Ga0081455_100053216 286
32 3300005985 Ga0081539_10004666 Ga0081539_100046663 286
33 3300006844 Ga0075428_100143143 Ga0075428_1001431431 286
34 3300006847 Ga0075431_100120550 Ga0075431_1001205503 286
35 3300006871 Ga0075434_100046141 Ga0075434_1000461411 286
36 3300009545 Ga0105237_10000419 Ga0105237_1000041935 286
37 3300009551 Ga0105238_10138608 Ga0105238_101386081 286
38 3300021384 Ga0213876_10013284 Ga0213876_100132844 286
39 3300021388 Ga0213875_10019478 Ga0213875_100194784 286
40 3300025914 Ga0207671_10000089 Ga0207671_10000089100 286
41 3300025916 Ga0207663_10299947 Ga0207663_102999472 286
42 3300025921 Ga0207652_10029481 Ga0207652_100294817 286
43 3300028379 Ga0268266_10000019 Ga0268266_10000019159 286
44 3300028563 Ga0265319_1034292 Ga0265319_10342922 286
45 3300028577 Ga0265318_10015058 Ga0265318_100150582 286
46 3300028800 Ga0265338_10048853 Ga0265338_100488531 286
47 3300031344 Ga0265316_10152083 Ga0265316_101520831 286
48 3300031712 Ga0265342_10070339 Ga0265342_100703391 286
49 3300037853 Ga0436364_0519106 Ga0436364_0519106_3777_4667 286
50 3300039437 Ga0436365_0598358 Ga0436365_0598358_2794_3678 286
51 3300039437 Ga0436365_1157171 Ga0436365_1157171_310_1194 286
52 3300049822 Ga0501035_0082184 Ga0501035_0082184_736_1620 286
53 3300050510 nmdc:mga06r32_226118_c1 nmdc:mga06r32_226118_c1_854_1753 286
54 3300050510 nmdc:mga06r32_4186_c1 nmdc:mga06r32_4186_c1_2053_2952 286
55 3300050512 nmdc:mga0n895_10504_c1 nmdc:mga0n895_10504_c1_7196_8095 286
56 3300050512 nmdc:mga0n895_432099_c1 nmdc:mga0n895_432099_c1_213_1103 286
57 3300050515 nmdc:mga0a205_67781_c1 nmdc:mga0a205_67781_c1_840_1739 286
58 3300053103 Ga0500555_005419 Ga0500555_005419_898_1797 286
59 3300054114 Ga0501084_0073204 Ga0501084_0073204_188_1087 286
60 3300005340 Ga0070689_100305301 Ga0070689_1003053012 287
61 3300005445 Ga0070708_100024226 Ga0070708_1000242262 287
62 3300005467 Ga0070706_100003347 Ga0070706_1000033471 287
63 3300005471 Ga0070698_100062534 Ga0070698_1000625343 287
64 3300005471 Ga0070698_100121572 Ga0070698_1001215722 287
65 3300005518 Ga0070699_100097717 Ga0070699_1000977172 287
66 3300005536 Ga0070697_100118102 Ga0070697_1001181023 287
67 3300005549 Ga0070704_100081590 Ga0070704_1000815902 287
68 3300005617 Ga0068859_100548158 Ga0068859_1005481581 287
69 3300006237 Ga0097621_100049399 Ga0097621_1000493992 287
70 3300006847 Ga0075431_100289157 Ga0075431_1002891573 287
71 3300006852 Ga0075433_10031635 Ga0075433_100316354 287
72 3300006871 Ga0075434_100087373 Ga0075434_1000873732 287
73 3300006871 Ga0075434_100154116 Ga0075434_1001541161 287
74 3300006871 Ga0075434_100215652 Ga0075434_1002156523 287
75 3300006931 Ga0097620_100548229 Ga0097620_1005482291 287
76 3300007076 Ga0075435_100071994 Ga0075435_1000719942 287
77 3300007076 Ga0075435_100243207 Ga0075435_1002432072 287
78 3300009094 Ga0111539_10459229 Ga0111539_104592292 287
79 3300009098 Ga0105245_10060639 Ga0105245_100606393 287
80 3300009553 Ga0105249_10245456 Ga0105249_102454561 287
81 3300013296 Ga0157374_10000216 Ga0157374_1000021636 287
82 3300013306 Ga0163162_10053098 Ga0163162_100530982 287
83 3300014968 Ga0157379_10328020 Ga0157379_103280201 287
84 3300014969 Ga0157376_10000416 Ga0157376_1000041624 287
85 3300025910 Ga0207684_10000705 Ga0207684_1000070516 287
86 3300025910 Ga0207684_10125067 Ga0207684_101250673 287
87 3300025910 Ga0207684_10431351 Ga0207684_104313511 287
88 3300025913 Ga0207695_10000505 Ga0207695_1000050524 287
89 3300025922 Ga0207646_10056740 Ga0207646_100567402 287
90 3300025961 Ga0207712_10248930 Ga0207712_102489301 287
91 3300026075 Ga0207708_10227778 Ga0207708_102277782 287
92 3300027907 Ga0207428_10056007 Ga0207428_100560075 287
93 3300028381 Ga0268264_10179120 Ga0268264_101791201 287
94 3300028558 Ga0265326_10001797 Ga0265326_100017973 287
95 3300028577 Ga0265318_10043131 Ga0265318_100431312 287
96 3300028666 Ga0265336_10060744 Ga0265336_100607441 287
97 3300028800 Ga0265338_10006810 Ga0265338_100068106 287
98 3300031090 Ga0265760_10010568 Ga0265760_100105682 287
99 3300031240 Ga0265320_10075598 Ga0265320_100755981 287
100 3300031344 Ga0265316_10007212 Ga0265316_100072128 287
101 3300035692 Ga0373935_0057759 Ga0373935_0057759_1280_2173 287
102 3300035725 Ga0373947_0244610 Ga0373947_0244610_159_1052 287
103 3300039437 Ga0436365_0098766 Ga0436365_0098766_8293_9180 287
104 3300044684 Ga0466966_0013527 Ga0466966_0013527_841_1731 287
105 3300044901 Ga0466960_0016970 Ga0466960_0016970_1143_2033 287
106 3300045836 Ga0466958_0108122 Ga0466958_0108122_393_1283 287
107 3300048929 Ga0496126_0232551 Ga0496126_0232551_352_1245 287
108 3300049823 Ga0501044_0300640 Ga0501044_0300640_603_1496 287
109 3300050507 nmdc:mga05p37_125109_c1 nmdc:mga05p37_125109_c1_1317_2210 287
110 3300050508 nmdc:mga09592_89188_c1 nmdc:mga09592_89188_c1_1480_2388 287
111 3300050510 nmdc:mga06r32_126793_c1 nmdc:mga06r32_126793_c1_66_974 287
112 3300050511 nmdc:mga08y16_50671_c1 nmdc:mga08y16_50671_c1_3148_4035 287
113 3300050512 nmdc:mga0n895_279583_c1 nmdc:mga0n895_279583_c1_260_1168 287
114 3300050513 nmdc:mga0rr50_345592_c1 nmdc:mga0rr50_345592_c1_306_1199 287
115 3300050515 nmdc:mga0a205_250044_c1 nmdc:mga0a205_250044_c1_343_1251 287
116 3300005334 Ga0068869_100355625 Ga0068869_1003556251 288
117 3300005468 Ga0070707_100348346 Ga0070707_1003483462 288
118 3300005539 Ga0068853_100000487 Ga0068853_10000048735 288
119 3300005544 Ga0070686_100136991 Ga0070686_1001369912 288
120 3300005615 Ga0070702_100204480 Ga0070702_1002044802 288
121 3300005841 Ga0068863_100625213 Ga0068863_1006252131 288
122 3300005843 Ga0068860_100655640 Ga0068860_1006556401 288
123 3300006914 Ga0075436_100359039 Ga0075436_1003590392 288
124 3300007076 Ga0075435_100478964 Ga0075435_1004789642 288
125 3300009093 Ga0105240_10261040 Ga0105240_102610402 288
126 3300009551 Ga0105238_10261965 Ga0105238_102619652 288
127 3300009553 Ga0105249_10268608 Ga0105249_102686082 288
128 3300011119 Ga0105246_10149752 Ga0105246_101497521 288
129 3300014325 Ga0163163_10427611 Ga0163163_104276112 288
130 3300014968 Ga0157379_10066822 Ga0157379_100668223 288
131 3300025911 Ga0207654_10001730 Ga0207654_100017302 288
132 3300025913 Ga0207695_10068870 Ga0207695_100688702 288
133 3300025937 Ga0207669_10250297 Ga0207669_102502972 288
134 3300026041 Ga0207639_10000357 Ga0207639_1000035738 288
135 3300039447 Ga0436361_0186542 Ga0436361_0186542_65_967 288
136 3300048913 Ga0496110_0218565 Ga0496110_0218565_548_1462 288
137 3300049583 Ga0501067_0029494 Ga0501067_0029494_486_1385 288
138 3300005347 Ga0070668_100012879 Ga0070668_1000128795 289
139 3300005354 Ga0070675_100230815 Ga0070675_1002308151 289
140 3300005364 Ga0070673_100181682 Ga0070673_1001816822 289
141 3300005468 Ga0070707_100165498 Ga0070707_1001654982 289
142 3300005543 Ga0070672_100002856 Ga0070672_1000028562 289
143 3300005544 Ga0070686_100002262 Ga0070686_1000022624 289
144 3300005548 Ga0070665_100357526 Ga0070665_1003575262 289
145 3300006195 Ga0075366_10088342 Ga0075366_100883422 289
146 3300009553 Ga0105249_10000245 Ga0105249_1000024520 289
147 3300014969 Ga0157376_10327390 Ga0157376_103273902 289
148 3300016635 Ga0183361_10002 Ga0183361_10002707 289
149 3300025940 Ga0207691_10003645 Ga0207691_100036458 289
150 3300025960 Ga0207651_10373836 Ga0207651_103738361 289
151 3300025961 Ga0207712_10000086 Ga0207712_1000008638 289
152 3300025972 Ga0207668_10011180 Ga0207668_100111803 289
153 3300028379 Ga0268266_10309237 Ga0268266_103092372 289
154 3300006914 Ga0075436_100011307 Ga0075436_1000113076 290
155 3300014325 Ga0163163_10324570 Ga0163163_103245702 290
156 3300025298 Ga0209050_1001860 Ga0209050_100186010 290
157 3300044656 Ga0466969_0015191 Ga0466969_0015191_259_1137 290
158 3300050507 nmdc:mga05p37_648607_c1 nmdc:mga05p37_648607_c1_225_1133 290
159 3300050514 nmdc:mga08x19_56723_c1 nmdc:mga08x19_56723_c1_1602_2480 290
160 3300002737 JGI25162J39368_1000255 JGI25162J39368_100025523 291
161 3300002741 JGI25157J39369_1000456 JGI25157J39369_10004566 291
162 3300002771 JGI25163J39215_1000635 JGI25163J39215_10006356 291
163 3300002772 JGI25164J39214_1000388 JGI25164J39214_100038823 291
164 3300003214 JGI25165J46597_1000144 JGI25165J46597_100014423 291
165 3300003761 Ga0055535_1000061 Ga0055535_100006180 291
166 3300003762 Ga0055542_1000099 Ga0055542_100009923 291
167 3300003763 Ga0055529_1000117 Ga0055529_100011723 291
168 3300005262 Ga0065165_1000383 Ga0065165_100038330 291
169 3300005327 Ga0070658_10215019 Ga0070658_102150192 291
170 3300005563 Ga0068855_100017683 Ga0068855_1000176834 291
171 3300005563 Ga0068855_100685868 Ga0068855_1006858682 291
172 3300010375 Ga0105239_10357471 Ga0105239_103574711 291
173 3300025206 Ga0209435_103176 Ga0209435_1031762 291
174 3300025207 Ga0209760_100503 Ga0209760_1005034 291
175 3300025224 Ga0209784_100043 Ga0209784_10004399 291
176 3300025228 Ga0209672_105974 Ga0209672_1059741 291
177 3300025231 Ga0207427_100087 Ga0207427_10008799 291
178 3300025233 Ga0209437_100173 Ga0209437_10017399 291
179 3300025242 Ga0209258_100092 Ga0209258_100092170 291
180 3300025246 Ga0209646_1000439 Ga0209646_100043911 291
181 3300025250 Ga0209026_1000112 Ga0209026_100011299 291
182 3300025254 Ga0209148_1000047 Ga0209148_1000047367 291
183 3300025256 Ga0209759_1000597 Ga0209759_100059723 291
184 3300025261 Ga0209233_1000179 Ga0209233_1000179100 291
185 3300025272 Ga0209455_1000056 Ga0209455_1000056291 291
186 3300025284 Ga0209130_1004650 Ga0209130_10046504 291
187 3300025302 Ga0207426_1000004 Ga0207426_1000004394 291
188 3300025949 Ga0207667_10003622 Ga0207667_100036224 291
189 3300025949 Ga0207667_10044098 Ga0207667_100440982 291
190 3300026067 Ga0207678_10002107 Ga0207678_100021079 291
191 3300031711 Ga0265314_10016728 Ga0265314_100167283 291
192 3300037068 Ga0373925_0068193 Ga0373925_0068193_644_1528 291
193 3300039437 Ga0436365_1893862 Ga0436365_1893862_171_1094 291
194 3300044693 Ga0466961_0176588 Ga0466961_0176588_211_1089 291
195 3300045049 Ga0466959_0010752 Ga0466959_0010752_2893_3771 291
196 3300048903 Ga0496100_0000020 Ga0496100_0000020_31133_32014 291
197 3300048904 Ga0496101_0000045 Ga0496101_0000045_125334_126215 291
198 3300048905 Ga0496102_0000589 Ga0496102_0000589_6430_7311 291
199 3300048906 Ga0496103_0000264 Ga0496103_0000264_30553_31434 291
200 3300048915 Ga0496112_0184830 Ga0496112_0184830_395_1276 291
201 3300048919 Ga0496116_0074789 Ga0496116_0074789_1091_1972 291
202 3300048920 Ga0496117_0000293 Ga0496117_0000293_31202_32083 291
203 3300048921 Ga0496118_0000411 Ga0496118_0000411_31206_32087 291
204 3300048922 Ga0496119_0013344 Ga0496119_0013344_1666_2547 291
205 3300048924 Ga0496121_0000765 Ga0496121_0000765_29826_30707 291
206 3300048929 Ga0496126_0060181 Ga0496126_0060181_2250_3131 291
207 3300049744 Ga0501083_0139143 Ga0501083_0139143_516_1397 291
208 3300054114 Ga0501084_0373874 Ga0501084_0373874_31_942 291

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

22

289

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hnq-assembly1.cif.gz_A the structure of a alcohol dehydrogenase akr13b2 with nadp 0.8972 2 281
8hnq-assembly1.cif.gz_A the structure of a alcohol dehydrogenase akr13b2 with nadp 0.876 2 281
4xap-assembly1.cif.gz_A crystal structure of aldo-keto reductase from sinorhizobium meliloti 1021 0.8604 1 283
3up8-assembly2.cif.gz_B crystal structure of a putative 2,5-diketo-d-gluconic acid reductase b 0.8523 6 284
3v0u-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.8509 11 284
ID Description Score Start End Superfamily
af_P25906_7_286_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9771 9 286 3.20.20.100
af_P25906_7_286_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9668 9 286 3.20.20.100
af_O94315_19_306_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8979 15 290 3.20.20.100
af_F4HPY8_8_325_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8661 14 288 3.20.20.100
4xapA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8604 1 283 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A4P1ALL5-F1-model_v4 deleted 0.9906 159 284
AF-A0A379LU18-F1-model_v4 Oxidoreductase YdbC (EC 1.-.-.-) 0.9904 45 283 GO:0005829
GO:0016491
AF-A0A3A8J7T9-F1-model_v4 Oxidoreductase 0.9878 63 190 GO:0005829
AF-A0A0K4T6T7-F1-model_v4 deleted 0.986 51 286
AF-A0A529NSE1-F1-model_v4 Oxidoreductase 0.9856 63 265

Feature Viewer

pLDDT pTM Quality
90.24 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map