F317947

General Info

Members Datasets Scaffolds Average Seq Length
208 91 416 174

Family's Representative Sequence

Representative Sequence 3300026078|Ga0207702_11116652|Ga0207702_111166522
Length 193
Sequence MSGTLPASGAAGYPASVTRQPFLNFDPIERAGRLWEQHWPDEDPAVYASMRAVTSIMRAHQILIAELDAILRPYGITFSRYEALVLLSYSRDGSLPLSKIGERLQVHATSVTNVVDRLEAAGLVRREPNPRDGRGTLATITDAGREVVAKATAEFNAARFAMSAIDLADLTSLFSILRELRLDAEDFSADGVH

Samples

Sample ID Description Type Environment
1 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
3 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
4 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
5 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
6 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
7 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
8 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
9 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
10 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
11 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
12 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
13 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
14 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
15 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
16 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
17 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
18 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
19 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
20 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
21 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
22 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
23 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
24 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
25 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
26 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
27 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
28 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
29 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
44 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
45 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
46 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
47 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
48 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
49 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
50 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
51 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
52 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
53 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
54 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
55 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
56 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
57 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
58 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
59 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
60 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
61 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
62 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
63 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
64 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
65 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
66 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
67 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
68 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
69 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
70 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
71 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
72 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
73 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
74 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
75 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
76 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
77 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
78 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
79 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
80 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
82 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
84 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
86 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
88 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
89 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
91 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.56
Metatranscriptomes 1.44
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.77
Rhizosphere 90.38
Stem 0
Stem Tuber 0
Unclassified 0.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207702_11116652 3300026078 Bacteria 782
2 Ga0070714_100678694 3300005435 Bacteria 993
3 Ga0070714_100982937 3300005435 Bacteria 821
4 Ga0070699_100400258 3300005518 Bacteria 1241
5 Ga0070665_100216090 3300005548 Bacteria 1918
6 Ga0068855_100006522 3300005563 Bacteria 14191
7 Ga0068855_100699445 3300005563 Bacteria 1085
8 Ga0068854_100174197 3300005578 Bacteria 1676
9 Ga0068856_100003755 3300005614 Bacteria 15226
10 Ga0068856_100085031 3300005614 Bacteria 3143
11 Ga0068856_100445956 3300005614 Bacteria 1315
12 Ga0068856_100680662 3300005614 Bacteria 1049
13 Ga0068856_100771302 3300005614 Bacteria 981
14 Ga0068852_100368888 3300005616 Bacteria 1406
15 Ga0068852_100942463 3300005616 Bacteria 881
16 Ga0081455_10013087 3300005937 Bacteria 8225
17 Ga0081540_1000660 3300005983 Bacteria 32489
18 Ga0097620_100580797 3300006931 Bacteria 1214
19 Ga0105240_10035389 3300009093 Bacteria 6436
20 Ga0105240_10064404 3300009093 Bacteria 4555
21 Ga0105240_10244968 3300009093 Bacteria 2076
22 Ga0105245_10068394 3300009098 Bacteria 3218
23 Ga0105247_10005690 3300009101 Bacteria 7811
24 Ga0105243_10014219 3300009148 Bacteria 6023
25 Ga0105241_10084837 3300009174 Bacteria 2488
26 Ga0105241_10161572 3300009174 Bacteria 1842
27 Ga0105248_11032396 3300009177 Bacteria 929
28 Ga0105237_10020769 3300009545 Bacteria 6764
29 Ga0105237_10056848 3300009545 Bacteria 3915
30 Ga0105237_10705624 3300009545 Bacteria 1015
31 Ga0105237_11656198 3300009545 Bacteria 647
32 Ga0105238_10883609 3300009551 Bacteria 912
33 Ga0105249_10587256 3300009553 Unclassified 1167
34 Ga0105239_10004176 3300010375 Bacteria 17349
35 Ga0105239_10435189 3300010375 Bacteria 1487
36 Ga0105239_10518590 3300010375 Bacteria 1356
37 Ga0105239_10657220 3300010375 Bacteria 1197
38 Ga0157369_10169520 3300013105 Bacteria 2301
39 Ga0157374_10079173 3300013296 Bacteria 3114
40 Ga0157374_10800772 3300013296 Bacteria 958
41 Ga0163162_11434299 3300013306 Bacteria 786
42 Ga0157372_10138738 3300013307 Bacteria 2801
43 Ga0206356_11621664 3300020070 Bacteria 3201
44 Ga0206354_11574826 3300020081 Bacteria 2023
45 Ga0206353_10151942 3300020082 Bacteria 2600
46 Ga0207710_10002975 3300025900 Bacteria 7665
47 Ga0207647_10031129 3300025904 Bacteria 3435
48 Ga0207647_10221381 3300025904 Bacteria 1091
49 Ga0207654_10198247 3300025911 Bacteria 1320
50 Ga0207707_10165761 3300025912 Bacteria 1931
51 Ga0207695_10069013 3300025913 Bacteria 3619
52 Ga0207695_10470408 3300025913 Bacteria 1139
53 Ga0207671_10015265 3300025914 Bacteria 6028
54 Ga0207671_10510166 3300025914 Bacteria 959
55 Ga0207687_10052454 3300025927 Bacteria 2846
56 Ga0207700_10404930 3300025928 Bacteria 1196
57 Ga0207664_10162264 3300025929 Bacteria 1907
58 Ga0207664_10525539 3300025929 Bacteria 1061
59 Ga0207669_10608489 3300025937 Bacteria 889
60 Ga0207661_10273154 3300025944 Bacteria 1509
61 Ga0207667_10013263 3300025949 Bacteria 9444
62 Ga0207667_10049389 3300025949 Bacteria 4443
63 Ga0207667_10602863 3300025949 Bacteria 1107
64 Ga0207702_10012055 3300026078 Bacteria 7189
65 Ga0207702_10031359 3300026078 Bacteria 4430
66 Ga0207702_10131801 3300026078 Bacteria 2250
67 Ga0207702_11214962 3300026078 Bacteria 748
68 Ga0207698_10024415 3300026142 Bacteria 4243
69 Ga0268266_11599865 3300028379 Bacteria 627
70 Ga0307413_10307083 3300031824 Bacteria 1206
71 Ga0373942_0019361 3300035207 Bacteria 1698
72 Ga0373927_0028647 3300035695 Bacteria 3633
73 Ga0395901_0226072 3300038443 Bacteria 1955
74 Ga0395901_0727818 3300038443 Bacteria 987
75 Ga0436365_0154606 3300039437 Bacteria 1513
76 Ga0466969_0025108 3300044656 Bacteria 3065
77 Ga0466969_0066041 3300044656 Bacteria 1747
78 Ga0466972_0008360 3300044658 Bacteria 5187
79 Ga0466972_0066948 3300044658 Bacteria 1717
80 Ga0466972_0513412 3300044658 Bacteria 564
81 Ga0466965_0028466 3300044683 Bacteria 2715
82 Ga0466966_0006936 3300044684 Bacteria 7503
83 Ga0466966_0036918 3300044684 Bacteria 3153
84 Ga0466966_0045547 3300044684 Bacteria 2804
85 Ga0466966_0173600 3300044684 Bacteria 1309
86 Ga0466966_0266927 3300044684 Bacteria 1030
87 Ga0466961_0010157 3300044693 Bacteria 5997
88 Ga0466961_0014099 3300044693 Bacteria 5127
89 Ga0466961_0028049 3300044693 Bacteria 3621
90 Ga0466961_0042445 3300044693 Bacteria 2915
91 Ga0466961_0069001 3300044693 Bacteria 2245
92 Ga0466961_0071442 3300044693 Bacteria 2202
93 Ga0466961_0071634 3300044693 Bacteria 2199
94 Ga0466961_0160047 3300044693 Bacteria 1403
95 Ga0466961_0198501 3300044693 Bacteria 1241
96 Ga0466961_0225302 3300044693 Bacteria 1155
97 Ga0466961_0314859 3300044693 Bacteria 955
98 Ga0466963_0001102 3300044694 Bacteria 14066
99 Ga0466963_0003341 3300044694 Bacteria 9155
100 Ga0466963_0006576 3300044694 Bacteria 6889
101 Ga0466963_0020880 3300044694 Bacteria 4124
102 Ga0466963_0022965 3300044694 Bacteria 3956
103 Ga0466963_0053505 3300044694 Bacteria 2680
104 Ga0466963_0071573 3300044694 Bacteria 2334
105 Ga0466963_0120996 3300044694 Bacteria 1801
106 Ga0466963_0122788 3300044694 Bacteria 1788
107 Ga0466963_0188436 3300044694 Bacteria 1441
108 Ga0466963_0224197 3300044694 Bacteria 1317
109 Ga0466963_0375561 3300044694 Bacteria 1002
110 Ga0466963_0552147 3300044694 Bacteria 813
111 Ga0466964_0013849 3300044706 Bacteria 3061
112 Ga0466964_0060957 3300044706 Bacteria 1570
113 Ga0466964_0307276 3300044706 Bacteria 801
114 Ga0466971_0026011 3300044719 Bacteria 2614
115 Ga0466971_0301930 3300044719 Bacteria 769
116 Ga0466970_0030177 3300044765 Bacteria 2858
117 Ga0466970_0062343 3300044765 Bacteria 1998
118 Ga0466970_0078978 3300044765 Bacteria 1776
119 Ga0466957_0009406 3300044842 Bacteria 5580
120 Ga0466957_0010072 3300044842 Bacteria 5409
121 Ga0466957_0050371 3300044842 Bacteria 2534
122 Ga0466957_0102970 3300044842 Bacteria 1802
123 Ga0466957_0205460 3300044842 Bacteria 1295
124 Ga0466957_0265809 3300044842 Bacteria 1144
125 Ga0466957_0731015 3300044842 Bacteria 700
126 Ga0466960_0000398 3300044901 Bacteria 14834
127 Ga0466960_0013314 3300044901 Bacteria 3492
128 Ga0466960_0044167 3300044901 Bacteria 2123
129 Ga0466959_0018263 3300045049 Bacteria 5149
130 Ga0466959_0074488 3300045049 Bacteria 2455
131 Ga0466959_0148319 3300045049 Bacteria 1655
132 Ga0466959_0154084 3300045049 Bacteria 1618
133 Ga0466959_0218308 3300045049 Bacteria 1323
134 Ga0466959_0332007 3300045049 Bacteria 1038
135 Ga0466959_0407058 3300045049 Bacteria 924
136 Ga0466959_0697315 3300045049 Bacteria 681
137 Ga0466958_0011195 3300045836 Bacteria 5046
138 Ga0466958_0014713 3300045836 Bacteria 4469
139 Ga0466958_0023370 3300045836 Bacteria 3628
140 Ga0466958_0065616 3300045836 Bacteria 2215
141 Ga0466958_0086715 3300045836 Bacteria 1932
142 Ga0466958_0101545 3300045836 Bacteria 1789
143 Ga0466958_0192732 3300045836 Bacteria 1296
144 Ga0466958_0615683 3300045836 Bacteria 706
145 Ga0466967_0002438 3300045976 Bacteria 11577
146 Ga0466967_0017526 3300045976 Bacteria 5690
147 Ga0466967_0020488 3300045976 Bacteria 5347
148 Ga0466967_0042894 3300045976 Bacteria 3913
149 Ga0466967_0048231 3300045976 Bacteria 3718
150 Ga0466967_0088295 3300045976 Bacteria 2813
151 Ga0466967_0098608 3300045976 Bacteria 2668
152 Ga0466967_0135644 3300045976 Bacteria 2288
153 Ga0466967_0175917 3300045976 Bacteria 2016
154 Ga0466967_0205628 3300045976 Bacteria 1866
155 Ga0466967_0346392 3300045976 Bacteria 1437
156 Ga0466967_0616430 3300045976 Bacteria 1072
157 Ga0466967_0807174 3300045976 Bacteria 932
158 Ga0466967_1449293 3300045976 Bacteria 684
159 Ga0495650_0000055 3300046471 Bacteria 308438
160 Ga0495674_0513504 3300047319 Bacteria 957
161 Ga0496102_0000072 3300048905 Bacteria 150284
162 Ga0496102_0000620 3300048905 Bacteria 36675
163 Ga0496102_0045834 3300048905 Bacteria 3970
164 Ga0496103_0000053 3300048906 Bacteria 148944
165 Ga0496103_0008046 3300048906 Bacteria 6261
166 Ga0496109_0150824 3300048912 Bacteria 2176
167 Ga0496110_0419572 3300048913 Bacteria 1220
168 Ga0496110_0599507 3300048913 Bacteria 999
169 Ga0496111_0468786 3300048914 Bacteria 928
170 Ga0496112_1140672 3300048915 Bacteria 697
171 Ga0496113_0787350 3300048916 Bacteria 756
172 Ga0496114_0231687 3300048917 Bacteria 1623
173 Ga0496118_0067162 3300048921 Bacteria 2613
174 Ga0496119_0002025 3300048922 Bacteria 22955
175 Ga0496119_0020063 3300048922 Bacteria 4890
176 Ga0496120_0007336 3300048923 Bacteria 8225
177 Ga0496120_0308426 3300048923 Bacteria 722
178 Ga0496121_0071367 3300048924 Bacteria 2793
179 Ga0496126_0085735 3300048929 Bacteria 2776
180 Ga0501031_0004501 3300049568 Bacteria 9040
181 Ga0501031_0224050 3300049568 Bacteria 1224
182 Ga0501032_0006248 3300049569 Bacteria 8769
183 Ga0501032_0495991 3300049569 Bacteria 781
184 Ga0501033_0252125 3300049570 Bacteria 1250
185 Ga0501034_0011167 3300049571 Bacteria 9322
186 Ga0501034_0263096 3300049571 Bacteria 1667
187 Ga0501034_1132612 3300049571 Bacteria 663
188 Ga0501036_0396153 3300049572 Bacteria 1152
189 Ga0501037_0038898 3300049573 Bacteria 3503
190 Ga0501038_0002945 3300049574 Bacteria 15878
191 Ga0501043_0008573 3300049579 Bacteria 8059
192 Ga0501043_0428938 3300049579 Bacteria 996
193 Ga0501047_0141149 3300049581 Bacteria 2287
194 Ga0501047_0457403 3300049581 Bacteria 1105
195 Ga0501048_0000232 3300049582 Bacteria 36800
196 Ga0501069_0078389 3300049585 Bacteria 1858
197 Ga0501070_0009846 3300049586 Bacteria 8083
198 Ga0501035_0008547 3300049822 Bacteria 9533
199 Ga0501035_0144988 3300049822 Bacteria 2063
200 Ga0501035_0399048 3300049822 Bacteria 1144
201 Ga0501035_0522558 3300049822 Bacteria 975
202 Ga0501044_0032786 3300049823 Bacteria 5460
203 Ga0501044_0080967 3300049823 Bacteria 3288
204 Ga0501044_0180898 3300049823 Bacteria 2075
205 Ga0466962_0005652 3300061719 Bacteria 6006
206 Ga0466962_0013913 3300061719 Bacteria 3875
207 Ga0466962_0015349 3300061719 Bacteria 3693
208 Ga0466962_0522533 3300061719 Bacteria 602
209 Ga0207702_11116652
210 Ga0070714_100678694
211 Ga0070714_100982937
212 Ga0070699_100400258
213 Ga0070665_100216090
214 Ga0068855_100006522
215 Ga0068855_100699445
216 Ga0068854_100174197
217 Ga0068856_100003755
218 Ga0068856_100085031
219 Ga0068856_100445956
220 Ga0068856_100680662
221 Ga0068856_100771302
222 Ga0068852_100368888
223 Ga0068852_100942463
224 Ga0081455_10013087
225 Ga0081540_1000660
226 Ga0097620_100580797
227 Ga0105240_10035389
228 Ga0105240_10064404
229 Ga0105240_10244968
230 Ga0105245_10068394
231 Ga0105247_10005690
232 Ga0105243_10014219
233 Ga0105241_10084837
234 Ga0105241_10161572
235 Ga0105248_11032396
236 Ga0105237_10020769
237 Ga0105237_10056848
238 Ga0105237_10705624
239 Ga0105237_11656198
240 Ga0105238_10883609
241 Ga0105249_10587256
242 Ga0105239_10004176
243 Ga0105239_10435189
244 Ga0105239_10518590
245 Ga0105239_10657220
246 Ga0157369_10169520
247 Ga0157374_10079173
248 Ga0157374_10800772
249 Ga0163162_11434299
250 Ga0157372_10138738
251 Ga0206356_11621664
252 Ga0206354_11574826
253 Ga0206353_10151942
254 Ga0207710_10002975
255 Ga0207647_10031129
256 Ga0207647_10221381
257 Ga0207654_10198247
258 Ga0207707_10165761
259 Ga0207695_10069013
260 Ga0207695_10470408
261 Ga0207671_10015265
262 Ga0207671_10510166
263 Ga0207687_10052454
264 Ga0207700_10404930
265 Ga0207664_10162264
266 Ga0207664_10525539
267 Ga0207669_10608489
268 Ga0207661_10273154
269 Ga0207667_10013263
270 Ga0207667_10049389
271 Ga0207667_10602863
272 Ga0207702_10012055
273 Ga0207702_10031359
274 Ga0207702_10131801
275 Ga0207702_11214962
276 Ga0207698_10024415
277 Ga0268266_11599865
278 Ga0307413_10307083
279 Ga0373942_0019361
280 Ga0373927_0028647
281 Ga0395901_0226072
282 Ga0395901_0727818
283 Ga0436365_0154606
284 Ga0466969_0025108
285 Ga0466969_0066041
286 Ga0466972_0008360
287 Ga0466972_0066948
288 Ga0466972_0513412
289 Ga0466965_0028466
290 Ga0466966_0006936
291 Ga0466966_0036918
292 Ga0466966_0045547
293 Ga0466966_0173600
294 Ga0466966_0266927
295 Ga0466961_0010157
296 Ga0466961_0014099
297 Ga0466961_0028049
298 Ga0466961_0042445
299 Ga0466961_0069001
300 Ga0466961_0071442
301 Ga0466961_0071634
302 Ga0466961_0160047
303 Ga0466961_0198501
304 Ga0466961_0225302
305 Ga0466961_0314859
306 Ga0466963_0001102
307 Ga0466963_0003341
308 Ga0466963_0006576
309 Ga0466963_0020880
310 Ga0466963_0022965
311 Ga0466963_0053505
312 Ga0466963_0071573
313 Ga0466963_0120996
314 Ga0466963_0122788
315 Ga0466963_0188436
316 Ga0466963_0224197
317 Ga0466963_0375561
318 Ga0466963_0552147
319 Ga0466964_0013849
320 Ga0466964_0060957
321 Ga0466964_0307276
322 Ga0466971_0026011
323 Ga0466971_0301930
324 Ga0466970_0030177
325 Ga0466970_0062343
326 Ga0466970_0078978
327 Ga0466957_0009406
328 Ga0466957_0010072
329 Ga0466957_0050371
330 Ga0466957_0102970
331 Ga0466957_0205460
332 Ga0466957_0265809
333 Ga0466957_0731015
334 Ga0466960_0000398
335 Ga0466960_0013314
336 Ga0466960_0044167
337 Ga0466959_0018263
338 Ga0466959_0074488
339 Ga0466959_0148319
340 Ga0466959_0154084
341 Ga0466959_0218308
342 Ga0466959_0332007
343 Ga0466959_0407058
344 Ga0466959_0697315
345 Ga0466958_0011195
346 Ga0466958_0014713
347 Ga0466958_0023370
348 Ga0466958_0065616
349 Ga0466958_0086715
350 Ga0466958_0101545
351 Ga0466958_0192732
352 Ga0466958_0615683
353 Ga0466967_0002438
354 Ga0466967_0017526
355 Ga0466967_0020488
356 Ga0466967_0042894
357 Ga0466967_0048231
358 Ga0466967_0088295
359 Ga0466967_0098608
360 Ga0466967_0135644
361 Ga0466967_0175917
362 Ga0466967_0205628
363 Ga0466967_0346392
364 Ga0466967_0616430
365 Ga0466967_0807174
366 Ga0466967_1449293
367 Ga0495650_0000055
368 Ga0495674_0513504
369 Ga0496102_0000072
370 Ga0496102_0000620
371 Ga0496102_0045834
372 Ga0496103_0000053
373 Ga0496103_0008046
374 Ga0496109_0150824
375 Ga0496110_0419572
376 Ga0496110_0599507
377 Ga0496111_0468786
378 Ga0496112_1140672
379 Ga0496113_0787350
380 Ga0496114_0231687
381 Ga0496118_0067162
382 Ga0496119_0002025
383 Ga0496119_0020063
384 Ga0496120_0007336
385 Ga0496120_0308426
386 Ga0496121_0071367
387 Ga0496126_0085735
388 Ga0501031_0004501
389 Ga0501031_0224050
390 Ga0501032_0006248
391 Ga0501032_0495991
392 Ga0501033_0252125
393 Ga0501034_0011167
394 Ga0501034_0263096
395 Ga0501034_1132612
396 Ga0501036_0396153
397 Ga0501037_0038898
398 Ga0501038_0002945
399 Ga0501043_0008573
400 Ga0501043_0428938
401 Ga0501047_0141149
402 Ga0501047_0457403
403 Ga0501048_0000232
404 Ga0501069_0078389
405 Ga0501070_0009846
406 Ga0501035_0008547
407 Ga0501035_0144988
408 Ga0501035_0399048
409 Ga0501035_0522558
410 Ga0501044_0032786
411 Ga0501044_0080967
412 Ga0501044_0180898
413 Ga0466962_0005652
414 Ga0466962_0013913
415 Ga0466962_0015349
416 Ga0466962_0522533

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12802

MarR_2

MarR family

74

135

0.98

PF13463

HTH_27

Winged helix DNA-binding domain

78

144

0.95

PF01047

MarR

MarR family

76

136

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4b8x-assembly1.cif.gz_B near atomic resolution crystal structure of sco5413, a marr family transcriptional regulator from streptomyces coelicolor 0.9635 29 170
4b8x-assembly1.cif.gz_A near atomic resolution crystal structure of sco5413, a marr family transcriptional regulator from streptomyces coelicolor 0.9621 29 170
4b8x-assembly1.cif.gz_B near atomic resolution crystal structure of sco5413, a marr family transcriptional regulator from streptomyces coelicolor 0.9434 29 170
4b8x-assembly1.cif.gz_A near atomic resolution crystal structure of sco5413, a marr family transcriptional regulator from streptomyces coelicolor 0.9421 29 170
6wxq-assembly1.cif.gz_A crystal structure of crispr-associated transcription factor csa3 complexed with ca4 0.9311 57 130
ID Description Score Start End Superfamily
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9764 57 120 1.10.10.10
af_I6Y8K3_25_165_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.97 29 168 1.10.10.10
4b8xB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9632 29 170 1.10.10.10
af_I6Y8K3_25_165_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9566 29 168 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9448 57 120 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2W6DTL2-F1-model_v4 MarR family transcriptional regulator 0.9895 1 170 GO:0003677
GO:0003700
GO:0006950
AF-A0A351ITW2-F1-model_v4 MarR family transcriptional regulator 0.9825 33 148 GO:0003677
GO:0003700
GO:0006950
AF-A0A522QDD9-F1-model_v4 MarR family transcriptional regulator 0.98 3 170 GO:0003677
GO:0003700
GO:0006950
AF-A0A2W4NVF4-F1-model_v4 deleted 0.9789 4 171
AF-A0A2W6DTL2-F1-model_v4 MarR family transcriptional regulator 0.9781 1 170 GO:0003677
GO:0003700
GO:0006950

Map