F317805

General Info

Members Datasets Scaffolds Average Seq Length
208 153 204 119

Family's Representative Sequence

Representative Sequence 3300013296|Ga0157374_10922166|Ga0157374_109221661
Length 140
Sequence VFIINLHAGKKPLIKHFTSQIKMTPKQVLEKWIDAFNKADADTISNLYDDDAVNHQVANEPVVGKTAIKQIFSTEFANAEMICIPENIFEDGDWAILEWKDPKGLRGCGFFNIKNDKIIFQRGYWDKLSFYRLHNISSAD

Samples

Sample ID Description Type Environment
1 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
2 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
3 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
4 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
89 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
90 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
91 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
92 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
93 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
94 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
95 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
96 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
97 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
98 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
99 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
100 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
101 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
102 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
103 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
104 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
105 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
106 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
107 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
108 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
109 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
110 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
111 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
112 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
113 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
114 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
115 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
116 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
117 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
118 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
119 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
120 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
121 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
122 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
123 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
124 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
125 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
126 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
127 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
128 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
129 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
130 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
131 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
132 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
133 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
134 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
135 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
136 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
137 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
140 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
141 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
142 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
144 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
145 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
146 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
147 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
148 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
149 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
150 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
151 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
152 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
153 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.08
Metatranscriptomes 0
Isolates 1.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.37
Nodule 0
Rhizoplane 3.37
Rhizosphere 88.94
Stem 0
Stem Tuber 0
Unclassified 4.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10031359 3300003320 Bacteria 3102
2 rootL2_10295686 3300003322 Bacteria 1213
3 rootH1_10008472 3300003323 Bacteria 18181
4 Ga0055531_10000718 3300003794 Bacteria 28238
5 Ga0070683_100390173 3300005329 Bacteria 1327
6 Ga0070683_100442881 3300005329 Bacteria 1240
7 Ga0070683_100576496 3300005329 Bacteria 1076
8 Ga0070670_100288276 3300005331 Bacteria 1434
9 Ga0070666_10360848 3300005335 Bacteria 1041
10 Ga0070660_100129414 3300005339 Bacteria 2019
11 Ga0070660_100370801 3300005339 Bacteria 1181
12 Ga0070689_100084176 3300005340 Bacteria 2499
13 Ga0070661_100434925 3300005344 Bacteria 1042
14 Ga0070661_100666940 3300005344 Bacteria 845
15 Ga0070669_101484100 3300005353 Bacteria 589
16 Ga0070675_100197971 3300005354 Bacteria 1743
17 Ga0070671_100011683 3300005355 Bacteria 7063
18 Ga0070673_100002606 3300005364 Bacteria 11020
19 Ga0070673_100707437 3300005364 Bacteria 925
20 Ga0070659_100174147 3300005366 Bacteria 1764
21 Ga0070659_102040789 3300005366 Unclassified 515
22 Ga0070713_100028687 3300005436 Bacteria 4397
23 Ga0070711_100396278 3300005439 Bacteria 1120
24 Ga0070663_100087778 3300005455 Unclassified 2299
25 Ga0070678_100309992 3300005456 Bacteria 1344
26 Ga0070662_100635820 3300005457 Bacteria 899
27 Ga0070662_101016520 3300005457 Bacteria 710
28 Ga0070662_101127348 3300005457 Bacteria 673
29 Ga0070685_11270981 3300005466 Bacteria 561
30 Ga0070679_100592499 3300005530 Bacteria 1052
31 Ga0070684_100334701 3300005535 Unclassified 1391
32 Ga0070684_100997601 3300005535 Bacteria 786
33 Ga0070672_101585087 3300005543 Bacteria 587
34 Ga0070693_100642483 3300005547 Unclassified 771
35 Ga0070693_101159880 3300005547 Unclassified 592
36 Ga0070665_100073351 3300005548 Bacteria 3429
37 Ga0070665_100634552 3300005548 Unclassified 1081
38 Ga0070664_100044200 3300005564 Bacteria 3761
39 Ga0070664_100792763 3300005564 Bacteria 885
40 Ga0068852_100104577 3300005616 Bacteria 2563
41 Ga0068852_100275184 3300005616 Bacteria 1621
42 Ga0068852_100445745 3300005616 Bacteria 1281
43 Ga0068852_100943069 3300005616 Bacteria 881
44 Ga0068852_101923167 3300005616 Unclassified 614
45 Ga0068864_100067471 3300005618 Bacteria 3106
46 Ga0068861_102136372 3300005719 Bacteria 560
47 Ga0068851_10517408 3300005834 Unclassified 717
48 Ga0068851_10789701 3300005834 Bacteria 589
49 Ga0068858_100060004 3300005842 Bacteria 3516
50 Ga0068860_100740523 3300005843 Bacteria 994
51 Ga0068862_100117268 3300005844 Bacteria 2343
52 Ga0081455_10069875 3300005937 Bacteria 2917
53 Ga0081455_10634720 3300005937 Unclassified 691
54 Ga0081540_1048625 3300005983 Bacteria 2122
55 Ga0070717_10203830 3300006028 Bacteria 1733
56 Ga0070712_100075984 3300006175 Bacteria 2418
57 Ga0075434_100079620 3300006871 Unclassified 3273
58 Ga0075434_101518328 3300006871 Bacteria 679
59 Ga0105251_10000015 3300009011 Bacteria 149012
60 Ga0105251_10009571 3300009011 Bacteria 5709
61 Ga0105251_10041820 3300009011 Bacteria 2228
62 Ga0105251_10355206 3300009011 Bacteria 669
63 Ga0105240_10401977 3300009093 Bacteria 1542
64 Ga0105245_10292851 3300009098 Bacteria 1595
65 Ga0105241_10071277 3300009174 Bacteria 2697
66 Ga0105248_10033901 3300009177 Bacteria 5705
67 Ga0105248_10789238 3300009177 Bacteria 1072
68 Ga0105237_10304947 3300009545 Bacteria 1595
69 Ga0105238_11448502 3300009551 Bacteria 715
70 Ga0105239_10334075 3300010375 Bacteria 1710
71 Ga0105239_11966382 3300010375 Bacteria 678
72 Ga0105246_10038129 3300011119 Bacteria 3229
73 Ga0157373_10016392 3300013100 Bacteria 5407
74 Ga0157371_10125782 3300013102 Bacteria 1823
75 Ga0157371_10368359 3300013102 Unclassified 1048
76 Ga0157369_10046975 3300013105 Bacteria 4689
77 Ga0157374_10404167 3300013296 Bacteria 1363
78 Ga0157374_10470047 3300013296 Bacteria 1260
79 Ga0157374_10922166 3300013296 Unclassified 891
80 Ga0157372_10011971 3300013307 Bacteria 9240
81 Ga0157372_10323185 3300013307 Bacteria 1796
82 Ga0157372_10471672 3300013307 Bacteria 1463
83 Ga0157372_11174695 3300013307 Bacteria 887
84 Ga0157372_12630379 3300013307 Bacteria 577
85 Ga0157375_10098844 3300013308 Bacteria 2996
86 Ga0157375_12344947 3300013308 Bacteria 636
87 Ga0157375_13109115 3300013308 Bacteria 554
88 Ga0163163_10932713 3300014325 Bacteria 931
89 Ga0163163_11383223 3300014325 Bacteria 765
90 Ga0157380_10011760 3300014326 Bacteria 6331
91 Ga0157377_10175154 3300014745 Bacteria 1344
92 Ga0157376_10236018 3300014969 Bacteria 1701
93 Ga0163161_10228156 3300017792 Bacteria 1444
94 Ga0163161_11747548 3300017792 Bacteria 552
95 Ga0209050_1000131 3300025298 Bacteria 186028
96 Ga0209257_1000028 3300025304 Bacteria 699493
97 Ga0207656_10215048 3300025321 Bacteria 933
98 Ga0207713_1000003 3300025735 Bacteria 860698
99 Ga0207695_10280352 3300025913 Bacteria 1560
100 Ga0207671_10428479 3300025914 Bacteria 1053
101 Ga0207693_10099805 3300025915 Bacteria 2276
102 Ga0207663_10178590 3300025916 Bacteria 1514
103 Ga0207659_11222823 3300025926 Bacteria 646
104 Ga0207644_10019655 3300025931 Bacteria 4586
105 Ga0207690_10112691 3300025932 Bacteria 1962
106 Ga0207691_11624660 3300025940 Bacteria 525
107 Ga0207661_10032654 3300025944 Bacteria 4036
108 Ga0207661_10159516 3300025944 Bacteria 1956
109 Ga0207661_10642907 3300025944 Bacteria 975
110 Ga0207661_11473107 3300025944 Unclassified 624
111 Ga0207679_10210049 3300025945 Bacteria 1631
112 Ga0207640_10221534 3300025981 Unclassified 1449
113 Ga0207703_10020018 3300026035 Bacteria 5228
114 Ga0207639_11181868 3300026041 Unclassified 718
115 Ga0207678_10111685 3300026067 Unclassified 2332
116 Ga0207678_11039594 3300026067 Bacteria 725
117 Ga0207676_10070351 3300026095 Bacteria 2806
118 Ga0207683_10299637 3300026121 Bacteria 1471
119 Ga0207698_10044863 3300026142 Bacteria 3325
120 Ga0207698_10250266 3300026142 Bacteria 1621
121 Ga0209995_1011603 3300027471 Bacteria 1433
122 Ga0209968_1011821 3300027526 Bacteria 1357
123 Ga0268266_10084997 3300028379 Bacteria 2764
124 Ga0268266_10564851 3300028379 Unclassified 1091
125 Ga0314311_1187631 3300030733 Bacteria 1112
126 Ga0265327_10146111 3300031251 Bacteria 1101
127 Ga0307408_100000183 3300031548 Bacteria 69517
128 Ga0265313_10394885 3300031595 Bacteria 543
129 Ga0307412_10000007 3300031911 Bacteria 486267
130 Ga0307412_10000090 3300031911 Bacteria 81466
131 Ga0307416_100000074 3300032002 Bacteria 79881
132 Ga0307414_10000210 3300032004 Bacteria 39220
133 Ga0307414_10001048 3300032004 Bacteria 14134
134 Ga0307414_10665373 3300032004 Unclassified 940
135 Ga0307411_11776830 3300032005 Unclassified 572
136 Ga0316583_10056911 3300032133 Bacteria 1373
137 Ga0316574_0139438 3300035398 Bacteria 1562
138 Ga0395899_0292804 3300037312 Bacteria 1104
139 Ga0395900_0008764 3300037418 Bacteria 10392
140 Ga0395905_0003216 3300037471 Bacteria 17578
141 Ga0395905_0353330 3300037471 Bacteria 1362
142 Ga0395901_0341224 3300038443 Bacteria 1548
143 Ga0400483_110888 3300039062 Bacteria 1311
144 Ga0400489_51479 3300039093 Bacteria 1711
145 Ga0436365_1744812 3300039437 Bacteria 636
146 Ga0439436_0011058 3300041404 Bacteria 2744
147 Ga0439439_0009101 3300041406 Bacteria 2356
148 Ga0439447_029072 3300041407 Bacteria 1401
149 Ga0439461_0000006 3300041410 Bacteria 28112
150 Ga0439461_0002516 3300041410 Bacteria 2936
151 Ga0439466_0049628 3300041411 Bacteria 1378
152 Ga0439465_0001487 3300041413 Bacteria 7601
153 Ga0439465_0002971 3300041413 Bacteria 5545
154 Ga0451793_1654308 3300041452 Unclassified 694
155 Ga0451837_1080444 3300041494 Bacteria 523
156 Ga0439431_0001707 3300041997 Bacteria 4840
157 Ga0439431_0049781 3300041997 Bacteria 1084
158 Ga0439433_0038918 3300041999 Bacteria 1104
159 Ga0439442_022250 3300042002 Bacteria 1315
160 Ga0439445_0001765 3300042004 Bacteria 4768
161 Ga0439432_003283 3300042006 Bacteria 6013
162 Ga0439432_218529 3300042006 Bacteria 550
163 Ga0439452_014362 3300042010 Bacteria 2202
164 Ga0439452_041465 3300042010 Bacteria 1083
165 Ga0439457_011835 3300042014 Bacteria 1974
166 Ga0439462_0001975 3300042015 Bacteria 4691
167 Ga0439462_0002607 3300042015 Bacteria 4213
168 Ga0450890_091623 3300042127 Bacteria 505
169 Ga0450898_045659 3300042134 Bacteria 837
170 Ga0439446_0012952 3300042156 Bacteria 2283
171 Ga0439434_0010784 3300042435 Bacteria 2696
172 Ga0439434_0014213 3300042435 Bacteria 2368
173 Ga0451577_0554197 3300042876 Bacteria 1044
174 Ga0466966_0105797 3300044684 Bacteria 1737
175 Ga0453684_0017547 3300044712 Bacteria 11077
176 Ga0453684_0474832 3300044712 Bacteria 1388
177 Ga0453684_2463873 3300044712 Bacteria 514
178 Ga0466959_0028485 3300045049 Bacteria 4142
179 Ga0495650_0111948 3300046471 Unclassified 1013
180 Ga0495625_0104932 3300046660 Bacteria 1937
181 Ga0496104_0170693 3300048907 Bacteria 2086
182 Ga0496108_1755148 3300048911 Bacteria 509
183 Ga0496110_0271545 3300048913 Bacteria 1544
184 Ga0496111_0272827 3300048914 Bacteria 1255
185 Ga0496112_0013431 3300048915 Bacteria 7559
186 Ga0496113_0290419 3300048916 Bacteria 1308
187 Ga0501034_0084804 3300049571 Bacteria 3169
188 Ga0501038_0538571 3300049574 Unclassified 889
189 Ga0501198_010179 3300049649 Bacteria 1387
190 Ga0501223_002936 3300049663 Bacteria 3742
191 Ga0501080_1041435 3300049742 Bacteria 708
192 Ga0501035_0241088 3300049822 Bacteria 1538
193 Ga0501044_0401216 3300049823 Bacteria 1284
194 nmdc:mga0n895_1284982_c1 3300050512 Bacteria 703
195 nmdc:mga0rr50_254630_c1 3300050513 Bacteria 1459
196 Ga0500658_0110090 3300053134 Bacteria 1211
197 Ga0500568_0009177 3300053139 Bacteria 4716
198 Ga0500604_0056502 3300053151 Bacteria 1223
199 Ga0500627_0326427 3300053158 Bacteria 666
200 Ga0590071_074017 3300059421 Bacteria 842
201 Ga0590077_014022 3300059426 Bacteria 1668
202 Ga0501082_0988649 3300060353 Bacteria 736
203 Ga0501082_1541155 3300060353 Unclassified 580
204 Ga0530510_0216348 3300061734 Bacteria 1424

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005547 Ga0070693_101159880 Ga0070693_1011598801 108
2 3300005616 Ga0068852_100943069 Ga0068852_1009430692 108
3 3300005842 Ga0068858_100060004 Ga0068858_1000600044 108
4 3300005843 Ga0068860_100740523 Ga0068860_1007405232 108
5 3300006028 Ga0070717_10203830 Ga0070717_102038303 108
6 3300006175 Ga0070712_100075984 Ga0070712_1000759842 108
7 3300025914 Ga0207671_10428479 Ga0207671_104284792 108
8 3300025915 Ga0207693_10099805 Ga0207693_100998052 108
9 3300025916 Ga0207663_10178590 Ga0207663_101785901 108
10 3300025931 Ga0207644_10019655 Ga0207644_100196554 108
11 iso_pu_bacteria 2643221622 2644127503 109
12 iso_pu_bacteria 2919108558 2919109096 110
13 3300005983 Ga0081540_1048625 Ga0081540_10486252 112
14 3300053158 Ga0500627_0326427 Ga0500627_0326427_37_387 112
15 3300013102 Ga0157371_10368359 Ga0157371_103683592 113
16 3300013307 Ga0157372_10011971 Ga0157372_1001197110 113
17 3300031251 Ga0265327_10146111 Ga0265327_101461112 113
18 3300046660 Ga0495625_0104932 Ga0495625_0104932_100_453 113
19 3300053134 Ga0500658_0110090 Ga0500658_0110090_446_799 113
20 3300053139 Ga0500568_0009177 Ga0500568_0009177_3176_3529 113
21 3300053151 Ga0500604_0056502 Ga0500604_0056502_711_1064 113
22 3300003794 Ga0055531_10000718 Ga0055531_1000071824 114
23 3300005329 Ga0070683_100442881 Ga0070683_1004428812 114
24 3300005329 Ga0070683_100576496 Ga0070683_1005764962 114
25 3300005331 Ga0070670_100288276 Ga0070670_1002882762 114
26 3300005335 Ga0070666_10360848 Ga0070666_103608482 114
27 3300005339 Ga0070660_100129414 Ga0070660_1001294142 114
28 3300005339 Ga0070660_100370801 Ga0070660_1003708012 114
29 3300005340 Ga0070689_100084176 Ga0070689_1000841764 114
30 3300005344 Ga0070661_100434925 Ga0070661_1004349252 114
31 3300005344 Ga0070661_100666940 Ga0070661_1006669401 114
32 3300005353 Ga0070669_101484100 Ga0070669_1014841001 114
33 3300005354 Ga0070675_100197971 Ga0070675_1001979712 114
34 3300005355 Ga0070671_100011683 Ga0070671_1000116836 114
35 3300005364 Ga0070673_100002606 Ga0070673_10000260611 114
36 3300005364 Ga0070673_100707437 Ga0070673_1007074372 114
37 3300005366 Ga0070659_100174147 Ga0070659_1001741473 114
38 3300005366 Ga0070659_102040789 Ga0070659_1020407891 114
39 3300005436 Ga0070713_100028687 Ga0070713_1000286877 114
40 3300005439 Ga0070711_100396278 Ga0070711_1003962783 114
41 3300005455 Ga0070663_100087778 Ga0070663_1000877782 114
42 3300005456 Ga0070678_100309992 Ga0070678_1003099922 114
43 3300005457 Ga0070662_100635820 Ga0070662_1006358202 114
44 3300005457 Ga0070662_101016520 Ga0070662_1010165201 114
45 3300005457 Ga0070662_101127348 Ga0070662_1011273481 114
46 3300005466 Ga0070685_11270981 Ga0070685_112709811 114
47 3300005530 Ga0070679_100592499 Ga0070679_1005924992 114
48 3300005535 Ga0070684_100334701 Ga0070684_1003347012 114
49 3300005535 Ga0070684_100997601 Ga0070684_1009976012 114
50 3300005543 Ga0070672_101585087 Ga0070672_1015850872 114
51 3300005547 Ga0070693_100642483 Ga0070693_1006424831 114
52 3300005548 Ga0070665_100073351 Ga0070665_1000733513 114
53 3300005548 Ga0070665_100634552 Ga0070665_1006345522 114
54 3300005564 Ga0070664_100044200 Ga0070664_1000442002 114
55 3300005564 Ga0070664_100792763 Ga0070664_1007927632 114
56 3300005616 Ga0068852_100104577 Ga0068852_1001045772 114
57 3300005616 Ga0068852_100275184 Ga0068852_1002751843 114
58 3300005616 Ga0068852_100445745 Ga0068852_1004457452 114
59 3300005616 Ga0068852_101923167 Ga0068852_1019231671 114
60 3300005618 Ga0068864_100067471 Ga0068864_1000674712 114
61 3300005719 Ga0068861_102136372 Ga0068861_1021363721 114
62 3300005834 Ga0068851_10517408 Ga0068851_105174082 114
63 3300005834 Ga0068851_10789701 Ga0068851_107897012 114
64 3300005844 Ga0068862_100117268 Ga0068862_1001172683 114
65 3300005937 Ga0081455_10069875 Ga0081455_100698753 114
66 3300005937 Ga0081455_10634720 Ga0081455_106347202 114
67 3300006871 Ga0075434_100079620 Ga0075434_1000796206 114
68 3300006871 Ga0075434_101518328 Ga0075434_1015183281 114
69 3300009011 Ga0105251_10009571 Ga0105251_100095711 114
70 3300009011 Ga0105251_10041820 Ga0105251_100418201 114
71 3300009011 Ga0105251_10355206 Ga0105251_103552062 114
72 3300009093 Ga0105240_10401977 Ga0105240_104019772 114
73 3300009098 Ga0105245_10292851 Ga0105245_102928512 114
74 3300009177 Ga0105248_10033901 Ga0105248_100339017 114
75 3300009177 Ga0105248_10789238 Ga0105248_107892382 114
76 3300009545 Ga0105237_10304947 Ga0105237_103049473 114
77 3300009551 Ga0105238_11448502 Ga0105238_114485021 114
78 3300010375 Ga0105239_10334075 Ga0105239_103340754 114
79 3300010375 Ga0105239_11966382 Ga0105239_119663822 114
80 3300011119 Ga0105246_10038129 Ga0105246_100381292 114
81 3300013100 Ga0157373_10016392 Ga0157373_100163927 114
82 3300013102 Ga0157371_10125782 Ga0157371_101257822 114
83 3300013105 Ga0157369_10046975 Ga0157369_100469752 114
84 3300013296 Ga0157374_10470047 Ga0157374_104700472 114
85 3300013307 Ga0157372_10323185 Ga0157372_103231852 114
86 3300013307 Ga0157372_10471672 Ga0157372_104716722 114
87 3300013307 Ga0157372_11174695 Ga0157372_111746952 114
88 3300013307 Ga0157372_12630379 Ga0157372_126303792 114
89 3300013308 Ga0157375_10098844 Ga0157375_100988442 114
90 3300013308 Ga0157375_13109115 Ga0157375_131091152 114
91 3300014325 Ga0163163_10932713 Ga0163163_109327131 114
92 3300014325 Ga0163163_11383223 Ga0163163_113832231 114
93 3300014326 Ga0157380_10011760 Ga0157380_100117602 114
94 3300014745 Ga0157377_10175154 Ga0157377_101751542 114
95 3300014969 Ga0157376_10236018 Ga0157376_102360182 114
96 3300017792 Ga0163161_10228156 Ga0163161_102281562 114
97 3300017792 Ga0163161_11747548 Ga0163161_117475481 114
98 3300025298 Ga0209050_1000131 Ga0209050_1000131141 114
99 3300025304 Ga0209257_1000028 Ga0209257_1000028507 114
100 3300025321 Ga0207656_10215048 Ga0207656_102150482 114
101 3300025913 Ga0207695_10280352 Ga0207695_102803522 114
102 3300025926 Ga0207659_11222823 Ga0207659_112228231 114
103 3300025932 Ga0207690_10112691 Ga0207690_101126914 114
104 3300025940 Ga0207691_11624660 Ga0207691_116246602 114
105 3300025944 Ga0207661_10032654 Ga0207661_100326543 114
106 3300025944 Ga0207661_10159516 Ga0207661_101595161 114
107 3300025944 Ga0207661_10642907 Ga0207661_106429072 114
108 3300025944 Ga0207661_11473107 Ga0207661_114731072 114
109 3300025945 Ga0207679_10210049 Ga0207679_102100492 114
110 3300025981 Ga0207640_10221534 Ga0207640_102215341 114
111 3300026035 Ga0207703_10020018 Ga0207703_100200185 114
112 3300026041 Ga0207639_11181868 Ga0207639_111818681 114
113 3300026067 Ga0207678_10111685 Ga0207678_101116852 114
114 3300026067 Ga0207678_11039594 Ga0207678_110395942 114
115 3300026095 Ga0207676_10070351 Ga0207676_100703512 114
116 3300026121 Ga0207683_10299637 Ga0207683_102996371 114
117 3300026142 Ga0207698_10044863 Ga0207698_100448632 114
118 3300026142 Ga0207698_10250266 Ga0207698_102502662 114
119 3300027471 Ga0209995_1011603 Ga0209995_10116032 114
120 3300027526 Ga0209968_1011821 Ga0209968_10118212 114
121 3300028379 Ga0268266_10084997 Ga0268266_100849973 114
122 3300028379 Ga0268266_10564851 Ga0268266_105648511 114
123 3300030733 Ga0314311_1187631 Ga0314311_11876312 114
124 3300031548 Ga0307408_100000183 Ga0307408_10000018327 114
125 3300031595 Ga0265313_10394885 Ga0265313_103948851 114
126 3300031911 Ga0307412_10000007 Ga0307412_10000007423 114
127 3300031911 Ga0307412_10000090 Ga0307412_1000009049 114
128 3300032002 Ga0307416_100000074 Ga0307416_10000007421 114
129 3300032004 Ga0307414_10000210 Ga0307414_100002105 114
130 3300032004 Ga0307414_10001048 Ga0307414_1000104811 114
131 3300032004 Ga0307414_10665373 Ga0307414_106653731 114
132 3300032005 Ga0307411_11776830 Ga0307411_117768301 114
133 3300032133 Ga0316583_10056911 Ga0316583_100569112 114
134 3300035398 Ga0316574_0139438 Ga0316574_0139438_1040_1399 114
135 3300037312 Ga0395899_0292804 Ga0395899_0292804_704_1063 114
136 3300037418 Ga0395900_0008764 Ga0395900_0008764_151_510 114
137 3300037471 Ga0395905_0003216 Ga0395905_0003216_14744_15103 114
138 3300037471 Ga0395905_0353330 Ga0395905_0353330_584_946 114
139 3300038443 Ga0395901_0341224 Ga0395901_0341224_192_551 114
140 3300039093 Ga0400489_51479 Ga0400489_51479_334_687 114
141 3300039437 Ga0436365_1744812 Ga0436365_1744812_104_460 114
142 3300041404 Ga0439436_0011058 Ga0439436_0011058_1606_1962 114
143 3300041406 Ga0439439_0009101 Ga0439439_0009101_1649_2005 114
144 3300041407 Ga0439447_029072 Ga0439447_029072_562_918 114
145 3300041410 Ga0439461_0000006 Ga0439461_0000006_3035_3391 114
146 3300041410 Ga0439461_0002516 Ga0439461_0002516_1609_1965 114
147 3300041411 Ga0439466_0049628 Ga0439466_0049628_563_919 114
148 3300041413 Ga0439465_0001487 Ga0439465_0001487_3566_3922 114
149 3300041413 Ga0439465_0002971 Ga0439465_0002971_2278_2634 114
150 3300041452 Ga0451793_1654308 Ga0451793_1654308_186_539 114
151 3300041997 Ga0439431_0001707 Ga0439431_0001707_3933_4289 114
152 3300041997 Ga0439431_0049781 Ga0439431_0049781_435_791 114
153 3300041999 Ga0439433_0038918 Ga0439433_0038918_47_403 114
154 3300042002 Ga0439442_022250 Ga0439442_022250_820_1176 114
155 3300042004 Ga0439445_0001765 Ga0439445_0001765_3861_4217 114
156 3300042006 Ga0439432_003283 Ga0439432_003283_1338_1694 114
157 3300042006 Ga0439432_218529 Ga0439432_218529_176_532 114
158 3300042010 Ga0439452_014362 Ga0439452_014362_1292_1648 114
159 3300042010 Ga0439452_041465 Ga0439452_041465_277_633 114
160 3300042014 Ga0439457_011835 Ga0439457_011835_924_1280 114
161 3300042015 Ga0439462_0001975 Ga0439462_0001975_574_930 114
162 3300042015 Ga0439462_0002607 Ga0439462_0002607_1341_1697 114
163 3300042127 Ga0450890_091623 Ga0450890_091623_53_409 114
164 3300042134 Ga0450898_045659 Ga0450898_045659_333_689 114
165 3300042156 Ga0439446_0012952 Ga0439446_0012952_725_1081 114
166 3300042435 Ga0439434_0010784 Ga0439434_0010784_1045_1401 114
167 3300042435 Ga0439434_0014213 Ga0439434_0014213_1260_1616 114
168 3300042876 Ga0451577_0554197 Ga0451577_0554197_189_539 114
169 3300044684 Ga0466966_0105797 Ga0466966_0105797_596_940 114
170 3300044712 Ga0453684_0017547 Ga0453684_0017547_8212_8562 114
171 3300044712 Ga0453684_0474832 Ga0453684_0474832_331_690 114
172 3300044712 Ga0453684_2463873 Ga0453684_2463873_110_469 114
173 3300045049 Ga0466959_0028485 Ga0466959_0028485_2725_3075 114
174 3300046471 Ga0495650_0111948 Ga0495650_0111948_479_838 114
175 3300048907 Ga0496104_0170693 Ga0496104_0170693_1352_1717 114
176 3300048911 Ga0496108_1755148 Ga0496108_1755148_118_474 114
177 3300048913 Ga0496110_0271545 Ga0496110_0271545_1085_1450 114
178 3300048914 Ga0496111_0272827 Ga0496111_0272827_599_964 114
179 3300048915 Ga0496112_0013431 Ga0496112_0013431_2898_3263 114
180 3300048916 Ga0496113_0290419 Ga0496113_0290419_186_551 114
181 3300049649 Ga0501198_010179 Ga0501198_010179_855_1214 114
182 3300049663 Ga0501223_002936 Ga0501223_002936_704_1063 114
183 3300049822 Ga0501035_0241088 Ga0501035_0241088_175_531 114
184 3300050512 nmdc:mga0n895_1284982_c1 nmdc:mga0n895_1284982_c1_149_514 114
185 3300050513 nmdc:mga0rr50_254630_c1 nmdc:mga0rr50_254630_c1_121_483 114
186 3300059421 Ga0590071_074017 Ga0590071_074017_238_597 114
187 3300059426 Ga0590077_014022 Ga0590077_014022_127_486 114
188 3300060353 Ga0501082_0988649 Ga0501082_0988649_266_631 114
189 3300060353 Ga0501082_1541155 Ga0501082_1541155_198_545 114
190 3300061734 Ga0530510_0216348 Ga0530510_0216348_366_731 114
191 3300005329 Ga0070683_100390173 Ga0070683_1003901732 115
192 3300003322 rootL2_10295686 rootL2_102956863 118
193 3300003323 rootH1_10008472 rootH1_100084724 118
194 3300041494 Ga0451837_1080444 Ga0451837_1080444_76_441 118
195 3300049574 Ga0501038_0538571 Ga0501038_0538571_362_724 118
196 3300049742 Ga0501080_1041435 Ga0501080_1041435_285_647 118
197 3300049823 Ga0501044_0401216 Ga0501044_0401216_652_1017 118
198 3300039062 Ga0400483_110888 Ga0400483_110888_74_448 119
199 3300049571 Ga0501034_0084804 Ga0501034_0084804_2555_2926 120
200 3300013308 Ga0157375_12344947 Ga0157375_123449472 122
201 iso_pu_bacteria 2554235234 2555257865 122
202 iso_pu_bacteria 2971820967 2971823650 122
203 3300013296 Ga0157374_10922166 Ga0157374_109221661 123
204 3300003320 rootH2_10031359 rootH2_100313592 126
205 3300009011 Ga0105251_10000015 Ga0105251_100000153 126
206 3300009174 Ga0105241_10071277 Ga0105241_100712773 126
207 3300013296 Ga0157374_10404167 Ga0157374_104041672 126
208 3300025735 Ga0207713_1000003 Ga0207713_1000003489 126

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07366

SnoaL

SnoaL-like polyketide cyclase

26

132

0.92

PF12680

SnoaL_2

SnoaL-like domain

29

121

0.9

PF13474

SnoaL_3

SnoaL-like domain

26

86

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5yao-assembly2.cif.gz_B the complex structure of sz529 and expoxid 0.9168 15 114
3ff2-assembly1.cif.gz_A-2 crystal structure of an uncharacterized cystatin fold protein (saro_2299) from novosphingobium aromaticivorans dsm at 1.90 a resolution 0.9042 13 114
6f50-assembly2.cif.gz_B crystal structure of ketosteroid isomerase double variant v88i/l99v 0.8954 15 118
1w01-assembly1.cif.gz_A crystal structure of mutant enzyme y57f/d103l of ketosteroid isomerase from pseudomonas putida biotype b 0.8938 15 118
4u13-assembly1.cif.gz_B crystal structure of putative polyketide cyclase (protein sma1630) from sinorhizobium meliloti at 2.3 a resolution 0.8931 17 114
ID Description Score Start End Superfamily
af_Q67TV5_62_185_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9162 13 116 3.10.450.50
af_A0A096RDL4_404_511_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9106 10 36 1.25.40.10
af_P96815_13_143_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8937 18 123 3.10.450.50
af_A0A1D8PFJ5_540_877_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8891 73 104 2.130.10.10
af_Q55CV2_31_144_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8881 19 117 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A366U690-F1-model_v4 deleted 1 13 101
AF-A0A6N3BX37-F1-model_v4 SnoaL-like domain protein 0.997 13 91
AF-A0A2J6I869-F1-model_v4 Steroid delta-isomerase 0.9967 13 126 GO:0016853
AF-A0A699Y5P4-F1-model_v4 deleted 0.9952 14 125
AF-A0A100ZUJ5-F1-model_v4 deleted 0.9948 13 125

Feature Viewer

pLDDT pTM Quality
91.66 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map