F317640

General Info

Members Datasets Scaffolds Average Seq Length
208 140 416 123

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100011163|Ga0075428_1000111631
Length 146
Sequence MANRPMRRTLGQEAWFRRLGVSGIPLIEIVGLDHVQLAMPAGREETARAFYSGVLGLIEETKPPNLAVRGGVWFRGGALRLHLGVDRQFHAAGKAHPAILVRGLSELAARCAAAGFPPVTDEPLAGFERVYVFDPFGNRIELLERQ

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
10 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
13 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
14 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
15 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
16 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
17 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
18 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
19 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
20 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
21 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
22 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
23 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
34 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
35 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
36 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
37 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
38 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
39 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
53 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
54 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
55 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
56 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
57 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
58 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
59 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
60 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
61 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
62 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
63 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
64 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
65 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
66 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
67 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
68 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
69 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
70 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
71 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
72 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
73 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
74 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
75 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
76 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
77 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
78 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
79 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
80 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
81 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
82 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
83 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
84 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
85 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
86 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
87 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
88 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
89 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
90 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
91 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
92 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
93 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
94 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
95 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
96 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
97 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
98 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
99 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
100 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
101 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
102 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
116 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
117 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
118 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
119 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
120 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
121 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
122 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
123 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
124 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
125 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
127 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
128 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
129 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
130 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
131 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
132 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
133 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
134 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
135 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
136 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
137 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
138 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
139 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
140 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.52
Metatranscriptomes 0
Isolates 0.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.44
Rhizosphere 97.12
Stem 0
Stem Tuber 0
Unclassified 22.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100011163 3300006844 Bacteria 9995
2 Ga0065707_10000719 3300005295 Bacteria 13761
3 Ga0065707_10085808 3300005295 Bacteria 5849
4 Ga0065707_10406055 3300005295 Unclassified 847
5 Ga0070670_100982228 3300005331 Unclassified 767
6 Ga0070689_100360786 3300005340 Bacteria 1221
7 Ga0070689_102062201 3300005340 Unclassified 522
8 Ga0070674_101640753 3300005356 Unclassified 580
9 Ga0070673_100160515 3300005364 Bacteria 1911
10 Ga0070709_10047350 3300005434 Bacteria 2678
11 Ga0070711_100090057 3300005439 Bacteria 2208
12 Ga0070678_100814336 3300005456 Unclassified 849
13 Ga0068867_102041515 3300005459 Bacteria 542
14 Ga0070698_100096059 3300005471 Bacteria 2940
15 Ga0070698_101168607 3300005471 Unclassified 718
16 Ga0070697_100621621 3300005536 Bacteria 950
17 Ga0070696_100782146 3300005546 Bacteria 784
18 Ga0070704_100673481 3300005549 Unclassified 915
19 Ga0068857_100323764 3300005577 Unclassified 1424
20 Ga0068859_100322825 3300005617 Bacteria 1638
21 Ga0068870_10713630 3300005840 Unclassified 693
22 Ga0068863_100572213 3300005841 Bacteria 1117
23 Ga0068860_101657102 3300005843 Unclassified 662
24 Ga0070716_100000825 3300006173 Bacteria 13357
25 Ga0070716_100203588 3300006173 Bacteria 1317
26 Ga0070712_100002454 3300006175 Bacteria 11431
27 Ga0070712_100036399 3300006175 Bacteria 3349
28 Ga0070712_100979132 3300006175 Unclassified 731
29 Ga0070712_101821250 3300006175 Bacteria 533
30 Ga0097621_100188439 3300006237 Bacteria 1785
31 Ga0068871_100578295 3300006358 Unclassified 1020
32 Ga0075428_100095275 3300006844 Bacteria 3245
33 Ga0075428_100305565 3300006844 Unclassified 1710
34 Ga0075431_100279458 3300006847 Bacteria 1690
35 Ga0075431_100313100 3300006847 Unclassified 1584
36 Ga0075433_10000708 3300006852 Bacteria 22771
37 Ga0075433_10013107 3300006852 Bacteria 6726
38 Ga0075434_100002442 3300006871 Bacteria 16355
39 Ga0075434_100097791 3300006871 Bacteria 2940
40 Ga0075434_100352723 3300006871 Bacteria 1492
41 Ga0075429_100006856 3300006880 Bacteria 9885
42 Ga0075429_100653041 3300006880 Unclassified 921
43 Ga0111539_10119135 3300009094 Bacteria 3094
44 Ga0111539_10301051 3300009094 Unclassified 1866
45 Ga0105245_10729188 3300009098 Unclassified 1026
46 Ga0114129_10020708 3300009147 Bacteria 9347
47 Ga0105243_10043398 3300009148 Bacteria 3524
48 Ga0105243_10055656 3300009148 Bacteria 3143
49 Ga0105248_10386058 3300009177 Bacteria 1577
50 Ga0105248_10444175 3300009177 Bacteria 1461
51 Ga0105249_10027016 3300009553 Bacteria 5177
52 Ga0105249_10371829 3300009553 Bacteria 1453
53 Ga0157378_11107507 3300013297 Unclassified 829
54 Ga0163162_10463334 3300013306 Bacteria 1399
55 Ga0157380_10282484 3300014326 Bacteria 1520
56 Ga0157380_11153109 3300014326 Bacteria 816
57 Ga0157377_11228287 3300014745 Bacteria 582
58 Ga0157376_10304301 3300014969 Bacteria 1510
59 Ga0157376_10769803 3300014969 Unclassified 973
60 Ga0207692_10095422 3300025898 Bacteria 1622
61 Ga0207699_10089289 3300025906 Bacteria 1931
62 Ga0207643_10151280 3300025908 Bacteria 1391
63 Ga0207693_10007151 3300025915 Bacteria 9203
64 Ga0207693_10023337 3300025915 Bacteria 4912
65 Ga0207663_10026495 3300025916 Bacteria 3366
66 Ga0207663_11535548 3300025916 Bacteria 536
67 Ga0207663_11693090 3300025916 Unclassified 509
68 Ga0207709_10127966 3300025935 Unclassified 1726
69 Ga0207709_10405413 3300025935 Unclassified 1043
70 Ga0207670_10135106 3300025936 Bacteria 1812
71 Ga0207665_10002440 3300025939 Bacteria 12569
72 Ga0207665_10081934 3300025939 Bacteria 2223
73 Ga0207689_10948013 3300025942 Bacteria 726
74 Ga0207712_10373632 3300025961 Bacteria 1191
75 Ga0207674_11384084 3300026116 Unclassified 673
76 Ga0207683_10196198 3300026121 Unclassified 1834
77 Ga0207683_10481478 3300026121 Bacteria 1145
78 Ga0268265_10764648 3300028380 Bacteria 939
79 Ga0307515_10032318 3300028794 Bacteria 8676
80 Ga0307408_100588393 3300031548 Bacteria 987
81 Ga0307408_101274182 3300031548 Bacteria 688
82 Ga0307408_102447182 3300031548 Unclassified 507
83 Ga0307405_10495220 3300031731 Unclassified 978
84 Ga0307413_10172829 3300031824 Bacteria 1531
85 Ga0307410_10032836 3300031852 Bacteria 3346
86 Ga0307406_10386491 3300031901 Unclassified 1105
87 Ga0307407_10015746 3300031903 Bacteria 3748
88 Ga0307412_10059376 3300031911 Unclassified 2563
89 Ga0307409_100501212 3300031995 Unclassified 1182
90 Ga0307416_102358251 3300032002 Bacteria 632
91 Ga0307411_10049802 3300032005 Bacteria 2725
92 Ga0307415_100638111 3300032126 Unclassified 953
93 Ga0373949_0234932 3300035090 Unclassified 562
94 Ga0373953_0062337 3300035117 Bacteria 1527
95 Ga0373957_0003302 3300035120 Bacteria 4753
96 Ga0373943_0123130 3300035170 Bacteria 1380
97 Ga0373962_0253380 3300035242 Unclassified 612
98 Ga0373933_0006064 3300035724 Bacteria 6577
99 Ga0373947_0046418 3300035725 Bacteria 2602
100 Ga0373937_0001352 3300036401 Bacteria 20518
101 Ga0373925_0357799 3300037068 Bacteria 1186
102 Ga0436360_1087539 3300039438 Bacteria 2981
103 Ga0439446_0248190 3300042156 Bacteria 613
104 Ga0451577_0624490 3300042876 Unclassified 977
105 Ga0453683_0175691 3300044673 Bacteria 1357
106 Ga0453684_0000074 3300044712 Bacteria 438364
107 Ga0453684_0094547 3300044712 Bacteria 3677
108 Ga0453684_0161914 3300044712 Bacteria 2646
109 Ga0453684_0312415 3300044712 Bacteria 1783
110 Ga0453684_0341990 3300044712 Viruses 1689
111 Ga0453684_0917416 3300044712 Bacteria 937
112 Ga0453684_1081263 3300044712 Unclassified 848
113 Ga0453684_1164535 3300044712 Unclassified 811
114 Ga0453684_1550350 3300044712 Bacteria 682
115 Ga0453684_1605269 3300044712 Bacteria 667
116 Ga0453684_2407076 3300044712 Unclassified 521
117 Ga0495592_0000846 3300046454 Bacteria 21193
118 Ga0495651_0003223 3300046462 Bacteria 12532
119 Ga0495580_0032525 3300046472 Unclassified 3764
120 Ga0495580_0655387 3300046472 Bacteria 690
121 Ga0495628_0000644 3300046516 Bacteria 31918
122 Ga0495652_0029112 3300046529 Bacteria 4852
123 Ga0495640_0026067 3300046533 Bacteria 4231
124 Ga0495587_0068628 3300046536 Bacteria 2065
125 Ga0495645_0027622 3300046543 Bacteria 4123
126 Ga0495667_0006179 3300046559 Bacteria 8117
127 Ga0495625_0030712 3300046660 Bacteria 4005
128 Ga0495635_0007141 3300046663 Bacteria 7807
129 Ga0495657_0033480 3300046675 Bacteria 3577
130 Ga0495623_0009313 3300046679 Bacteria 6376
131 Ga0495604_0010173 3300047317 Bacteria 7450
132 Ga0495674_0058087 3300047319 Bacteria 3384
133 Ga0495680_0007435 3300047322 Bacteria 10046
134 Ga0495684_0046182 3300047471 Bacteria 3332
135 Ga0495602_0004542 3300048088 Bacteria 14482
136 Ga0496101_0682959 3300048904 Bacteria 811
137 Ga0496109_0000047 3300048912 Bacteria 130578
138 Ga0496109_0488080 3300048912 Bacteria 1163
139 Ga0496123_0000020 3300048926 Bacteria 388748
140 Ga0496124_0285340 3300048927 Bacteria 1201
141 Ga0501295_059264 3300049518 Unclassified 835
142 Ga0501299_062680 3300049522 Bacteria 791
143 Ga0501031_0053340 3300049568 Bacteria 2634
144 Ga0501032_0041137 3300049569 Bacteria 3140
145 Ga0501033_0074817 3300049570 Bacteria 2486
146 Ga0501033_0089004 3300049570 Bacteria 2258
147 Ga0501033_0300337 3300049570 Bacteria 1130
148 Ga0501034_0082595 3300049571 Bacteria 3214
149 Ga0501034_0652383 3300049571 Bacteria 954
150 Ga0501036_0284179 3300049572 Bacteria 1384
151 Ga0501037_0048050 3300049573 Bacteria 3127
152 Ga0501037_0289825 3300049573 Bacteria 1139
153 Ga0501038_0095272 3300049574 Bacteria 2486
154 Ga0501038_0222523 3300049574 Bacteria 1505
155 Ga0501039_0549135 3300049575 Bacteria 906
156 Ga0501040_1327677 3300049576 Unclassified 522
157 Ga0501042_0337178 3300049578 Bacteria 1090
158 Ga0501043_0085058 3300049579 Bacteria 2485
159 Ga0501047_0029971 3300049581 Bacteria 5245
160 Ga0501047_0084392 3300049581 Bacteria 3052
161 Ga0501048_0082778 3300049582 Bacteria 2263
162 Ga0501067_0127811 3300049583 Bacteria 1414
163 Ga0501069_0069324 3300049585 Bacteria 1974
164 Ga0501070_0001936 3300049586 Bacteria 18277
165 Ga0501070_1311403 3300049586 Bacteria 552
166 Ga0501072_0795643 3300049588 Unclassified 741
167 Ga0501073_0014140 3300049589 Bacteria 5797
168 Ga0501074_0128246 3300049590 Bacteria 1815
169 Ga0501076_0220074 3300049592 Bacteria 1552
170 Ga0501076_0468612 3300049592 Bacteria 1037
171 Ga0501243_046372 3300049675 Bacteria 775
172 Ga0501080_0089505 3300049742 Bacteria 2859
173 Ga0501080_0287799 3300049742 Bacteria 1493
174 Ga0501081_1229871 3300049743 Unclassified 568
175 Ga0501035_0003566 3300049822 Bacteria 14870
176 Ga0501035_0109552 3300049822 Bacteria 2420
177 Ga0501035_0233582 3300049822 Bacteria 1566
178 Ga0501035_1531916 3300049822 Bacteria 508
179 Ga0501044_0006461 3300049823 Bacteria 12947
180 Ga0501044_0141896 3300049823 Bacteria 2390
181 Ga0501044_0450655 3300049823 Bacteria 1193
182 nmdc:mga05p37_1562_c1 3300050507 Bacteria 26607
183 nmdc:mga05p37_297716_c1 3300050507 Bacteria 1918
184 nmdc:mga09592_1444611_c1 3300050508 Unclassified 561
185 nmdc:mga09592_6209_c1 3300050508 Bacteria 9722
186 nmdc:mga09592_763658_c1 3300050508 Bacteria 820
187 nmdc:mga09592_86698_c1 3300050508 Unclassified 2672
188 nmdc:mga09592_929967_c1 3300050508 Unclassified 730
189 nmdc:mga0qj67_59506_c1 3300050509 Bacteria 3029
190 nmdc:mga06r32_1037001_c1 3300050510 Bacteria 771
191 nmdc:mga06r32_516925_c1 3300050510 Bacteria 1170
192 nmdc:mga06r32_601941_c1 3300050510 Bacteria 1070
193 nmdc:mga08y16_113544_c1 3300050511 Bacteria 2820
194 nmdc:mga08y16_248536_c1 3300050511 Bacteria 1838
195 nmdc:mga08y16_454017_c1 3300050511 Unclassified 1307
196 nmdc:mga0n895_23310_c1 3300050512 Bacteria 5815
197 nmdc:mga0n895_473963_c1 3300050512 Bacteria 1263
198 nmdc:mga0n895_626747_c1 3300050512 Bacteria 1076
199 nmdc:mga08x19_165594_c1 3300050514 Bacteria 1503
200 nmdc:mga0a205_1424014_c1 3300050515 Unclassified 541
201 nmdc:mga0a205_3683_c1 3300050515 Bacteria 13719
202 Ga0495601_0000172 3300053077 Bacteria 34585
203 Ga0495612_0000133 3300053078 Bacteria 31528
204 Ga0495595_0097308 3300053084 Bacteria 1417
205 Ga0495619_0000150 3300053085 Bacteria 51375
206 Ga0530510_0286740 3300061734 Bacteria 1231
207 Ga0530510_0751963 3300061734 Bacteria 743
208 2585397966 2582581866 Bacteria 6859583
209 Ga0075428_100011163
210 Ga0065707_10000719
211 Ga0065707_10085808
212 Ga0065707_10406055
213 Ga0070670_100982228
214 Ga0070689_100360786
215 Ga0070689_102062201
216 Ga0070674_101640753
217 Ga0070673_100160515
218 Ga0070709_10047350
219 Ga0070711_100090057
220 Ga0070678_100814336
221 Ga0068867_102041515
222 Ga0070698_100096059
223 Ga0070698_101168607
224 Ga0070697_100621621
225 Ga0070696_100782146
226 Ga0070704_100673481
227 Ga0068857_100323764
228 Ga0068859_100322825
229 Ga0068870_10713630
230 Ga0068863_100572213
231 Ga0068860_101657102
232 Ga0070716_100000825
233 Ga0070716_100203588
234 Ga0070712_100002454
235 Ga0070712_100036399
236 Ga0070712_100979132
237 Ga0070712_101821250
238 Ga0097621_100188439
239 Ga0068871_100578295
240 Ga0075428_100095275
241 Ga0075428_100305565
242 Ga0075431_100279458
243 Ga0075431_100313100
244 Ga0075433_10000708
245 Ga0075433_10013107
246 Ga0075434_100002442
247 Ga0075434_100097791
248 Ga0075434_100352723
249 Ga0075429_100006856
250 Ga0075429_100653041
251 Ga0111539_10119135
252 Ga0111539_10301051
253 Ga0105245_10729188
254 Ga0114129_10020708
255 Ga0105243_10043398
256 Ga0105243_10055656
257 Ga0105248_10386058
258 Ga0105248_10444175
259 Ga0105249_10027016
260 Ga0105249_10371829
261 Ga0157378_11107507
262 Ga0163162_10463334
263 Ga0157380_10282484
264 Ga0157380_11153109
265 Ga0157377_11228287
266 Ga0157376_10304301
267 Ga0157376_10769803
268 Ga0207692_10095422
269 Ga0207699_10089289
270 Ga0207643_10151280
271 Ga0207693_10007151
272 Ga0207693_10023337
273 Ga0207663_10026495
274 Ga0207663_11535548
275 Ga0207663_11693090
276 Ga0207709_10127966
277 Ga0207709_10405413
278 Ga0207670_10135106
279 Ga0207665_10002440
280 Ga0207665_10081934
281 Ga0207689_10948013
282 Ga0207712_10373632
283 Ga0207674_11384084
284 Ga0207683_10196198
285 Ga0207683_10481478
286 Ga0268265_10764648
287 Ga0307515_10032318
288 Ga0307408_100588393
289 Ga0307408_101274182
290 Ga0307408_102447182
291 Ga0307405_10495220
292 Ga0307413_10172829
293 Ga0307410_10032836
294 Ga0307406_10386491
295 Ga0307407_10015746
296 Ga0307412_10059376
297 Ga0307409_100501212
298 Ga0307416_102358251
299 Ga0307411_10049802
300 Ga0307415_100638111
301 Ga0373949_0234932
302 Ga0373953_0062337
303 Ga0373957_0003302
304 Ga0373943_0123130
305 Ga0373962_0253380
306 Ga0373933_0006064
307 Ga0373947_0046418
308 Ga0373937_0001352
309 Ga0373925_0357799
310 Ga0436360_1087539
311 Ga0439446_0248190
312 Ga0451577_0624490
313 Ga0453683_0175691
314 Ga0453684_0000074
315 Ga0453684_0094547
316 Ga0453684_0161914
317 Ga0453684_0312415
318 Ga0453684_0341990
319 Ga0453684_0917416
320 Ga0453684_1081263
321 Ga0453684_1164535
322 Ga0453684_1550350
323 Ga0453684_1605269
324 Ga0453684_2407076
325 Ga0495592_0000846
326 Ga0495651_0003223
327 Ga0495580_0032525
328 Ga0495580_0655387
329 Ga0495628_0000644
330 Ga0495652_0029112
331 Ga0495640_0026067
332 Ga0495587_0068628
333 Ga0495645_0027622
334 Ga0495667_0006179
335 Ga0495625_0030712
336 Ga0495635_0007141
337 Ga0495657_0033480
338 Ga0495623_0009313
339 Ga0495604_0010173
340 Ga0495674_0058087
341 Ga0495680_0007435
342 Ga0495684_0046182
343 Ga0495602_0004542
344 Ga0496101_0682959
345 Ga0496109_0000047
346 Ga0496109_0488080
347 Ga0496123_0000020
348 Ga0496124_0285340
349 Ga0501295_059264
350 Ga0501299_062680
351 Ga0501031_0053340
352 Ga0501032_0041137
353 Ga0501033_0074817
354 Ga0501033_0089004
355 Ga0501033_0300337
356 Ga0501034_0082595
357 Ga0501034_0652383
358 Ga0501036_0284179
359 Ga0501037_0048050
360 Ga0501037_0289825
361 Ga0501038_0095272
362 Ga0501038_0222523
363 Ga0501039_0549135
364 Ga0501040_1327677
365 Ga0501042_0337178
366 Ga0501043_0085058
367 Ga0501047_0029971
368 Ga0501047_0084392
369 Ga0501048_0082778
370 Ga0501067_0127811
371 Ga0501069_0069324
372 Ga0501070_0001936
373 Ga0501070_1311403
374 Ga0501072_0795643
375 Ga0501073_0014140
376 Ga0501074_0128246
377 Ga0501076_0220074
378 Ga0501076_0468612
379 Ga0501243_046372
380 Ga0501080_0089505
381 Ga0501080_0287799
382 Ga0501081_1229871
383 Ga0501035_0003566
384 Ga0501035_0109552
385 Ga0501035_0233582
386 Ga0501035_1531916
387 Ga0501044_0006461
388 Ga0501044_0141896
389 Ga0501044_0450655
390 nmdc:mga05p37_1562_c1
391 nmdc:mga05p37_297716_c1
392 nmdc:mga09592_1444611_c1
393 nmdc:mga09592_6209_c1
394 nmdc:mga09592_763658_c1
395 nmdc:mga09592_86698_c1
396 nmdc:mga09592_929967_c1
397 nmdc:mga0qj67_59506_c1
398 nmdc:mga06r32_1037001_c1
399 nmdc:mga06r32_516925_c1
400 nmdc:mga06r32_601941_c1
401 nmdc:mga08y16_113544_c1
402 nmdc:mga08y16_248536_c1
403 nmdc:mga08y16_454017_c1
404 nmdc:mga0n895_23310_c1
405 nmdc:mga0n895_473963_c1
406 nmdc:mga0n895_626747_c1
407 nmdc:mga08x19_165594_c1
408 nmdc:mga0a205_1424014_c1
409 nmdc:mga0a205_3683_c1
410 Ga0495601_0000172
411 Ga0495612_0000133
412 Ga0495595_0097308
413 Ga0495619_0000150
414 Ga0530510_0286740
415 Ga0530510_0751963
416 2585397966

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

31

142

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qqz-assembly1.cif.gz_B crystal structure of putative glyoxalase family protein from bacillus anthracis 0.9051 1 121
2qqz-assembly1.cif.gz_B crystal structure of putative glyoxalase family protein from bacillus anthracis 0.891 1 121
2p7l-assembly4.cif.gz_A crystal structure of monoclinic form of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes at ph 5.75 0.8333 2 121
2p7q-assembly4.cif.gz_A crystal structure of e126q mutant of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes complexed with mn(ii) and 1s,2s-dihydroxypropylphosphonic acid 0.8249 2 121
2p7p-assembly2.cif.gz_D crystal structure of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes complexed with mn(ii) and sulfate ion 0.8237 2 121
ID Description Score Start End Superfamily
2qqzB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9045 7 121 3.10.180.10
2qqzB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8969 7 121 3.10.180.10
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8379 70 121 3.30.720.110
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8217 68 120 3.30.720.110
2p7kA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8174 2 121 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A136KXW9-F1-model_v4 Glyoxalase/bleomycin resistance protein/dioxygenase 0.9809 1 121 GO:0051213
AF-A0A7Y9LG20-F1-model_v4 GNAT superfamily N-acetyltransferase 0.9808 8 121 GO:0016747
AF-A0A537VLQ6-F1-model_v4 Glyoxalase 0.98 13 121
AF-A0A849IS11-F1-model_v4 Glyoxalase 0.9793 13 121
AF-A0A165X6C6-F1-model_v4 Glyoxalase-like domain protein 0.9763 1 121

Map