F317185

General Info

Members Datasets Scaffolds Average Seq Length
207 167 414 307

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8056054917|8056055574
Length 351
Sequence YHPTGSTPKSKRMHNRSQFDYVLGPNVPRDRRFRGADMPYRTATQDWDVHRLPSAEGKNFLVTGGNAGIGYFVAEQLASTGAQVILGSRDSTKAASAAAAIRSRVPDARVRHLRLDLAELAGLKSSVDALELDRLDAIVCNAGVLLDHPQRRADLDGRELMFATNHLGHFALTGWLAPLLSAAPAGRVVTTGSFVAKSARLDLADLQVTSGYEPKDAYARSKLAQMLFAFELDRRLRAAGSTTASVVNHPGGALDLLTPSRPPVHTRTKGQWLRGLPASILLQGKHAAAWPAVRAVLDPAVRGGQMWGPRMLGLRGRPRLEPVRGALADTALAARLWTACVDLTGLDPFAQ

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
14 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
15 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
16 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
17 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
18 3300013875 Rhizosphere microbial communities from switchgrass unharvested rhizosphere in Austin, TX, USA - RS_233 Metagenome Rhizosphere
19 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
20 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
21 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
22 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
23 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
24 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
31 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
32 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
33 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
34 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
35 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
36 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
37 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
38 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
39 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
40 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
41 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
42 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
43 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
44 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
45 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
46 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
47 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
48 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
49 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
50 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
51 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
52 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
53 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
54 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
55 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
56 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
57 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
58 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
59 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
60 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
61 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
62 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
63 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
64 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
65 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
66 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
67 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
68 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
69 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
70 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
71 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
72 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
73 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
74 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
75 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
76 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
77 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
78 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
79 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
80 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
81 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
82 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
83 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
84 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
85 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
86 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
87 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
88 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
89 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
90 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
91 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
92 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
93 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
94 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
95 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
96 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
110 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
113 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
114 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
115 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
116 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
117 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
118 8056054917 Glycomyces luteolus NEAU-A15 Isolate Rhizosphere
119 2501939600 Micromonospora sp. L5 Isolate Unclassified
120 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
121 2519899620 Rhizobium sp. Pop5 Isolate Nodule
122 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
123 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
124 2558860280 Kutzneria sp. 744 Isolate Unclassified
125 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
126 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
127 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
128 2643221572 Leifsonia sp. Root60 Isolate Unclassified
129 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
130 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
131 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
132 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
133 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
134 2808606448 Streptomyces sp. 193411 Isolate Unclassified
135 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
136 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
137 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
138 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
139 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
140 2838048938 Rhizobium pisi 27/80 Isolate Nodule
141 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
142 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
143 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
144 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
145 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
146 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
147 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
148 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
149 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
150 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
151 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
152 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
153 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
154 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
155 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
156 641522639 Methylobacterium sp. 4-46 Isolate Nodule
157 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
158 649633069 Micromonospora sp. L5 Isolate Unclassified
159 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
160 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
161 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
162 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
163 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
164 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
165 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
166 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
167 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 73.91
Metatranscriptomes 0
Isolates 26.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.31
Nodule 3.38
Rhizoplane 1.45
Rhizosphere 66.18
Stem 0
Stem Tuber 0
Unclassified 1.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10025406 3300003316 Bacteria 18733
2 rootH1_10177698 3300003316 Unclassified 1955
3 rootL2_10241669 3300003322 Bacteria 1303
4 rootH1_10020804 3300003323 Bacteria 7974
5 JGI25160J50197_1009507 3300003354 Bacteria 3599
6 JGI25160J50197_1011941 3300003354 Bacteria 3045
7 Ga0070670_100121142 3300005331 Bacteria 2257
8 Ga0070682_100133446 3300005337 Bacteria 1683
9 Ga0068868_100052814 3300005338 Bacteria 3200
10 Ga0070671_100010281 3300005355 Bacteria 7507
11 Ga0070714_100004306 3300005435 Bacteria 10731
12 Ga0070663_100016522 3300005455 Bacteria 4797
13 Ga0070706_100001287 3300005467 Bacteria 26755
14 Ga0070679_100537842 3300005530 Bacteria 1112
15 Ga0068852_100222134 3300005616 Bacteria 1797
16 Ga0068862_100089889 3300005844 Bacteria 2673
17 Ga0114129_10022249 3300009147 Bacteria 9000
18 Ga0105035_101401 3300009988 Bacteria 1667
19 Ga0157370_10115610 3300013104 Bacteria 2506
20 Ga0157515_113003 3300013875 Bacteria 1599
21 Ga0163163_10452850 3300014325 Bacteria 1344
22 Ga0183361_10019 3300016635 Bacteria 129849
23 Ga0213872_10066202 3300021361 Bacteria 1631
24 Ga0213876_10046942 3300021384 Bacteria 2284
25 Ga0207426_1004213 3300025302 Bacteria 7153
26 Ga0207426_1004456 3300025302 Bacteria 6824
27 Ga0207426_1005704 3300025302 Bacteria 5615
28 Ga0207426_1024800 3300025302 Bacteria 2030
29 Ga0207684_10003002 3300025910 Bacteria 16722
30 Ga0207652_10255056 3300025921 Bacteria 1582
31 Ga0207644_10185788 3300025931 Bacteria 1632
32 Ga0207678_10000470 3300026067 Bacteria 36474
33 Ga0268265_10020920 3300028380 Bacteria 4573
34 Ga0268264_10260666 3300028381 Bacteria 1615
35 Ga0307513_10103137 3300031456 Bacteria 2869
36 Ga0307513_10232168 3300031456 Bacteria 1657
37 Ga0307509_10017354 3300031507 Bacteria 8288
38 Ga0307508_10006061 3300031616 Bacteria 11408
39 Ga0307514_10045907 3300031649 Bacteria 3415
40 Ga0316576_10029337 3300031727 Bacteria 3887
41 Ga0316576_10101073 3300031727 Bacteria 2155
42 Ga0316577_10055858 3300031733 Bacteria 2203
43 Ga0316577_10217393 3300031733 Bacteria 1080
44 Ga0307518_10011349 3300031838 Bacteria 6367
45 Ga0307507_10149541 3300033179 Bacteria 1762
46 Ga0307510_10089060 3300033180 Bacteria 2941
47 Ga0307510_10194575 3300033180 Bacteria 1571
48 Ga0373951_0000322 3300035091 Bacteria 14947
49 Ga0316574_0118182 3300035398 Bacteria 1701
50 Ga0316574_0126902 3300035398 Bacteria 1640
51 Ga0373935_0030951 3300035692 Bacteria 3317
52 Ga0316584_0141024 3300036712 Bacteria 1797
53 Ga0436364_0310840 3300037853 Unclassified 2134
54 Ga0436365_0694208 3300039437 Unclassified 1658
55 Ga0436361_1123694 3300039447 Bacteria 3517
56 Ga0439436_0023839 3300041404 Bacteria 1809
57 Ga0439439_0045880 3300041406 Bacteria 1140
58 Ga0439433_0028452 3300041999 Bacteria 1271
59 Ga0439449_0005954 3300042007 Bacteria 4658
60 Ga0439449_0008953 3300042007 Bacteria 3796
61 Ga0439457_001310 3300042014 Bacteria 7456
62 Ga0450898_004066 3300042134 Bacteria 2139
63 Ga0439446_0022243 3300042156 Bacteria 1797
64 Ga0466966_0202205 3300044684 Bacteria 1202
65 Ga0466957_0151388 3300044842 Bacteria 1500
66 Ga0495603_0010829 3300046455 Bacteria 5533
67 Ga0495603_0028173 3300046455 Bacteria 3388
68 Ga0495590_0000115 3300046457 Bacteria 48176
69 Ga0495605_0124985 3300046474 Bacteria 1164
70 Ga0495585_0120041 3300046492 Bacteria 1391
71 Ga0495607_0127473 3300046501 Bacteria 1329
72 Ga0495583_0031430 3300046506 Bacteria 2573
73 Ga0495606_0133405 3300046507 Bacteria 1474
74 Ga0495620_0052713 3300046515 Bacteria 1726
75 Ga0495628_0023010 3300046516 Bacteria 5115
76 Ga0495632_0088797 3300046519 Bacteria 1468
77 Ga0495643_0001202 3300046522 Bacteria 25157
78 Ga0495648_0013394 3300046524 Bacteria 6068
79 Ga0495652_0101889 3300046529 Bacteria 2327
80 Ga0495640_0031496 3300046533 Bacteria 3784
81 Ga0495667_0190142 3300046559 Bacteria 1316
82 Ga0495668_0023686 3300046616 Bacteria 3498
83 Ga0495634_0031920 3300046642 Bacteria 3625
84 Ga0495625_0042516 3300046660 Bacteria 3301
85 Ga0495635_0020531 3300046663 Bacteria 4602
86 Ga0495623_0102747 3300046679 Bacteria 1740
87 Ga0495613_0041824 3300046689 Bacteria 3392
88 Ga0495670_0126021 3300046691 Bacteria 1333
89 Ga0495589_0014876 3300046794 Bacteria 4003
90 Ga0495589_0034379 3300046794 Bacteria 2545
91 Ga0495600_0030380 3300046809 Bacteria 3500
92 Ga0495604_0046816 3300047317 Bacteria 3371
93 Ga0495674_0154324 3300047319 Bacteria 1924
94 Ga0495672_0138036 3300047320 Bacteria 1276
95 Ga0495676_0010456 3300047321 Bacteria 8415
96 Ga0495676_0105578 3300047321 Bacteria 2076
97 Ga0495680_0024317 3300047322 Bacteria 5025
98 Ga0495683_0059215 3300047323 Bacteria 1901
99 Ga0495687_009781 3300047443 Bacteria 5327
100 Ga0495687_044679 3300047443 Bacteria 1923
101 Ga0495675_0052461 3300047444 Bacteria 2589
102 Ga0495685_010184 3300047447 Bacteria 3151
103 Ga0495593_0053430 3300047673 Bacteria 2132
104 Ga0495602_0250448 3300048088 Bacteria 1320
105 Ga0496108_0000140 3300048911 Bacteria 70345
106 Ga0496121_0073648 3300048924 Bacteria 2736
107 Ga0496122_0001892 3300048925 Bacteria 31688
108 Ga0496123_0000845 3300048926 Bacteria 48945
109 Ga0496124_0286208 3300048927 Bacteria 1199
110 Ga0496126_0029315 3300048929 Bacteria 5229
111 Ga0501031_0010477 3300049568 Bacteria 6039
112 Ga0501031_0015525 3300049568 Bacteria 4943
113 Ga0501032_0007163 3300049569 Bacteria 8165
114 Ga0501032_0009960 3300049569 Bacteria 6862
115 Ga0501033_0015082 3300049570 Bacteria 5863
116 Ga0501034_0019489 3300049571 Bacteria 6938
117 Ga0501034_0065327 3300049571 Bacteria 3650
118 Ga0501034_0092788 3300049571 Bacteria 3015
119 Ga0501034_0165794 3300049571 Bacteria 2178
120 Ga0501034_0253585 3300049571 Bacteria 1703
121 Ga0501034_0400947 3300049571 Bacteria 1294
122 Ga0501036_0023004 3300049572 Bacteria 5247
123 Ga0501037_0000697 3300049573 Bacteria 25622
124 Ga0501037_0012404 3300049573 Bacteria 6275
125 Ga0501037_0053754 3300049573 Bacteria 2946
126 Ga0501038_0044547 3300049574 Bacteria 3853
127 Ga0501039_0013590 3300049575 Bacteria 6226
128 Ga0501042_0026211 3300049578 Bacteria 4097
129 Ga0501043_0013540 3300049579 Bacteria 6382
130 Ga0501043_0029485 3300049579 Bacteria 4311
131 Ga0501046_0008850 3300049580 Bacteria 8744
132 Ga0501046_0013620 3300049580 Bacteria 6878
133 Ga0501046_0040374 3300049580 Bacteria 3729
134 Ga0501046_0045994 3300049580 Bacteria 3464
135 Ga0501047_0021593 3300049581 Bacteria 6182
136 Ga0501047_0283376 3300049581 Bacteria 1501
137 Ga0501048_0011895 3300049582 Bacteria 6490
138 Ga0501048_0029122 3300049582 Bacteria 4006
139 Ga0501073_0016152 3300049589 Bacteria 5410
140 Ga0501035_0062967 3300049822 Bacteria 3299
141 Ga0501035_0079238 3300049822 Bacteria 2901
142 Ga0501035_0112093 3300049822 Bacteria 2390
143 Ga0501044_0035151 3300049823 Bacteria 5249
144 Ga0501044_0078120 3300049823 Bacteria 3355
145 Ga0501044_0098969 3300049823 Bacteria 2935
146 Ga0501044_0243223 3300049823 Bacteria 1742
147 Ga0501045_0252678 3300049824 Bacteria 1312
148 nmdc:mga05p37_24165_c1 3300050507 Bacteria 7383
149 Ga0500592_001489 3300053116 Bacteria 3802
150 Ga0500568_0009671 3300053139 Bacteria 4565
151 Ga0500568_0009832 3300053139 Bacteria 4519
152 Ga0500588_0014210 3300053146 Bacteria 2013
153 Ga0500616_0003129 3300053153 Bacteria 12940
154 8056055574 8056054917 Bacteria 5736694
155 2501945695 2501939600 Bacteria 6907073
156 2513595425 2513237088 Bacteria 6927906
157 2520375853 2519899620 Bacteria 6499161
158 2524439374 2524023205 Bacteria 8918781
159 2545678690 2545555834 Bacteria 8130841
160 2559431759 2558860280 Bacteria 11429938
161 2586061636 2585427649 Bacteria 9053857
162 2616696454 2616644814 Bacteria 11555299
163 2616901640 2616644941 Bacteria 8510691
164 2643876911 2643221572 Bacteria 3614809
165 2644383966 2643221669 Bacteria 3611286
166 2772643735 2772190715 Bacteria 6959372
167 2784592739 2784132148 Bacteria 8627943
168 2785345932 2784746763 Bacteria 9783172
169 2793978357 2791355406 Bacteria 11364898
170 2809229031 2808606448 Bacteria 8656184
171 2809590273 2808606522 Bacteria 9488490
172 2812353428 2811994879 Bacteria 9313447
173 2816511283 2816332139 Bacteria 9138787
174 2819744940 2818991472 Bacteria 10089953
175 2831938549 2831935698 Bacteria 5963223
176 2838050326 2838048938 Bacteria 6044578
177 2856860275 2856858025 Bacteria 7255264
178 2862994416 2862993130 Bacteria 3860849
179 2867512891 2867507094 Bacteria 6506033
180 2869075037 2869068681 Bacteria 7205615
181 2880491886 2880489317 Bacteria 7096270
182 2880501942 2880495981 Bacteria 7340502
183 2891559430 2891554331 Bacteria 8812224
184 2895662311 2895660088 Bacteria 3782833
185 2912728101 2912723979 Bacteria 8557534
186 2915773275 2915768154 Bacteria 8424322
187 2917742230 2917736166 Bacteria 9690793
188 2928962963 2928959182 Bacteria 4725774
189 2929230911 2929226422 Bacteria 7248583
190 2946072317 2946064051 Bacteria 8957905
191 2947232970 2947224130 Bacteria 9938529
192 641646743 641522639 Bacteria 7737025
193 643604327 643348564 Bacteria 8839022
194 649810977 649633069 Bacteria 6962533
195 8023626742 8023623736 Bacteria 8593882
196 8025538170 8025530807 Bacteria 8495698
197 8047718607 8047710418 Bacteria 11023148
198 8047896513 8047893842 Bacteria 11723082
199 8047898144 8047893842 Bacteria 11723082
200 8048360749 8048356638 Bacteria 11044339
201 8048362422 8048356638 Bacteria 11044339
202 8048373527 8048369669 Bacteria 11666822
203 8048375107 8048369669 Bacteria 11666822
204 8048383099 8048379754 Bacteria 11877923
205 8048384715 8048379754 Bacteria 11877923
206 8054166302 8054160619 Bacteria 7783213
207 8056454268 8056447290 Bacteria 7680491
208 rootH1_10025406
209 rootH1_10177698
210 rootL2_10241669
211 rootH1_10020804
212 JGI25160J50197_1009507
213 JGI25160J50197_1011941
214 Ga0070670_100121142
215 Ga0070682_100133446
216 Ga0068868_100052814
217 Ga0070671_100010281
218 Ga0070714_100004306
219 Ga0070663_100016522
220 Ga0070706_100001287
221 Ga0070679_100537842
222 Ga0068852_100222134
223 Ga0068862_100089889
224 Ga0114129_10022249
225 Ga0105035_101401
226 Ga0157370_10115610
227 Ga0157515_113003
228 Ga0163163_10452850
229 Ga0183361_10019
230 Ga0213872_10066202
231 Ga0213876_10046942
232 Ga0207426_1004213
233 Ga0207426_1004456
234 Ga0207426_1005704
235 Ga0207426_1024800
236 Ga0207684_10003002
237 Ga0207652_10255056
238 Ga0207644_10185788
239 Ga0207678_10000470
240 Ga0268265_10020920
241 Ga0268264_10260666
242 Ga0307513_10103137
243 Ga0307513_10232168
244 Ga0307509_10017354
245 Ga0307508_10006061
246 Ga0307514_10045907
247 Ga0316576_10029337
248 Ga0316576_10101073
249 Ga0316577_10055858
250 Ga0316577_10217393
251 Ga0307518_10011349
252 Ga0307507_10149541
253 Ga0307510_10089060
254 Ga0307510_10194575
255 Ga0373951_0000322
256 Ga0316574_0118182
257 Ga0316574_0126902
258 Ga0373935_0030951
259 Ga0316584_0141024
260 Ga0436364_0310840
261 Ga0436365_0694208
262 Ga0436361_1123694
263 Ga0439436_0023839
264 Ga0439439_0045880
265 Ga0439433_0028452
266 Ga0439449_0005954
267 Ga0439449_0008953
268 Ga0439457_001310
269 Ga0450898_004066
270 Ga0439446_0022243
271 Ga0466966_0202205
272 Ga0466957_0151388
273 Ga0495603_0010829
274 Ga0495603_0028173
275 Ga0495590_0000115
276 Ga0495605_0124985
277 Ga0495585_0120041
278 Ga0495607_0127473
279 Ga0495583_0031430
280 Ga0495606_0133405
281 Ga0495620_0052713
282 Ga0495628_0023010
283 Ga0495632_0088797
284 Ga0495643_0001202
285 Ga0495648_0013394
286 Ga0495652_0101889
287 Ga0495640_0031496
288 Ga0495667_0190142
289 Ga0495668_0023686
290 Ga0495634_0031920
291 Ga0495625_0042516
292 Ga0495635_0020531
293 Ga0495623_0102747
294 Ga0495613_0041824
295 Ga0495670_0126021
296 Ga0495589_0014876
297 Ga0495589_0034379
298 Ga0495600_0030380
299 Ga0495604_0046816
300 Ga0495674_0154324
301 Ga0495672_0138036
302 Ga0495676_0010456
303 Ga0495676_0105578
304 Ga0495680_0024317
305 Ga0495683_0059215
306 Ga0495687_009781
307 Ga0495687_044679
308 Ga0495675_0052461
309 Ga0495685_010184
310 Ga0495593_0053430
311 Ga0495602_0250448
312 Ga0496108_0000140
313 Ga0496121_0073648
314 Ga0496122_0001892
315 Ga0496123_0000845
316 Ga0496124_0286208
317 Ga0496126_0029315
318 Ga0501031_0010477
319 Ga0501031_0015525
320 Ga0501032_0007163
321 Ga0501032_0009960
322 Ga0501033_0015082
323 Ga0501034_0019489
324 Ga0501034_0065327
325 Ga0501034_0092788
326 Ga0501034_0165794
327 Ga0501034_0253585
328 Ga0501034_0400947
329 Ga0501036_0023004
330 Ga0501037_0000697
331 Ga0501037_0012404
332 Ga0501037_0053754
333 Ga0501038_0044547
334 Ga0501039_0013590
335 Ga0501042_0026211
336 Ga0501043_0013540
337 Ga0501043_0029485
338 Ga0501046_0008850
339 Ga0501046_0013620
340 Ga0501046_0040374
341 Ga0501046_0045994
342 Ga0501047_0021593
343 Ga0501047_0283376
344 Ga0501048_0011895
345 Ga0501048_0029122
346 Ga0501073_0016152
347 Ga0501035_0062967
348 Ga0501035_0079238
349 Ga0501035_0112093
350 Ga0501044_0035151
351 Ga0501044_0078120
352 Ga0501044_0098969
353 Ga0501044_0243223
354 Ga0501045_0252678
355 nmdc:mga05p37_24165_c1
356 Ga0500592_001489
357 Ga0500568_0009671
358 Ga0500568_0009832
359 Ga0500588_0014210
360 Ga0500616_0003129
361 8056055574
362 2501945695
363 2513595425
364 2520375853
365 2524439374
366 2545678690
367 2559431759
368 2586061636
369 2616696454
370 2616901640
371 2643876911
372 2644383966
373 2772643735
374 2784592739
375 2785345932
376 2793978357
377 2809229031
378 2809590273
379 2812353428
380 2816511283
381 2819744940
382 2831938549
383 2838050326
384 2856860275
385 2862994416
386 2867512891
387 2869075037
388 2880491886
389 2880501942
390 2891559430
391 2895662311
392 2912728101
393 2915773275
394 2917742230
395 2928962963
396 2929230911
397 2946072317
398 2947232970
399 641646743
400 643604327
401 649810977
402 8023626742
403 8025538170
404 8047718607
405 8047896513
406 8047898144
407 8048360749
408 8048362422
409 8048373527
410 8048375107
411 8048383099
412 8048384715
413 8054166302
414 8056454268

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

58

252

0.95

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

64

208

0.92

PF08659

KR

KR domain

59

231

0.82

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

60

241

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rd5-assembly1.cif.gz_A crystal structure of a putative uncharacterized protein from mycobacterium paratuberculosis 0.9127 9 309
3rd5-assembly1.cif.gz_A crystal structure of a putative uncharacterized protein from mycobacterium paratuberculosis 0.8929 9 309
8g9m-assembly1.cif.gz_A acinetobacter_baumannii short-chain dehydrogenase 0.8653 13 213
2p68-assembly1.cif.gz_B-2 crystal structure of aq_1716 from aquifex aeolicus vf5 0.8576 13 216
2q45-assembly1.cif.gz_A ensemble refinement of the protein crystal structure of putative tropinone reductase from arabidopsis thaliana gene at1g07440 0.8516 16 215
ID Description Score Start End Superfamily
af_A0A368UI72_22_109_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9327 11 93 3.40.50.720
3rd5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9127 9 309 3.40.50.720
af_Q95QH4_36_248_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9055 19 213 3.40.50.720
af_O53537_4_315_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9008 9 309 3.40.50.720
af_O53726_7_311_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8952 6 309 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A665WFJ7-F1-model_v4 Retinol dehydrogenase 12-like 0.9511 15 201 GO:0016491
AF-A0A560UXZ6-F1-model_v4 NAD(P)-dependent dehydrogenase (Short-subunit alcohol dehydrogenase family) 0.9439 8 213 GO:0016491
AF-A0A7N9I966-F1-model_v4 Zinc finger BED-type containing 1 0.9408 9 216 GO:0005576
GO:0010508
GO:0016491
AF-A0A7S0XD79-F1-model_v4 Protochlorophyllide reductase 0.9402 13 188 GO:0016491
AF-R7U5E6-F1-model_v4 Uncharacterized protein 0.9334 15 127 GO:0016491

Map