F317028

General Info

Members Datasets Scaffolds Average Seq Length
207 155 204 358

Family's Representative Sequence

Representative Sequence 3300049581|Ga0501047_0001253|Ga0501047_0001253_11520_12755
Length 411
Sequence MRSIELGTQEPTARGPWVPDRPAGIAVELLAQLHCLSRDTGAGVRNDEVFEPAMTETTTPQADFTGTKPVEERHRLDEASLTRWLEANVDGFKGPLTLNQFKGGQSNPTYQLVTPTKKYVLRKKPSGKLLPSAHAVDREYRVISALYPTGFPVARPYALCEDDSIVGAMFYVMDMVEGRILWNGALPDSDPAERRAIYENKIATLAKLHMTDYAAIGLSDYGKAGNYFARQIDRWSKQYKLSETENIDEMNRLIEWLPQTIPAGERTSIVHGDYRLDNMVLHATEPRVLAVLDWELSTLGDPLGDFTYYLMSWVMPHDGRANLDGLDLKALGIPTIEETVALYCAQTRRDGIPDLDWYFAYNAFRLAGILQGIAGRVRDGTAASAHAAQMIQRIRPLAQAAYSFAQKAGLK

Samples

Sample ID Description Type Environment
1 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
2 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
3 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
4 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
28 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
31 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
32 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
46 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
47 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
83 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
84 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
85 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
86 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
87 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
88 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
89 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
90 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
91 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
92 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
93 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
94 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
95 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
96 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
97 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
98 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
99 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
100 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
101 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
102 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
103 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
104 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
105 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
106 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
107 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
108 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
109 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
110 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
111 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
112 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
113 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
114 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
115 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
116 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
117 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
118 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
119 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
120 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
121 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
122 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
123 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
124 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
125 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
126 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
127 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
128 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
129 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
130 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
131 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
132 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
133 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
134 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
135 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
136 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
137 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
138 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
139 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
140 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
142 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
143 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
144 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
145 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
146 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
147 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
148 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
149 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
150 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
151 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
152 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
153 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
154 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
155 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.55
Metatranscriptomes 0
Isolates 1.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.8
Nodule 0.48
Rhizoplane 7.73
Rhizosphere 80.68
Stem 0
Stem Tuber 0
Unclassified 5.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000291 3300001904 Bacteria 9171
2 JGI24737J22298_10000085 3300001990 Bacteria 27466
3 JGI24737J22298_10001421 3300001990 Bacteria 8518
4 JGI24735J21928_10001487 3300002067 Bacteria 8297
5 JGI24751J29686_10000084 3300002459 Bacteria 52362
6 Ga0055530_10019404 3300003791 Bacteria 2061
7 Ga0070658_10100507 3300005327 Bacteria 2391
8 Ga0070670_100070546 3300005331 Bacteria 2999
9 Ga0070670_100239326 3300005331 Bacteria 1580
10 Ga0070666_10026816 3300005335 Bacteria 3768
11 Ga0070668_100000378 3300005347 Bacteria 29470
12 Ga0070675_100153766 3300005354 Bacteria 1974
13 Ga0070671_100000063 3300005355 Bacteria 72834
14 Ga0070667_100000145 3300005367 Bacteria 89528
15 Ga0070663_100008274 3300005455 Bacteria 6390
16 Ga0070662_100185939 3300005457 Bacteria 1640
17 Ga0070665_100331651 3300005548 Bacteria 1526
18 Ga0070664_100005210 3300005564 Bacteria 10423
19 Ga0068854_100016467 3300005578 Bacteria 4930
20 Ga0068854_100266155 3300005578 Bacteria 1374
21 Ga0068856_100281766 3300005614 Bacteria 1679
22 Ga0068864_100098141 3300005618 Unclassified 2594
23 Ga0068863_100000723 3300005841 Bacteria 33109
24 Ga0068863_100001090 3300005841 Bacteria 27124
25 Ga0068863_100068537 3300005841 Bacteria 3356
26 Ga0068860_100000942 3300005843 Bacteria 32259
27 Ga0068860_100010487 3300005843 Bacteria 9158
28 Ga0068860_100028005 3300005843 Bacteria 5425
29 Ga0068862_100089437 3300005844 Bacteria 2680
30 Ga0070717_10001949 3300006028 Bacteria 14418
31 Ga0075363_100004491 3300006048 Bacteria 6114
32 Ga0070716_100007159 3300006173 Bacteria 5483
33 Ga0070712_100125256 3300006175 Bacteria 1939
34 Ga0075367_10038269 3300006178 Bacteria 2792
35 Ga0075366_10000662 3300006195 Bacteria 16222
36 Ga0105251_10015458 3300009011 Bacteria 4171
37 Ga0105240_10033689 3300009093 Bacteria 6614
38 Ga0105240_10061364 3300009093 Bacteria 4685
39 Ga0105240_10272106 3300009093 Bacteria 1949
40 Ga0105240_10499188 3300009093 Bacteria 1353
41 Ga0105243_10219997 3300009148 Bacteria 1678
42 Ga0105241_10000932 3300009174 Bacteria 22159
43 Ga0105248_10095267 3300009177 Bacteria 3351
44 Ga0105237_10005047 3300009545 Bacteria 15017
45 Ga0105237_10384407 3300009545 Bacteria 1408
46 Ga0105238_10010486 3300009551 Bacteria 9301
47 Ga0105238_10019952 3300009551 Bacteria 6824
48 Ga0105238_10033761 3300009551 Bacteria 5206
49 Ga0105249_10305702 3300009553 Bacteria 1597
50 Ga0157373_10026331 3300013100 Bacteria 4202
51 Ga0157370_10103525 3300013104 Bacteria 2665
52 Ga0157369_10219999 3300013105 Bacteria 1988
53 Ga0157378_10239935 3300013297 Bacteria 1731
54 Ga0163162_10120536 3300013306 Bacteria 2727
55 Ga0163162_10284665 3300013306 Bacteria 1785
56 Ga0157379_10000433 3300014968 Bacteria 33887
57 Ga0163161_10014911 3300017792 Bacteria 5413
58 Ga0209050_1000253 3300025298 Bacteria 114525
59 Ga0207688_10083150 3300025901 Bacteria 1831
60 Ga0207680_10038294 3300025903 Bacteria 2775
61 Ga0207680_10128955 3300025903 Bacteria 1664
62 Ga0207647_10008832 3300025904 Bacteria 7191
63 Ga0207705_10057586 3300025909 Bacteria 2803
64 Ga0207705_10105330 3300025909 Bacteria 2079
65 Ga0207654_10005706 3300025911 Bacteria 6290
66 Ga0207695_10023828 3300025913 Bacteria 6909
67 Ga0207695_10126168 3300025913 Bacteria 2521
68 Ga0207695_10171694 3300025913 Bacteria 2094
69 Ga0207671_10128159 3300025914 Bacteria 1946
70 Ga0207693_10031643 3300025915 Bacteria 4180
71 Ga0207662_10045220 3300025918 Bacteria 2602
72 Ga0207657_10007386 3300025919 Bacteria 11272
73 Ga0207657_10120397 3300025919 Bacteria 2160
74 Ga0207652_10054467 3300025921 Bacteria 3439
75 Ga0207694_10033911 3300025924 Bacteria 3912
76 Ga0207694_10052089 3300025924 Bacteria 3173
77 Ga0207694_10182932 3300025924 Bacteria 1700
78 Ga0207650_10170613 3300025925 Bacteria 1729
79 Ga0207700_10003874 3300025928 Bacteria 8743
80 Ga0207644_10000075 3300025931 Bacteria 72848
81 Ga0207706_10051149 3300025933 Bacteria 3649
82 Ga0207665_10001038 3300025939 Bacteria 18711
83 Ga0207691_10033780 3300025940 Bacteria 4762
84 Ga0207691_10105850 3300025940 Bacteria 2506
85 Ga0207689_10033166 3300025942 Bacteria 4291
86 Ga0207689_10243850 3300025942 Bacteria 1485
87 Ga0207679_10069071 3300025945 Bacteria 2657
88 Ga0207651_10114271 3300025960 Bacteria 2033
89 Ga0207668_10000022 3300025972 Bacteria 135782
90 Ga0207668_10051493 3300025972 Bacteria 2844
91 Ga0207640_10031924 3300025981 Bacteria 3261
92 Ga0207640_10079122 3300025981 Bacteria 2240
93 Ga0207640_10088075 3300025981 Bacteria 2142
94 Ga0207658_10000021 3300025986 Bacteria 201456
95 Ga0207658_10000103 3300025986 Bacteria 93261
96 Ga0207703_10075482 3300026035 Bacteria 2794
97 Ga0207639_10000687 3300026041 Bacteria 23359
98 Ga0207678_10001199 3300026067 Bacteria 23772
99 Ga0207702_10013765 3300026078 Bacteria 6719
100 Ga0207702_10254232 3300026078 Bacteria 1651
101 Ga0207641_10000040 3300026088 Bacteria 192446
102 Ga0207641_10000344 3300026088 Bacteria 55824
103 Ga0207641_10026916 3300026088 Bacteria 4749
104 Ga0207641_10086856 3300026088 Bacteria 2728
105 Ga0207683_10009299 3300026121 Bacteria 8373
106 Ga0207683_10010727 3300026121 Bacteria 7812
107 Ga0207698_10009743 3300026142 Bacteria 6135
108 Ga0268266_10000005 3300028379 Bacteria 1448194
109 Ga0268266_10292549 3300028379 Bacteria 1517
110 Ga0268265_10019494 3300028380 Bacteria 4716
111 Ga0268265_10042193 3300028380 Bacteria 3383
112 Ga0268265_10097468 3300028380 Bacteria 2366
113 Ga0268264_10000351 3300028381 Bacteria 69834
114 Ga0268264_10003821 3300028381 Bacteria 12915
115 Ga0268264_10126275 3300028381 Bacteria 2261
116 Ga0265337_1008991 3300028556 Bacteria 3595
117 Ga0265338_10023474 3300028800 Bacteria 6339
118 Ga0265325_10000496 3300031241 Bacteria 28512
119 Ga0265325_10024633 3300031241 Bacteria 3272
120 Ga0265339_10069991 3300031249 Bacteria 1872
121 Ga0265331_10008155 3300031250 Bacteria 5979
122 Ga0265327_10000076 3300031251 Bacteria 212272
123 Ga0265316_10079378 3300031344 Bacteria 2518
124 Ga0307408_100025348 3300031548 Bacteria 4061
125 Ga0265313_10048905 3300031595 Bacteria 2038
126 Ga0316575_10037831 3300031665 Bacteria 1902
127 Ga0265314_10089904 3300031711 Bacteria 2002
128 Ga0265342_10036816 3300031712 Bacteria 2987
129 Ga0307413_10051012 3300031824 Bacteria 2490
130 Ga0307414_10042692 3300032004 Bacteria 3083
131 Ga0373927_0034683 3300035695 Bacteria 3281
132 Ga0395899_0025506 3300037312 Bacteria 4462
133 Ga0395900_0001141 3300037418 Bacteria 33489
134 Ga0395900_0341718 3300037418 Bacteria 1472
135 Ga0395898_0005037 3300037466 Bacteria 14324
136 Ga0395898_0087113 3300037466 Bacteria 3009
137 Ga0436364_0947217 3300037853 Bacteria 1470
138 Ga0395901_0027827 3300038443 Bacteria 5813
139 Ga0439441_025029 3300042001 Bacteria 1125
140 Ga0439435_0011738 3300042436 Bacteria 2106
141 Ga0466966_0055094 3300044684 Bacteria 2518
142 Ga0466963_0121116 3300044694 Bacteria 1801
143 Ga0466963_0373522 3300044694 Bacteria 1005
144 Ga0466970_0006016 3300044765 Bacteria 6049
145 Ga0466959_0120150 3300045049 Bacteria 1869
146 Ga0451576_0088662 3300045051 Bacteria 3218
147 Ga0466967_0000764 3300045976 Bacteria 16636
148 Ga0495629_0052268 3300046459 Bacteria 2859
149 Ga0495629_0058534 3300046459 Bacteria 2694
150 Ga0495638_0007551 3300046460 Bacteria 7778
151 Ga0495605_0046575 3300046474 Bacteria 2131
152 Ga0495664_0017340 3300046477 Bacteria 4114
153 Ga0495618_0000794 3300046514 Bacteria 22048
154 Ga0495586_0003466 3300046535 Bacteria 8457
155 Ga0495657_0033084 3300046675 Bacteria 3603
156 Ga0495658_0011944 3300046683 Bacteria 4383
157 Ga0495604_0006987 3300047317 Bacteria 8942
158 Ga0495672_0077550 3300047320 Bacteria 1862
159 Ga0495687_001030 3300047443 Bacteria 27749
160 Ga0495684_0105600 3300047471 Bacteria 2128
161 Ga0496101_0021178 3300048904 Bacteria 4463
162 Ga0496102_0020863 3300048905 Bacteria 5792
163 Ga0496103_0064531 3300048906 Bacteria 2283
164 Ga0496104_0011718 3300048907 Bacteria 7865
165 Ga0496106_0001852 3300048909 Bacteria 15826
166 Ga0496106_0153428 3300048909 Bacteria 1817
167 Ga0496107_0037517 3300048910 Bacteria 3477
168 Ga0496107_0049852 3300048910 Bacteria 3017
169 Ga0496109_0040805 3300048912 Bacteria 4204
170 Ga0496110_0062211 3300048913 Bacteria 3296
171 Ga0496111_0005620 3300048914 Bacteria 8065
172 Ga0496112_0000224 3300048915 Bacteria 36869
173 Ga0496112_0083365 3300048915 Bacteria 3161
174 Ga0496113_0000456 3300048916 Bacteria 19887
175 Ga0496113_0017102 3300048916 Bacteria 5027
176 Ga0496115_0002686 3300048918 Bacteria 12757
177 Ga0496116_0025567 3300048919 Bacteria 4339
178 Ga0496118_0018903 3300048921 Bacteria 6182
179 Ga0496121_0097857 3300048924 Bacteria 2272
180 Ga0496122_0012340 3300048925 Bacteria 8528
181 Ga0496122_0036889 3300048925 Bacteria 3944
182 Ga0496123_0003508 3300048926 Bacteria 17471
183 Ga0496123_0063859 3300048926 Bacteria 2349
184 Ga0496124_0010025 3300048927 Bacteria 9668
185 Ga0496124_0016334 3300048927 Bacteria 7063
186 Ga0501047_0001253 3300049581 Bacteria 25138
187 Ga0501072_0023767 3300049588 Bacteria 4760
188 Ga0501235_006266 3300049669 Bacteria 2591
189 Ga0501080_0015732 3300049742 Bacteria 6977
190 Ga0501080_0252081 3300049742 Bacteria 1609
191 Ga0501083_0003480 3300049744 Bacteria 11013
192 Ga0501083_0034702 3300049744 Bacteria 3449
193 nmdc:mga03683_10473_c1 3300050489 Bacteria 3326
194 nmdc:mga03n38_33073_c1 3300050490 Bacteria 2197
195 nmdc:mga06z11_4408_c1 3300050494 Bacteria 5542
196 nmdc:mga08x19_157366_c1 3300050514 Bacteria 1541
197 Ga0495601_0001229 3300053077 Bacteria 14066
198 Ga0495619_0000924 3300053085 Bacteria 19309
199 Ga0495619_0001250 3300053085 Bacteria 16655
200 Ga0500566_0055376 3300053094 Bacteria 2259
201 Ga0500641_0076595 3300053096 Bacteria 1415
202 Ga0500595_008093 3300053119 Bacteria 4312
203 Ga0500652_000014 3300053131 Bacteria 147740
204 Ga0501082_0000016 3300060353 Bacteria 115081

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050514 nmdc:mga08x19_157366_c1 nmdc:mga08x19_157366_c1_20_907 291
2 3300048916 Ga0496113_0017102 Ga0496113_0017102_4051_5010 298
3 3300042001 Ga0439441_025029 Ga0439441_025029_13_918 299
4 3300044694 Ga0466963_0373522 Ga0466963_0373522_48_962 302
5 3300044765 Ga0466970_0006016 Ga0466970_0006016_3306_4403 329
6 3300009093 Ga0105240_10033689 Ga0105240_100336894 349
7 3300025913 Ga0207695_10126168 Ga0207695_101261684 349
8 3300031250 Ga0265331_10008155 Ga0265331_100081555 349
9 3300031251 Ga0265327_10000076 Ga0265327_1000007676 349
10 3300009551 Ga0105238_10033761 Ga0105238_100337612 351
11 3300028380 Ga0268265_10097468 Ga0268265_100974682 351
12 3300047320 Ga0495672_0077550 Ga0495672_0077550_195_1268 351
13 3300009093 Ga0105240_10499188 Ga0105240_104991881 352
14 3300009551 Ga0105238_10010486 Ga0105238_100104865 352
15 3300025919 Ga0207657_10120397 Ga0207657_101203972 352
16 3300025924 Ga0207694_10182932 Ga0207694_101829322 352
17 3300028379 Ga0268266_10000005 Ga0268266_10000005242 352
18 3300028556 Ga0265337_1008991 Ga0265337_10089912 352
19 3300048918 Ga0496115_0002686 Ga0496115_0002686_2114_3196 352
20 3300048925 Ga0496122_0036889 Ga0496122_0036889_1189_2247 352
21 3300048926 Ga0496123_0003508 Ga0496123_0003508_12046_13104 352
22 3300049669 Ga0501235_006266 Ga0501235_006266_1223_2293 353
23 3300049742 Ga0501080_0015732 Ga0501080_0015732_3535_4617 353
24 3300049744 Ga0501083_0003480 Ga0501083_0003480_4366_5448 353
25 3300031665 Ga0316575_10037831 Ga0316575_100378312 354
26 3300044694 Ga0466963_0121116 Ga0466963_0121116_699_1775 354
27 iso_pu_bacteria 2643221547 2643755120 354
28 iso_pu_bacteria 2841974524 2841980665 354
29 3300002459 JGI24751J29686_10000084 JGI24751J29686_1000008433 355
30 3300005331 Ga0070670_100239326 Ga0070670_1002393261 355
31 3300005335 Ga0070666_10026816 Ga0070666_100268163 355
32 3300005347 Ga0070668_100000378 Ga0070668_10000037815 355
33 3300005355 Ga0070671_100000063 Ga0070671_10000006313 355
34 3300005367 Ga0070667_100000145 Ga0070667_10000014510 355
35 3300005841 Ga0068863_100000723 Ga0068863_10000072318 355
36 3300005841 Ga0068863_100001090 Ga0068863_10000109022 355
37 3300005841 Ga0068863_100068537 Ga0068863_1000685372 355
38 3300005843 Ga0068860_100000942 Ga0068860_10000094218 355
39 3300005843 Ga0068860_100010487 Ga0068860_1000104872 355
40 3300005843 Ga0068860_100028005 Ga0068860_1000280053 355
41 3300005844 Ga0068862_100089437 Ga0068862_1000894373 355
42 3300009177 Ga0105248_10095267 Ga0105248_100952672 355
43 3300013105 Ga0157369_10219999 Ga0157369_102199992 355
44 3300013306 Ga0163162_10120536 Ga0163162_101205362 355
45 3300014968 Ga0157379_10000433 Ga0157379_1000043323 355
46 3300025903 Ga0207680_10038294 Ga0207680_100382942 355
47 3300025925 Ga0207650_10170613 Ga0207650_101706132 355
48 3300025931 Ga0207644_10000075 Ga0207644_1000007545 355
49 3300025972 Ga0207668_10000022 Ga0207668_10000022112 355
50 3300025972 Ga0207668_10051493 Ga0207668_100514933 355
51 3300025986 Ga0207658_10000021 Ga0207658_1000002158 355
52 3300025986 Ga0207658_10000103 Ga0207658_100001036 355
53 3300026035 Ga0207703_10075482 Ga0207703_100754821 355
54 3300026088 Ga0207641_10000040 Ga0207641_1000004056 355
55 3300026088 Ga0207641_10000344 Ga0207641_1000034442 355
56 3300026088 Ga0207641_10026916 Ga0207641_100269162 355
57 3300026088 Ga0207641_10086856 Ga0207641_100868562 355
58 3300028380 Ga0268265_10019494 Ga0268265_100194944 355
59 3300028380 Ga0268265_10042193 Ga0268265_100421932 355
60 3300028381 Ga0268264_10000351 Ga0268264_1000035155 355
61 3300028381 Ga0268264_10003821 Ga0268264_1000382110 355
62 3300028381 Ga0268264_10126275 Ga0268264_101262752 355
63 3300045051 Ga0451576_0088662 Ga0451576_0088662_2056_3126 355
64 3300048904 Ga0496101_0021178 Ga0496101_0021178_63_1133 355
65 3300048905 Ga0496102_0020863 Ga0496102_0020863_2933_4003 355
66 3300048906 Ga0496103_0064531 Ga0496103_0064531_262_1332 355
67 3300048909 Ga0496106_0001852 Ga0496106_0001852_1015_2085 355
68 3300048910 Ga0496107_0049852 Ga0496107_0049852_1174_2244 355
69 3300048915 Ga0496112_0000224 Ga0496112_0000224_1656_2726 355
70 3300048916 Ga0496113_0000456 Ga0496113_0000456_12984_14054 355
71 3300048919 Ga0496116_0025567 Ga0496116_0025567_2126_3196 355
72 3300048921 Ga0496118_0018903 Ga0496118_0018903_3182_4252 355
73 3300048927 Ga0496124_0016334 Ga0496124_0016334_3448_4518 355
74 3300049581 Ga0501047_0001253 Ga0501047_0001253_11520_12755 355
75 3300005327 Ga0070658_10100507 Ga0070658_101005071 356
76 3300005331 Ga0070670_100070546 Ga0070670_1000705464 356
77 3300005618 Ga0068864_100098141 Ga0068864_1000981414 356
78 3300006028 Ga0070717_10001949 Ga0070717_100019497 356
79 3300006173 Ga0070716_100007159 Ga0070716_1000071594 356
80 3300006175 Ga0070712_100125256 Ga0070712_1001252562 356
81 3300009148 Ga0105243_10219997 Ga0105243_102199971 356
82 3300025909 Ga0207705_10105330 Ga0207705_101053303 356
83 3300025915 Ga0207693_10031643 Ga0207693_100316435 356
84 3300025921 Ga0207652_10054467 Ga0207652_100544673 356
85 3300025928 Ga0207700_10003874 Ga0207700_100038746 356
86 3300025939 Ga0207665_10001038 Ga0207665_1000103811 356
87 3300025940 Ga0207691_10033780 Ga0207691_100337802 356
88 3300025942 Ga0207689_10243850 Ga0207689_102438502 356
89 3300026078 Ga0207702_10254232 Ga0207702_102542322 356
90 3300026121 Ga0207683_10009299 Ga0207683_100092998 356
91 3300031241 Ga0265325_10000496 Ga0265325_1000049623 356
92 3300031249 Ga0265339_10069991 Ga0265339_100699911 356
93 3300046459 Ga0495629_0052268 Ga0495629_0052268_1446_2522 356
94 3300046675 Ga0495657_0033084 Ga0495657_0033084_300_1376 356
95 3300046683 Ga0495658_0011944 Ga0495658_0011944_2183_3259 356
96 3300047317 Ga0495604_0006987 Ga0495604_0006987_897_1973 356
97 3300047471 Ga0495684_0105600 Ga0495684_0105600_423_1499 356
98 3300048907 Ga0496104_0011718 Ga0496104_0011718_6256_7332 356
99 3300048909 Ga0496106_0153428 Ga0496106_0153428_177_1253 356
100 3300048910 Ga0496107_0037517 Ga0496107_0037517_565_1641 356
101 3300048914 Ga0496111_0005620 Ga0496111_0005620_2665_3741 356
102 3300048915 Ga0496112_0083365 Ga0496112_0083365_119_1195 356
103 3300049742 Ga0501080_0252081 Ga0501080_0252081_425_1510 356
104 3300053077 Ga0495601_0001229 Ga0495601_0001229_363_1439 356
105 3300053085 Ga0495619_0000924 Ga0495619_0000924_9486_10562 356
106 3300053094 Ga0500566_0055376 Ga0500566_0055376_51_1127 356
107 3300053119 Ga0500595_008093 Ga0500595_008093_1004_2080 356
108 iso_pu_bacteria 2775507255 2778125346 356
109 3300005614 Ga0068856_100281766 Ga0068856_1002817663 357
110 3300009093 Ga0105240_10061364 Ga0105240_100613642 357
111 3300013104 Ga0157370_10103525 Ga0157370_101035252 357
112 3300025913 Ga0207695_10171694 Ga0207695_101716942 357
113 3300025981 Ga0207640_10088075 Ga0207640_100880754 357
114 3300028800 Ga0265338_10023474 Ga0265338_100234743 357
115 3300031241 Ga0265325_10024633 Ga0265325_100246334 357
116 3300031595 Ga0265313_10048905 Ga0265313_100489053 357
117 3300037312 Ga0395899_0025506 Ga0395899_0025506_2860_3939 357
118 3300037418 Ga0395900_0341718 Ga0395900_0341718_257_1336 357
119 3300037466 Ga0395898_0087113 Ga0395898_0087113_136_1215 357
120 3300044684 Ga0466966_0055094 Ga0466966_0055094_475_1554 357
121 3300045049 Ga0466959_0120150 Ga0466959_0120150_47_1126 357
122 3300045976 Ga0466967_0000764 Ga0466967_0000764_15438_16517 357
123 3300047443 Ga0495687_001030 Ga0495687_001030_15443_16540 357
124 3300053131 Ga0500652_000014 Ga0500652_000014_110679_111758 357
125 3300001990 JGI24737J22298_10000085 JGI24737J22298_1000008526 358
126 3300025918 Ga0207662_10045220 Ga0207662_100452202 358
127 3300035695 Ga0373927_0034683 Ga0373927_0034683_364_1440 358
128 3300037418 Ga0395900_0001141 Ga0395900_0001141_21685_22767 358
129 3300037466 Ga0395898_0005037 Ga0395898_0005037_10739_11821 358
130 3300038443 Ga0395901_0027827 Ga0395901_0027827_170_1252 358
131 3300046459 Ga0495629_0058534 Ga0495629_0058534_1126_2202 358
132 3300046477 Ga0495664_0017340 Ga0495664_0017340_1191_2267 358
133 3300046514 Ga0495618_0000794 Ga0495618_0000794_2540_3616 358
134 3300046535 Ga0495586_0003466 Ga0495586_0003466_5037_6113 358
135 3300049588 Ga0501072_0023767 Ga0501072_0023767_1915_2997 358
136 3300049744 Ga0501083_0034702 Ga0501083_0034702_536_1618 358
137 3300053085 Ga0495619_0001250 Ga0495619_0001250_6815_7891 358
138 3300060353 Ga0501082_0000016 Ga0501082_0000016_32463_33545 358
139 3300005354 Ga0070675_100153766 Ga0070675_1001537661 359
140 3300005548 Ga0070665_100331651 Ga0070665_1003316512 359
141 3300005578 Ga0068854_100016467 Ga0068854_1000164673 359
142 3300006048 Ga0075363_100004491 Ga0075363_1000044916 359
143 3300006178 Ga0075367_10038269 Ga0075367_100382692 359
144 3300006195 Ga0075366_10000662 Ga0075366_100006623 359
145 3300009545 Ga0105237_10005047 Ga0105237_1000504710 359
146 3300009545 Ga0105237_10384407 Ga0105237_103844072 359
147 3300009551 Ga0105238_10019952 Ga0105238_100199522 359
148 3300013297 Ga0157378_10239935 Ga0157378_102399352 359
149 3300013306 Ga0163162_10284665 Ga0163162_102846652 359
150 3300025901 Ga0207688_10083150 Ga0207688_100831502 359
151 3300025903 Ga0207680_10128955 Ga0207680_101289552 359
152 3300025924 Ga0207694_10052089 Ga0207694_100520892 359
153 3300025940 Ga0207691_10105850 Ga0207691_101058502 359
154 3300025942 Ga0207689_10033166 Ga0207689_100331663 359
155 3300025945 Ga0207679_10069071 Ga0207679_100690712 359
156 3300025960 Ga0207651_10114271 Ga0207651_101142712 359
157 3300026121 Ga0207683_10010727 Ga0207683_100107277 359
158 3300028379 Ga0268266_10292549 Ga0268266_102925492 359
159 3300031344 Ga0265316_10079378 Ga0265316_100793784 359
160 3300031711 Ga0265314_10089904 Ga0265314_100899042 359
161 3300031712 Ga0265342_10036816 Ga0265342_100368162 359
162 3300037853 Ga0436364_0947217 Ga0436364_0947217_72_1160 359
163 3300042436 Ga0439435_0011738 Ga0439435_0011738_259_1344 359
164 3300046460 Ga0495638_0007551 Ga0495638_0007551_5979_7064 359
165 3300046474 Ga0495605_0046575 Ga0495605_0046575_961_2046 359
166 3300050489 nmdc:mga03683_10473_c1 nmdc:mga03683_10473_c1_1237_2322 359
167 3300050490 nmdc:mga03n38_33073_c1 nmdc:mga03n38_33073_c1_247_1332 359
168 3300050494 nmdc:mga06z11_4408_c1 nmdc:mga06z11_4408_c1_4242_5327 359
169 3300053096 Ga0500641_0076595 Ga0500641_0076595_110_1195 359
170 3300001904 JGI24736J21556_1000291 JGI24736J21556_10002916 360
171 3300001990 JGI24737J22298_10001421 JGI24737J22298_100014218 360
172 3300002067 JGI24735J21928_10001487 JGI24735J21928_100014873 360
173 3300003791 Ga0055530_10019404 Ga0055530_100194042 360
174 3300005455 Ga0070663_100008274 Ga0070663_1000082741 360
175 3300005457 Ga0070662_100185939 Ga0070662_1001859391 360
176 3300005564 Ga0070664_100005210 Ga0070664_1000052108 360
177 3300005578 Ga0068854_100266155 Ga0068854_1002661551 360
178 3300009011 Ga0105251_10015458 Ga0105251_100154582 360
179 3300009093 Ga0105240_10272106 Ga0105240_102721061 360
180 3300009174 Ga0105241_10000932 Ga0105241_1000093211 360
181 3300009553 Ga0105249_10305702 Ga0105249_103057022 360
182 3300013100 Ga0157373_10026331 Ga0157373_100263312 360
183 3300017792 Ga0163161_10014911 Ga0163161_100149115 360
184 3300025298 Ga0209050_1000253 Ga0209050_100025367 360
185 3300025904 Ga0207647_10008832 Ga0207647_100088324 360
186 3300025909 Ga0207705_10057586 Ga0207705_100575863 360
187 3300025911 Ga0207654_10005706 Ga0207654_100057064 360
188 3300025913 Ga0207695_10023828 Ga0207695_100238286 360
189 3300025914 Ga0207671_10128159 Ga0207671_101281592 360
190 3300025919 Ga0207657_10007386 Ga0207657_100073864 360
191 3300025924 Ga0207694_10033911 Ga0207694_100339112 360
192 3300025933 Ga0207706_10051149 Ga0207706_100511492 360
193 3300025981 Ga0207640_10031924 Ga0207640_100319243 360
194 3300025981 Ga0207640_10079122 Ga0207640_100791222 360
195 3300026041 Ga0207639_10000687 Ga0207639_100006873 360
196 3300026067 Ga0207678_10001199 Ga0207678_100011996 360
197 3300026078 Ga0207702_10013765 Ga0207702_100137652 360
198 3300026142 Ga0207698_10009743 Ga0207698_100097432 360
199 3300031548 Ga0307408_100025348 Ga0307408_1000253482 360
200 3300031824 Ga0307413_10051012 Ga0307413_100510122 360
201 3300032004 Ga0307414_10042692 Ga0307414_100426922 360
202 3300048912 Ga0496109_0040805 Ga0496109_0040805_2270_3352 360
203 3300048913 Ga0496110_0062211 Ga0496110_0062211_906_1988 360
204 3300048924 Ga0496121_0097857 Ga0496121_0097857_412_1494 360
205 3300048925 Ga0496122_0012340 Ga0496122_0012340_3716_4798 360
206 3300048926 Ga0496123_0063859 Ga0496123_0063859_505_1587 360
207 3300048927 Ga0496124_0010025 Ga0496124_0010025_3063_4145 360

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01636

APH

Phosphotransferase enzyme family

97

339

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dxp-assembly1.cif.gz_A-2 crystal structure of a putative aminoglycoside phosphotransferase (reut_a1007) from ralstonia eutropha jmp134 at 2.32 a resolution 0.9212 21 356
3dxp-assembly1.cif.gz_A-2 crystal structure of a putative aminoglycoside phosphotransferase (reut_a1007) from ralstonia eutropha jmp134 at 2.32 a resolution 0.9106 21 356
6fdn-assembly1.cif.gz_B rio2 structure 0.7302 28 241
6ctz-assembly1.cif.gz_A "structure of the gdp and kanamycin complex of aph(2"")-iiia" 0.7263 27 349
3att-assembly1.cif.gz_A crystal structure of rv3168 with atp 0.7253 24 351
ID Description Score Start End Superfamily
af_Q8K370_368_600_3.90.1200.10 Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe 0.9542 126 356 3.90.1200.10
af_B3DMA2_17_122_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.9522 21 122 3.30.200.20
af_Q8K370_368_600_3.90.1200.10 Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe 0.9384 126 356 3.90.1200.10
af_Q10333_13_233_1.20.1420.10 Mainly Alpha;Up-down Bundle;A middle domain of Talin 1;Talin, central domain 0.9372 302 358 1.20.1420.10
af_Q8K370_265_366_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.9349 25 122 3.30.200.20
ID Description Score Start End GO Terms
AF-A0A2H6MXG5-F1-model_v4 Aminoglycoside phosphotransferase domain-containing protein 0.9768 86 255
AF-A0A7D9KCW7-F1-model_v4 Acyl- dehydrogenase family member 10-like 0.9758 89 259
AF-A0A3D3AAL0-F1-model_v4 Phosphotransferase family protein 0.9753 10 254 GO:0016740
AF-A0A7C1Y298-F1-model_v4 Phosphotransferase family protein 0.9712 21 292
AF-A0A2H6MXG5-F1-model_v4 Aminoglycoside phosphotransferase domain-containing protein 0.9712 86 255

Feature Viewer

pLDDT pTM Quality
90.34 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map