F316979

General Info

Members Datasets Scaffolds Average Seq Length
207 163 206 254

Family's Representative Sequence

Representative Sequence 3300048922|Ga0496119_0091354|Ga0496119_0091354_46_975
Length 309
Sequence MDTFEGLLRRSARAYDASCADAAHRGKSGKATGNDVFWSAGFESLEAANAPRKTLENIMKIVVIGGTGLIGSKVVKNLRGRGHDVLAASPASGVNTITGEGLGEALAGANVVVDLANSPSFEDAAVLEFFTTAGKNLFAAEKAAGVQHHVALSVVGTDRLAQSGYFRGKIAQEKLIRESGVPYTIIHSTQFFEFLGGIAQSGGEGETIRLSPAYFQPIASDDVGAAVADYAVEAPRNGIVEIAGPDRVRLADMVQRFLDATHDSRKVVADTGARYFGAELDDDTLVPGANPRLGALNFDAWFSQSQAAR

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
5 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
14 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
15 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
16 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
17 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
18 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
19 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
20 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
21 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
22 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
23 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
26 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
27 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
28 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
29 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
30 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
31 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
32 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
33 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
34 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
35 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
36 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
37 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
38 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
39 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
58 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
59 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
60 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
61 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
62 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
63 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
64 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
65 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
66 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
67 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
68 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
69 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
70 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
71 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
72 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
73 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
74 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
75 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
76 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
77 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
78 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
79 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
80 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
81 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
82 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
83 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
84 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
85 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
86 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
87 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
88 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
89 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
90 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
91 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
92 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
93 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
94 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
95 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
96 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
97 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
98 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
99 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
100 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
101 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
102 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
103 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
104 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
105 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
106 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
107 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
108 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
109 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
110 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
111 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
112 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
113 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
114 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
115 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
116 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
117 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
118 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
119 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
120 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
121 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
122 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
123 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
124 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
125 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
126 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
127 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
128 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
129 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
130 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
131 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
132 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
133 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
134 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
135 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
136 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
137 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
138 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
139 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
140 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
141 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
146 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
147 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
148 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
149 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
150 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
151 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
152 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
153 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
154 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
156 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
157 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
158 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
159 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
160 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
161 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
162 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
163 643692032 Sinorhizobium fredii NGR234 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.03
Metatranscriptomes 0.48
Isolates 0.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.86
Nodule 0.48
Rhizoplane 2.42
Rhizosphere 79.23
Stem 0
Stem Tuber 0
Unclassified 14.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10016611 3300003322 Bacteria 2957
2 Ga0070690_100007462 3300005330 Bacteria 6264
3 Ga0070670_100066079 3300005331 Bacteria 3103
4 Ga0070661_100075993 3300005344 Bacteria 2475
5 Ga0070669_100191380 3300005353 Bacteria 1605
6 Ga0070675_100166669 3300005354 Bacteria 1898
7 Ga0070673_100011542 3300005364 Bacteria 6034
8 Ga0070667_100179472 3300005367 Bacteria 1872
9 Ga0070678_100030463 3300005456 Bacteria 3709
10 Ga0070706_100252328 3300005467 Bacteria 1647
11 Ga0070706_100319606 3300005467 Bacteria 1448
12 Ga0070672_100178277 3300005543 Bacteria 1770
13 Ga0068855_100013543 3300005563 Bacteria 9836
14 Ga0070664_100004026 3300005564 Bacteria 11805
15 Ga0068854_100019942 3300005578 Bacteria 4527
16 Ga0068861_100142950 3300005719 Bacteria 1955
17 Ga0081538_10003147 3300005981 Bacteria 15686
18 Ga0075366_10005080 3300006195 Bacteria 7115
19 Ga0075366_10019628 3300006195 Bacteria 3915
20 Ga0075366_10175807 3300006195 Bacteria 1300
21 Ga0075370_10062449 3300006353 Bacteria 2123
22 Ga0068871_100653409 3300006358 Bacteria 960
23 Ga0075428_100683643 3300006844 Bacteria 1094
24 Ga0105251_10000029 3300009011 Bacteria 125097
25 Ga0105240_10004510 3300009093 Bacteria 21164
26 Ga0105240_10321819 3300009093 Bacteria 1762
27 Ga0111539_10346743 3300009094 Bacteria 1728
28 Ga0114129_10036550 3300009147 Bacteria 6934
29 Ga0105248_10145979 3300009177 Bacteria 2670
30 Ga0105237_10004152 3300009545 Bacteria 16879
31 Ga0105237_10098875 3300009545 Bacteria 2909
32 Ga0105237_10710682 3300009545 Bacteria 1011
33 Ga0105239_10003770 3300010375 Bacteria 18441
34 Ga0105246_10042005 3300011119 Bacteria 3095
35 Ga0157374_10340466 3300013296 Bacteria 1489
36 Ga0157378_10008823 3300013297 Bacteria 8777
37 Ga0163162_10003836 3300013306 Bacteria 14413
38 Ga0157372_10468202 3300013307 Bacteria 1469
39 Ga0157375_10157522 3300013308 Bacteria 2411
40 Ga0157376_10166031 3300014969 Bacteria 2006
41 Ga0182007_10002025 3300015262 Bacteria 10430
42 Ga0163161_10010608 3300017792 Bacteria 6378
43 Ga0206355_1101495 3300020076 Bacteria 1030
44 Ga0213876_10000262 3300021384 Bacteria 48652
45 Ga0207713_1000112 3300025735 Bacteria 133341
46 Ga0207713_1053961 3300025735 Bacteria 1579
47 Ga0207647_10005249 3300025904 Bacteria 9535
48 Ga0207684_10217961 3300025910 Bacteria 1647
49 Ga0207671_10004994 3300025914 Bacteria 12420
50 Ga0207671_10447304 3300025914 Bacteria 1029
51 Ga0207649_10465717 3300025920 Bacteria 956
52 Ga0207650_10326402 3300025925 Bacteria 1258
53 Ga0207659_10173507 3300025926 Bacteria 1702
54 Ga0207709_10297642 3300025935 Bacteria 1198
55 Ga0207669_10142987 3300025937 Bacteria 1664
56 Ga0207691_10118668 3300025940 Bacteria 2347
57 Ga0207711_10053215 3300025941 Bacteria 3472
58 Ga0207689_10397100 3300025942 Bacteria 1149
59 Ga0207679_10000653 3300025945 Bacteria 23210
60 Ga0207679_10359681 3300025945 Unclassified 1271
61 Ga0207667_10005168 3300025949 Bacteria 15945
62 Ga0207651_10005590 3300025960 Bacteria 6475
63 Ga0207640_10038961 3300025981 Bacteria 3004
64 Ga0207658_10307342 3300025986 Bacteria 1368
65 Ga0207658_10555791 3300025986 Bacteria 1027
66 Ga0207702_10205004 3300026078 Unclassified 1830
67 Ga0307517_10005370 3300028786 Bacteria 19361
68 Ga0307517_10014171 3300028786 Bacteria 10743
69 Ga0307517_10053847 3300028786 Bacteria 3997
70 Ga0307511_10005608 3300030521 Bacteria 12740
71 Ga0307511_10178762 3300030521 Bacteria 1148
72 Ga0307509_10083149 3300031507 Bacteria 3301
73 Ga0307509_10085631 3300031507 Bacteria 3242
74 Ga0307509_10279054 3300031507 Bacteria 1433
75 Ga0307509_10351577 3300031507 Bacteria 1197
76 Ga0307408_100001412 3300031548 Bacteria 17856
77 Ga0307508_10001770 3300031616 Bacteria 24000
78 Ga0307516_10002464 3300031730 Bacteria 24733
79 Ga0307516_10044519 3300031730 Bacteria 4390
80 Ga0307516_10157747 3300031730 Bacteria 2022
81 Ga0307516_10221243 3300031730 Bacteria 1602
82 Ga0307410_10082300 3300031852 Bacteria 2264
83 Ga0307407_10008381 3300031903 Bacteria 4739
84 Ga0307409_100008339 3300031995 Bacteria 6282
85 Ga0307416_100170014 3300032002 Bacteria 2027
86 Ga0307510_10050339 3300033180 Bacteria 4421
87 Ga0307510_10051924 3300033180 Bacteria 4330
88 Ga0395905_0020275 3300037471 Bacteria 6299
89 Ga0395905_0081859 3300037471 Bacteria 3025
90 Ga0436365_1120687 3300039437 Bacteria 61803
91 Ga0436361_0733509 3300039447 Bacteria 1791
92 Ga0451835_0692358 3300041492 Bacteria 1102
93 Ga0466972_0078243 3300044658 Bacteria 1575
94 Ga0466965_0006182 3300044683 Bacteria 5418
95 Ga0466963_0491348 3300044694 Bacteria 866
96 Ga0466968_0025379 3300044735 Bacteria 2427
97 Ga0451576_0174416 3300045051 Bacteria 2244
98 Ga0466967_0179974 3300045976 Bacteria 1994
99 Ga0495592_0001798 3300046454 Bacteria 15080
100 Ga0495592_0089643 3300046454 Bacteria 2208
101 Ga0495590_0024178 3300046457 Bacteria 2142
102 Ga0495629_0000370 3300046459 Bacteria 38059
103 Ga0495638_0002078 3300046460 Bacteria 17000
104 Ga0495638_0165834 3300046460 Bacteria 1271
105 Ga0495651_0003650 3300046462 Bacteria 11786
106 Ga0495653_0000353 3300046463 Bacteria 37368
107 Ga0495650_0001042 3300046471 Bacteria 30968
108 Ga0495580_0314897 3300046472 Bacteria 1064
109 Ga0495639_0017615 3300046475 Bacteria 3104
110 Ga0495664_0001054 3300046477 Bacteria 14241
111 Ga0495585_0028052 3300046492 Bacteria 3213
112 Ga0495596_0022662 3300046500 Bacteria 2556
113 Ga0495596_0023614 3300046500 Bacteria 2494
114 Ga0495583_0000161 3300046506 Bacteria 113144
115 Ga0495606_0005758 3300046507 Bacteria 11714
116 Ga0495606_0260817 3300046507 Bacteria 957
117 Ga0495608_0069419 3300046511 Bacteria 2302
118 Ga0495618_0045361 3300046514 Bacteria 2773
119 Ga0495620_0027703 3300046515 Bacteria 2648
120 Ga0495628_0000967 3300046516 Bacteria 26255
121 Ga0495628_0008616 3300046516 Bacteria 8739
122 Ga0495630_0368130 3300046517 Bacteria 1100
123 Ga0495631_0046485 3300046518 Bacteria 1908
124 Ga0495632_0003490 3300046519 Bacteria 11121
125 Ga0495643_0047197 3300046522 Bacteria 2333
126 Ga0495648_0198919 3300046524 Bacteria 1005
127 Ga0495642_0019254 3300046528 Bacteria 2675
128 Ga0495652_0132052 3300046529 Bacteria 1975
129 Ga0495654_0008453 3300046530 Bacteria 5685
130 Ga0495665_0077151 3300046531 Bacteria 1753
131 Ga0495640_0188156 3300046533 Bacteria 1313
132 Ga0495640_0341593 3300046533 Bacteria 925
133 Ga0495621_0005812 3300046539 Bacteria 3566
134 Ga0495621_0019911 3300046539 Bacteria 2196
135 Ga0495597_0056375 3300046542 Bacteria 1721
136 Ga0495645_0002549 3300046543 Bacteria 12363
137 Ga0495668_0017680 3300046616 Bacteria 4130
138 Ga0495668_0229193 3300046616 Bacteria 1017
139 Ga0495625_0003060 3300046660 Bacteria 17136
140 Ga0495625_0034501 3300046660 Bacteria 3733
141 Ga0495635_0160191 3300046663 Bacteria 1531
142 Ga0495599_0016976 3300046678 Bacteria 4523
143 Ga0495646_0009904 3300046680 Bacteria 6055
144 Ga0495646_0033760 3300046680 Bacteria 3181
145 Ga0495669_0001821 3300046684 Bacteria 8714
146 Ga0495613_0064661 3300046689 Bacteria 2675
147 Ga0495624_0001623 3300046690 Bacteria 17239
148 Ga0495670_0021446 3300046691 Bacteria 3186
149 Ga0495671_0149280 3300046692 Bacteria 1138
150 Ga0495649_0002140 3300046694 Bacteria 14130
151 Ga0495589_0002170 3300046794 Bacteria 11041
152 Ga0495589_0105970 3300046794 Bacteria 1358
153 Ga0495660_0078742 3300046810 Bacteria 1732
154 Ga0495604_0336802 3300047317 Bacteria 1005
155 Ga0495674_0064569 3300047319 Bacteria 3182
156 Ga0495674_0105196 3300047319 Bacteria 2398
157 Ga0495672_0019332 3300047320 Bacteria 4495
158 Ga0495672_0060805 3300047320 Bacteria 2180
159 Ga0495687_000669 3300047443 Bacteria 39168
160 Ga0495687_000748 3300047443 Bacteria 35192
161 Ga0495687_096867 3300047443 Bacteria 1116
162 Ga0495687_115309 3300047443 Bacteria 979
163 Ga0495685_036824 3300047447 Bacteria 1679
164 Ga0495681_0039205 3300047470 Bacteria 2316
165 Ga0495684_0053052 3300047471 Bacteria 3093
166 Ga0495593_0082060 3300047673 Bacteria 1667
167 Ga0496100_0043451 3300048903 Bacteria 2874
168 Ga0496102_0310670 3300048905 Bacteria 1486
169 Ga0496105_0133559 3300048908 Bacteria 2045
170 Ga0496106_0005719 3300048909 Bacteria 9199
171 Ga0496114_0036094 3300048917 Bacteria 4086
172 Ga0496116_0008625 3300048919 Bacteria 8820
173 Ga0496118_0132515 3300048921 Bacteria 1597
174 Ga0496119_0091354 3300048922 Bacteria 1729
175 Ga0496120_0068152 3300048923 Bacteria 1964
176 Ga0496121_0010975 3300048924 Bacteria 10116
177 Ga0496121_0033283 3300048924 Bacteria 4668
178 Ga0496121_0098196 3300048924 Bacteria 2267
179 Ga0496121_0172745 3300048924 Bacteria 1568
180 Ga0496121_0418184 3300048924 Bacteria 873
181 Ga0495682_0013044 3300049460 Bacteria 3169
182 Ga0501031_0298643 3300049568 Bacteria 1044
183 Ga0501034_0055444 3300049571 Unclassified 3989
184 Ga0501043_0343314 3300049579 Bacteria 1135
185 Ga0501047_0158017 3300049581 Bacteria 2140
186 Ga0501068_0220229 3300049584 Bacteria 1206
187 Ga0501069_0065453 3300049585 Unclassified 2032
188 Ga0501070_0006177 3300049586 Bacteria 10207
189 Ga0501073_0009330 3300049589 Bacteria 7239
190 Ga0501074_0273521 3300049590 Unclassified 1201
191 Ga0501223_012855 3300049663 Bacteria 1671
192 Ga0501079_0262269 3300049741 Unclassified 1350
193 Ga0501080_0221948 3300049742 Bacteria 1729
194 Ga0501080_0380165 3300049742 Unclassified 1272
195 Ga0501083_0006687 3300049744 Bacteria 8179
196 Ga0501035_0254262 3300049822 Bacteria 1491
197 Ga0501035_0384292 3300049822 Bacteria 1170
198 Ga0501044_0026322 3300049823 Bacteria 6159
199 Ga0501044_0293383 3300049823 Unclassified 1557
200 nmdc:mga0k408_3530_c1 3300050493 Bacteria 8259
201 nmdc:mga07m45_852_c1 3300050496 Bacteria 13257
202 nmdc:mga08y16_252595_c1 3300050511 Bacteria 1822
203 Ga0495619_0056020 3300053085 Bacteria 2613
204 Ga0500658_0015255 3300053134 Bacteria 2850
205 Ga0500619_058765 3300053154 Bacteria 1261
206 Ga0501082_0024202 3300060353 Bacteria 5237

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046692 Ga0495671_0149280 Ga0495671_0149280_54_776 226
2 3300006195 Ga0075366_10019628 Ga0075366_100196283 247
3 3300045976 Ga0466967_0179974 Ga0466967_0179974_438_1184 248
4 3300047320 Ga0495672_0060805 Ga0495672_0060805_319_1068 248
5 3300049568 Ga0501031_0298643 Ga0501031_0298643_259_1011 248
6 3300049742 Ga0501080_0221948 Ga0501080_0221948_862_1614 248
7 3300049822 Ga0501035_0254262 Ga0501035_0254262_94_846 248
8 3300049823 Ga0501044_0026322 Ga0501044_0026322_1496_2248 248
9 3300005981 Ga0081538_10003147 Ga0081538_100031477 249
10 3300025735 Ga0207713_1053961 Ga0207713_10539612 249
11 3300031852 Ga0307410_10082300 Ga0307410_100823002 249
12 3300031903 Ga0307407_10008381 Ga0307407_100083812 249
13 3300031995 Ga0307409_100008339 Ga0307409_1000083399 249
14 3300032002 Ga0307416_100170014 Ga0307416_1001700142 249
15 3300033180 Ga0307510_10051924 Ga0307510_100519244 249
16 3300037471 Ga0395905_0020275 Ga0395905_0020275_4507_5256 249
17 3300049586 Ga0501070_0006177 Ga0501070_0006177_8503_9255 249
18 3300048923 Ga0496120_0068152 Ga0496120_0068152_163_915 250
19 3300048924 Ga0496121_0098196 Ga0496121_0098196_205_960 250
20 3300005330 Ga0070690_100007462 Ga0070690_1000074625 251
21 3300005364 Ga0070673_100011542 Ga0070673_1000115427 251
22 3300005367 Ga0070667_100179472 Ga0070667_1001794722 251
23 3300005456 Ga0070678_100030463 Ga0070678_1000304634 251
24 3300005467 Ga0070706_100252328 Ga0070706_1002523282 251
25 3300005563 Ga0068855_100013543 Ga0068855_1000135435 251
26 3300005578 Ga0068854_100019942 Ga0068854_1000199422 251
27 3300005719 Ga0068861_100142950 Ga0068861_1001429502 251
28 3300006195 Ga0075366_10005080 Ga0075366_100050802 251
29 3300006195 Ga0075366_10175807 Ga0075366_101758073 251
30 3300006353 Ga0075370_10062449 Ga0075370_100624491 251
31 3300006358 Ga0068871_100653409 Ga0068871_1006534091 251
32 3300006844 Ga0075428_100683643 Ga0075428_1006836432 251
33 3300009011 Ga0105251_10000029 Ga0105251_1000002983 251
34 3300009094 Ga0111539_10346743 Ga0111539_103467433 251
35 3300009147 Ga0114129_10036550 Ga0114129_1003655010 251
36 3300009177 Ga0105248_10145979 Ga0105248_101459792 251
37 3300009545 Ga0105237_10004152 Ga0105237_100041526 251
38 3300009545 Ga0105237_10098875 Ga0105237_100988753 251
39 3300009545 Ga0105237_10710682 Ga0105237_107106821 251
40 3300010375 Ga0105239_10003770 Ga0105239_100037709 251
41 3300011119 Ga0105246_10042005 Ga0105246_100420054 251
42 3300013296 Ga0157374_10340466 Ga0157374_103404662 251
43 3300013297 Ga0157378_10008823 Ga0157378_100088238 251
44 3300013306 Ga0163162_10003836 Ga0163162_1000383612 251
45 3300013308 Ga0157375_10157522 Ga0157375_101575222 251
46 3300014969 Ga0157376_10166031 Ga0157376_101660312 251
47 3300015262 Ga0182007_10002025 Ga0182007_100020258 251
48 3300017792 Ga0163161_10010608 Ga0163161_100106088 251
49 3300020076 Ga0206355_1101495 Ga0206355_11014952 251
50 3300025735 Ga0207713_1000112 Ga0207713_100011238 251
51 3300025904 Ga0207647_10005249 Ga0207647_100052495 251
52 3300025910 Ga0207684_10217961 Ga0207684_102179613 251
53 3300025914 Ga0207671_10004994 Ga0207671_1000499417 251
54 3300025914 Ga0207671_10447304 Ga0207671_104473041 251
55 3300025925 Ga0207650_10326402 Ga0207650_103264022 251
56 3300025935 Ga0207709_10297642 Ga0207709_102976422 251
57 3300025941 Ga0207711_10053215 Ga0207711_100532154 251
58 3300025942 Ga0207689_10397100 Ga0207689_103971001 251
59 3300025949 Ga0207667_10005168 Ga0207667_100051689 251
60 3300025960 Ga0207651_10005590 Ga0207651_100055903 251
61 3300025981 Ga0207640_10038961 Ga0207640_100389614 251
62 3300025986 Ga0207658_10307342 Ga0207658_103073422 251
63 3300025986 Ga0207658_10555791 Ga0207658_105557911 251
64 3300028786 Ga0307517_10005370 Ga0307517_1000537016 251
65 3300028786 Ga0307517_10053847 Ga0307517_100538474 251
66 3300030521 Ga0307511_10005608 Ga0307511_1000560811 251
67 3300030521 Ga0307511_10178762 Ga0307511_101787622 251
68 3300031507 Ga0307509_10083149 Ga0307509_100831493 251
69 3300031507 Ga0307509_10085631 Ga0307509_100856313 251
70 3300031507 Ga0307509_10279054 Ga0307509_102790542 251
71 3300031548 Ga0307408_100001412 Ga0307408_10000141219 251
72 3300031616 Ga0307508_10001770 Ga0307508_1000177014 251
73 3300031730 Ga0307516_10044519 Ga0307516_100445191 251
74 3300031730 Ga0307516_10157747 Ga0307516_101577472 251
75 3300031730 Ga0307516_10221243 Ga0307516_102212432 251
76 3300033180 Ga0307510_10050339 Ga0307510_100503394 251
77 3300039447 Ga0436361_0733509 Ga0436361_0733509_900_1655 251
78 3300044658 Ga0466972_0078243 Ga0466972_0078243_215_970 251
79 3300044683 Ga0466965_0006182 Ga0466965_0006182_3398_4153 251
80 3300044735 Ga0466968_0025379 Ga0466968_0025379_1502_2257 251
81 3300046454 Ga0495592_0001798 Ga0495592_0001798_3756_4511 251
82 3300046457 Ga0495590_0024178 Ga0495590_0024178_445_1200 251
83 3300046459 Ga0495629_0000370 Ga0495629_0000370_36569_37324 251
84 3300046460 Ga0495638_0002078 Ga0495638_0002078_10917_11672 251
85 3300046460 Ga0495638_0165834 Ga0495638_0165834_419_1174 251
86 3300046463 Ga0495653_0000353 Ga0495653_0000353_730_1485 251
87 3300046472 Ga0495580_0314897 Ga0495580_0314897_88_843 251
88 3300046475 Ga0495639_0017615 Ga0495639_0017615_809_1564 251
89 3300046492 Ga0495585_0028052 Ga0495585_0028052_753_1508 251
90 3300046500 Ga0495596_0022662 Ga0495596_0022662_1007_1762 251
91 3300046500 Ga0495596_0023614 Ga0495596_0023614_565_1365 251
92 3300046506 Ga0495583_0000161 Ga0495583_0000161_82439_83194 251
93 3300046507 Ga0495606_0005758 Ga0495606_0005758_9037_9792 251
94 3300046507 Ga0495606_0260817 Ga0495606_0260817_143_904 251
95 3300046515 Ga0495620_0027703 Ga0495620_0027703_144_899 251
96 3300046516 Ga0495628_0000967 Ga0495628_0000967_24624_25379 251
97 3300046518 Ga0495631_0046485 Ga0495631_0046485_842_1597 251
98 3300046519 Ga0495632_0003490 Ga0495632_0003490_8318_9073 251
99 3300046524 Ga0495648_0198919 Ga0495648_0198919_149_904 251
100 3300046528 Ga0495642_0019254 Ga0495642_0019254_1581_2336 251
101 3300046531 Ga0495665_0077151 Ga0495665_0077151_412_1167 251
102 3300046533 Ga0495640_0188156 Ga0495640_0188156_17_772 251
103 3300046542 Ga0495597_0056375 Ga0495597_0056375_422_1177 251
104 3300046616 Ga0495668_0017680 Ga0495668_0017680_2140_2895 251
105 3300046616 Ga0495668_0229193 Ga0495668_0229193_240_995 251
106 3300046660 Ga0495625_0003060 Ga0495625_0003060_2419_3174 251
107 3300046660 Ga0495625_0034501 Ga0495625_0034501_2954_3709 251
108 3300046680 Ga0495646_0009904 Ga0495646_0009904_708_1463 251
109 3300046680 Ga0495646_0033760 Ga0495646_0033760_648_1403 251
110 3300046684 Ga0495669_0001821 Ga0495669_0001821_5437_6192 251
111 3300046690 Ga0495624_0001623 Ga0495624_0001623_1197_1952 251
112 3300046691 Ga0495670_0021446 Ga0495670_0021446_1038_1793 251
113 3300046694 Ga0495649_0002140 Ga0495649_0002140_12321_13076 251
114 3300046794 Ga0495589_0002170 Ga0495589_0002170_4243_4998 251
115 3300046794 Ga0495589_0105970 Ga0495589_0105970_519_1319 251
116 3300046810 Ga0495660_0078742 Ga0495660_0078742_468_1223 251
117 3300047319 Ga0495674_0105196 Ga0495674_0105196_936_1691 251
118 3300047443 Ga0495687_000669 Ga0495687_000669_22292_23047 251
119 3300047443 Ga0495687_000748 Ga0495687_000748_22351_23106 251
120 3300047443 Ga0495687_115309 Ga0495687_115309_128_883 251
121 3300047447 Ga0495685_036824 Ga0495685_036824_386_1141 251
122 3300047470 Ga0495681_0039205 Ga0495681_0039205_1294_2049 251
123 3300047673 Ga0495593_0082060 Ga0495593_0082060_185_940 251
124 3300048903 Ga0496100_0043451 Ga0496100_0043451_758_1513 251
125 3300048905 Ga0496102_0310670 Ga0496102_0310670_535_1290 251
126 3300048908 Ga0496105_0133559 Ga0496105_0133559_779_1534 251
127 3300048909 Ga0496106_0005719 Ga0496106_0005719_4940_5695 251
128 3300048917 Ga0496114_0036094 Ga0496114_0036094_2118_2873 251
129 3300048919 Ga0496116_0008625 Ga0496116_0008625_1964_2719 251
130 3300048921 Ga0496118_0132515 Ga0496118_0132515_234_1151 251
131 3300048922 Ga0496119_0091354 Ga0496119_0091354_46_975 251
132 3300048924 Ga0496121_0010975 Ga0496121_0010975_8951_9751 251
133 3300048924 Ga0496121_0033283 Ga0496121_0033283_3860_4615 251
134 3300048924 Ga0496121_0172745 Ga0496121_0172745_516_1271 251
135 3300048924 Ga0496121_0418184 Ga0496121_0418184_19_774 251
136 3300049460 Ga0495682_0013044 Ga0495682_0013044_449_1366 251
137 3300049579 Ga0501043_0343314 Ga0501043_0343314_52_846 251
138 3300049581 Ga0501047_0158017 Ga0501047_0158017_308_1102 251
139 3300049663 Ga0501223_012855 Ga0501223_012855_561_1331 251
140 3300049822 Ga0501035_0384292 Ga0501035_0384292_61_855 251
141 3300050493 nmdc:mga0k408_3530_c1 nmdc:mga0k408_3530_c1_5852_6607 251
142 3300050496 nmdc:mga07m45_852_c1 nmdc:mga07m45_852_c1_1765_2520 251
143 3300050511 nmdc:mga08y16_252595_c1 nmdc:mga08y16_252595_c1_806_1561 251
144 3300053134 Ga0500658_0015255 Ga0500658_0015255_978_1733 251
145 3300053154 Ga0500619_058765 Ga0500619_058765_329_1084 251
146 iso_pu_bacteria 643692032 643823544 251
147 3300005331 Ga0070670_100066079 Ga0070670_1000660792 252
148 3300005353 Ga0070669_100191380 Ga0070669_1001913802 252
149 3300005354 Ga0070675_100166669 Ga0070675_1001666691 252
150 3300005543 Ga0070672_100178277 Ga0070672_1001782771 252
151 3300025926 Ga0207659_10173507 Ga0207659_101735072 252
152 3300025937 Ga0207669_10142987 Ga0207669_101429872 252
153 3300025940 Ga0207691_10118668 Ga0207691_101186682 252
154 3300031507 Ga0307509_10351577 Ga0307509_103515772 252
155 3300031730 Ga0307516_10002464 Ga0307516_100024646 252
156 3300037471 Ga0395905_0081859 Ga0395905_0081859_780_1577 252
157 3300046471 Ga0495650_0001042 Ga0495650_0001042_22392_23150 252
158 3300046530 Ga0495654_0008453 Ga0495654_0008453_3000_3770 252
159 3300046539 Ga0495621_0005812 Ga0495621_0005812_712_1476 252
160 3300046539 Ga0495621_0019911 Ga0495621_0019911_608_1372 252
161 3300047320 Ga0495672_0019332 Ga0495672_0019332_128_886 252
162 3300005344 Ga0070661_100075993 Ga0070661_1000759933 253
163 3300005564 Ga0070664_100004026 Ga0070664_1000040262 253
164 3300009093 Ga0105240_10004510 Ga0105240_1000451013 253
165 3300009093 Ga0105240_10321819 Ga0105240_103218191 253
166 3300013307 Ga0157372_10468202 Ga0157372_104682022 253
167 3300025920 Ga0207649_10465717 Ga0207649_104657171 253
168 3300025945 Ga0207679_10000653 Ga0207679_100006535 253
169 3300025945 Ga0207679_10359681 Ga0207679_103596812 253
170 3300026078 Ga0207702_10205004 Ga0207702_102050042 253
171 3300041492 Ga0451835_0692358 Ga0451835_0692358_184_945 253
172 3300044694 Ga0466963_0491348 Ga0466963_0491348_32_799 253
173 3300045051 Ga0451576_0174416 Ga0451576_0174416_1250_2011 253
174 3300003322 rootL2_10016611 rootL2_100166114 254
175 3300005467 Ga0070706_100319606 Ga0070706_1003196062 254
176 3300021384 Ga0213876_10000262 Ga0213876_1000026233 254
177 3300028786 Ga0307517_10014171 Ga0307517_100141714 254
178 3300039437 Ga0436365_1120687 Ga0436365_1120687_34340_35110 254
179 3300046454 Ga0495592_0089643 Ga0495592_0089643_305_1084 254
180 3300046462 Ga0495651_0003650 Ga0495651_0003650_4440_5219 254
181 3300046477 Ga0495664_0001054 Ga0495664_0001054_5757_6536 254
182 3300046511 Ga0495608_0069419 Ga0495608_0069419_970_1812 254
183 3300046514 Ga0495618_0045361 Ga0495618_0045361_1167_1946 254
184 3300046516 Ga0495628_0008616 Ga0495628_0008616_6810_7589 254
185 3300046517 Ga0495630_0368130 Ga0495630_0368130_74_853 254
186 3300046522 Ga0495643_0047197 Ga0495643_0047197_574_1341 254
187 3300046529 Ga0495652_0132052 Ga0495652_0132052_967_1746 254
188 3300046533 Ga0495640_0341593 Ga0495640_0341593_36_815 254
189 3300046543 Ga0495645_0002549 Ga0495645_0002549_5790_6569 254
190 3300046663 Ga0495635_0160191 Ga0495635_0160191_672_1451 254
191 3300046678 Ga0495599_0016976 Ga0495599_0016976_1023_1802 254
192 3300046689 Ga0495613_0064661 Ga0495613_0064661_1622_2401 254
193 3300047317 Ga0495604_0336802 Ga0495604_0336802_122_964 254
194 3300047319 Ga0495674_0064569 Ga0495674_0064569_373_1152 254
195 3300047443 Ga0495687_096867 Ga0495687_096867_302_1066 254
196 3300047471 Ga0495684_0053052 Ga0495684_0053052_133_912 254
197 3300049571 Ga0501034_0055444 Ga0501034_0055444_1394_2158 254
198 3300049584 Ga0501068_0220229 Ga0501068_0220229_186_950 254
199 3300049585 Ga0501069_0065453 Ga0501069_0065453_397_1161 254
200 3300049589 Ga0501073_0009330 Ga0501073_0009330_156_920 254
201 3300049590 Ga0501074_0273521 Ga0501074_0273521_156_920 254
202 3300049741 Ga0501079_0262269 Ga0501079_0262269_252_1016 254
203 3300049742 Ga0501080_0380165 Ga0501080_0380165_380_1144 254
204 3300049744 Ga0501083_0006687 Ga0501083_0006687_2173_2937 254
205 3300049823 Ga0501044_0293383 Ga0501044_0293383_428_1192 254
206 3300053085 Ga0495619_0056020 Ga0495619_0056020_1775_2548 254
207 3300060353 Ga0501082_0024202 Ga0501082_0024202_4270_5034 254

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

61

163

0.82

PF13460

NAD_binding_10

NAD(P)H-binding

65

233

0.77

PF05368

NmrA

NmrA-like family

91

248

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
6jkg-assembly1.cif.gz_A the nad+-free form of human nsdhl 0.8814 2 130
7qsn-assembly1.cif.gz_P bovine complex i in lipid nanodisc, deactive-apo 0.8591 1 202
6jkh-assembly1.cif.gz_A the nad+-bound form of human nsdhl 0.8478 2 130
6jkh-assembly1.cif.gz_B the nad+-bound form of human nsdhl 0.8341 2 129
6jkg-assembly1.cif.gz_B the nad+-free form of human nsdhl 0.8289 2 129
ID Description Score Start End Superfamily
af_Q9N3H3_46_282_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8494 2 183 3.40.50.720
af_Q54L85_1_328_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8291 2 211 3.40.50.720
1qrrA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8278 1 130 3.40.50.720
2c59B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8255 1 130 3.40.50.720
af_P75822_3_266_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8252 1 212 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2V7CXT5-F1-model_v4 NmrA family transcriptional regulator 1 1 129
AF-A0A4V1T6H8-F1-model_v4 deleted 0.9982 1 91
AF-A0A0Q5J8C6-F1-model_v4 NmrA family transcriptional regulator 0.9968 1 245
AF-A0A829PTN0-F1-model_v4 NAD dependent epimerase/dehydratase family protein 0.9967 1 129 GO:0009523
GO:0015979
AF-A0A2V6I120-F1-model_v4 NmrA family transcriptional regulator 0.9964 1 119

Feature Viewer

pLDDT pTM Quality
94.47 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map