F316846

General Info

Members Datasets Scaffolds Average Seq Length
207 131 414 139

Family's Representative Sequence

Representative Sequence 3300045836|Ga0466958_0061600|Ga0466958_0061600_1780_2265
Length 161
Sequence MVMDMVFGNVKTEPRSLGSGRGGAMTSSARLLQRARRGFTLIELMVVMAIISILLSIALPIYQKSITRAKESVLRNNLFTLRDMIDEYTIDKQKAPESLDDLVSEGYLRQVPQDPMTGSNQTWKTTMEDTPIGGANSTPGIFDVHSGSDKTALDGTAYADW

Samples

Sample ID Description Type Environment
1 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
52 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
54 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
55 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
56 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
57 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
58 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
59 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
86 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
87 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
88 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
89 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
90 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
91 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
92 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
93 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
94 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
95 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
96 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
97 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
98 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
99 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
100 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
101 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
102 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
103 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
115 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
116 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
117 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
118 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
119 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
120 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
121 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
122 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
123 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
124 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
126 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
127 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
128 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
129 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
130 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
131 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.55
Metatranscriptomes 1.45
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.9
Rhizosphere 74.88
Stem 0
Stem Tuber 0
Unclassified 9.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466958_0061600 3300045836 Bacteria 2286
2 Ga0058863_11577071 3300004799 Unclassified 821
3 Ga0065707_10591486 3300005295 Unclassified 695
4 Ga0070658_11283384 3300005327 Unclassified 636
5 Ga0070683_100450833 3300005329 Bacteria 1227
6 Ga0070683_101333861 3300005329 Bacteria 689
7 Ga0070680_100020243 3300005336 Bacteria 5280
8 Ga0070682_100986232 3300005337 Unclassified 698
9 Ga0070660_100009995 3300005339 Bacteria 6690
10 Ga0070660_100123665 3300005339 Bacteria 2066
11 Ga0070687_100274393 3300005343 Bacteria 1058
12 Ga0070661_100307153 3300005344 Bacteria 1236
13 Ga0070692_10162459 3300005345 Bacteria 1281
14 Ga0070669_100025210 3300005353 Unclassified 4270
15 Ga0070659_100188627 3300005366 Bacteria 1694
16 Ga0070709_10200755 3300005434 Bacteria 1412
17 Ga0070713_100277117 3300005436 Bacteria 1538
18 Ga0070713_100286823 3300005436 Bacteria 1512
19 Ga0070713_101923007 3300005436 Bacteria 574
20 Ga0070713_102272993 3300005436 Bacteria 525
21 Ga0070710_10482097 3300005437 Bacteria 846
22 Ga0070701_10269761 3300005438 Bacteria 1035
23 Ga0070711_100089925 3300005439 Bacteria 2210
24 Ga0070678_100907313 3300005456 Bacteria 806
25 Ga0070662_101380274 3300005457 Bacteria 607
26 Ga0070681_10149159 3300005458 Bacteria 2266
27 Ga0070681_10185358 3300005458 Bacteria 2002
28 Ga0070681_10612954 3300005458 Bacteria 1003
29 Ga0068867_100048173 3300005459 Unclassified 3135
30 Ga0070679_100140326 3300005530 Bacteria 2397
31 Ga0068853_100025326 3300005539 Bacteria 4978
32 Ga0070665_100548036 3300005548 Bacteria 1169
33 Ga0068855_100049679 3300005563 Bacteria 4946
34 Ga0068854_100384891 3300005578 Bacteria 1157
35 Ga0068856_100072037 3300005614 Bacteria 3421
36 Ga0068856_100105729 3300005614 Bacteria 2808
37 Ga0068856_100197406 3300005614 Bacteria 2026
38 Ga0068852_100550547 3300005616 Bacteria 1154
39 Ga0068859_100144924 3300005617 Bacteria 2449
40 Ga0068863_102227739 3300005841 Bacteria 558
41 Ga0068862_100007482 3300005844 Bacteria 9053
42 Ga0081455_10018137 3300005937 Bacteria 6717
43 Ga0070717_10116679 3300006028 Bacteria 2283
44 Ga0070717_10231578 3300006028 Bacteria 1627
45 Ga0070716_101168300 3300006173 Bacteria 617
46 Ga0070712_102005542 3300006175 Bacteria 507
47 Ga0097621_100877120 3300006237 Bacteria 835
48 Ga0068871_100237650 3300006358 Bacteria 1583
49 Ga0068871_100676754 3300006358 Bacteria 944
50 Ga0075428_101540538 3300006844 Unclassified 696
51 Ga0097620_100144923 3300006931 Bacteria 2449
52 Ga0114129_11307203 3300009147 Unclassified 898
53 Ga0105241_10102316 3300009174 Bacteria 2279
54 Ga0105248_10727016 3300009177 Unclassified 1120
55 Ga0105237_11102102 3300009545 Bacteria 801
56 Ga0157371_10115216 3300013102 Bacteria 1909
57 Ga0157370_10197005 3300013104 Bacteria 1869
58 Ga0157370_10442091 3300013104 Bacteria 1196
59 Ga0157369_10002504 3300013105 Bacteria 21991
60 Ga0157369_10109478 3300013105 Bacteria 2937
61 Ga0157369_10159079 3300013105 Bacteria 2385
62 Ga0157374_10246253 3300013296 Bacteria 1758
63 Ga0157374_10587366 3300013296 Bacteria 1123
64 Ga0163162_13046937 3300013306 Bacteria 538
65 Ga0157372_10097251 3300013307 Bacteria 3357
66 Ga0157372_10195139 3300013307 Bacteria 2345
67 Ga0157372_10517420 3300013307 Bacteria 1391
68 Ga0157376_10382945 3300014969 Bacteria 1355
69 Ga0206349_1001769 3300020075 Bacteria 1343
70 Ga0213873_10018619 3300021358 Bacteria 1599
71 Ga0213872_10000228 3300021361 Bacteria 49212
72 Ga0213874_10050250 3300021377 Bacteria 1277
73 Ga0213876_10001771 3300021384 Bacteria 13086
74 Ga0213876_10025252 3300021384 Bacteria 3135
75 Ga0213876_10336051 3300021384 Bacteria 803
76 Ga0213875_10000006 3300021388 Bacteria 579005
77 Ga0213875_10001571 3300021388 Bacteria 14618
78 Ga0213875_10043001 3300021388 Bacteria 2121
79 Ga0213875_10063239 3300021388 Bacteria 1730
80 Ga0213875_10079488 3300021388 Bacteria 1530
81 Ga0213875_10102352 3300021388 Bacteria 1337
82 Ga0213875_10137079 3300021388 Bacteria 1145
83 Ga0213875_10376518 3300021388 Bacteria 676
84 Ga0213871_10052501 3300021441 Bacteria 1120
85 Ga0224712_10012277 3300022467 Bacteria 2689
86 Ga0207692_10761213 3300025898 Bacteria 631
87 Ga0207699_10251976 3300025906 Bacteria 1217
88 Ga0207707_10194036 3300025912 Bacteria 1771
89 Ga0207707_10228843 3300025912 Bacteria 1618
90 Ga0207707_10505180 3300025912 Bacteria 1031
91 Ga0207663_10573398 3300025916 Bacteria 884
92 Ga0207660_10104172 3300025917 Bacteria 2124
93 Ga0207657_10052260 3300025919 Bacteria 3547
94 Ga0207657_10126974 3300025919 Bacteria 2094
95 Ga0207649_10236732 3300025920 Bacteria 1309
96 Ga0207652_10023661 3300025921 Bacteria 5090
97 Ga0207681_10004993 3300025923 Bacteria 8151
98 Ga0207664_10985775 3300025929 Bacteria 755
99 Ga0207690_10447489 3300025932 Bacteria 1038
100 Ga0207711_10763707 3300025941 Unclassified 901
101 Ga0207661_11228355 3300025944 Bacteria 689
102 Ga0207661_11396624 3300025944 Unclassified 643
103 Ga0207679_10043931 3300025945 Bacteria 3221
104 Ga0207667_10040327 3300025949 Bacteria 4972
105 Ga0207667_10382188 3300025949 Bacteria 1435
106 Ga0207651_10744831 3300025960 Bacteria 866
107 Ga0207640_10305997 3300025981 Bacteria 1259
108 Ga0207640_10639411 3300025981 Bacteria 905
109 Ga0207639_10018482 3300026041 Bacteria 4954
110 Ga0207708_10028469 3300026075 Bacteria 4231
111 Ga0207702_10005178 3300026078 Bacteria 11471
112 Ga0207702_10733669 3300026078 Bacteria 975
113 Ga0207641_12155045 3300026088 Bacteria 558
114 Ga0207683_10148664 3300026121 Bacteria 2114
115 Ga0207698_10384137 3300026142 Bacteria 1337
116 Ga0268266_10244626 3300028379 Bacteria 1657
117 Ga0268265_10210548 3300028380 Bacteria 1693
118 Ga0373935_0539586 3300035692 Bacteria 849
119 Ga0373925_0066221 3300037068 Bacteria 2723
120 Ga0373925_0989565 3300037068 Bacteria 693
121 Ga0395898_0580187 3300037466 Bacteria 1064
122 Ga0436364_0056033 3300037853 Bacteria 882
123 Ga0436364_0235972 3300037853 Bacteria 2482
124 Ga0436364_0239224 3300037853 Bacteria 54429
125 Ga0436364_0330016 3300037853 Bacteria 6431
126 Ga0436364_0478514 3300037853 Bacteria 578677
127 Ga0436364_0580009 3300037853 Bacteria 9646
128 Ga0436364_0601128 3300037853 Bacteria 88345
129 Ga0436364_0680140 3300037853 Bacteria 9909
130 Ga0436364_0825054 3300037853 Bacteria 1337
131 Ga0436364_0834588 3300037853 Bacteria 3418
132 Ga0436364_0903663 3300037853 Bacteria 16180
133 Ga0436364_0955829 3300037853 Bacteria 1034
134 Ga0436364_0986873 3300037853 Bacteria 740
135 Ga0436364_1023667 3300037853 Bacteria 2312
136 Ga0436364_1191337 3300037853 Bacteria 1310
137 Ga0436364_1219825 3300037853 Bacteria 1564
138 Ga0436364_1302461 3300037853 Bacteria 4541
139 Ga0436364_1478792 3300037853 Bacteria 3897
140 Ga0436364_1552890 3300037853 Unclassified 716
141 Ga0436365_0024991 3300039437 Unclassified 1073
142 Ga0436365_0153194 3300039437 Bacteria 959
143 Ga0436365_0221108 3300039437 Bacteria 849
144 Ga0436365_0260405 3300039437 Unclassified 957
145 Ga0436365_0319102 3300039437 Bacteria 2043
146 Ga0436365_0391802 3300039437 Bacteria 1001
147 Ga0436365_0468713 3300039437 Bacteria 4059
148 Ga0436365_1361083 3300039437 Bacteria 9432
149 Ga0436365_1611839 3300039437 Bacteria 2082
150 Ga0436360_0067805 3300039438 Unclassified 1271
151 Ga0436360_1353299 3300039438 Bacteria 55854
152 Ga0436361_0419405 3300039447 Bacteria 103155
153 Ga0436361_0789476 3300039447 Unclassified 676
154 Ga0436363_0037731 3300039450 Bacteria 1261
155 Ga0436363_0215847 3300039450 Unclassified 517
156 Ga0436363_1029510 3300039450 Bacteria 1023
157 Ga0436363_1086657 3300039450 Bacteria 8509
158 Ga0436363_1106592 3300039450 Bacteria 1038
159 Ga0436363_1708765 3300039450 Bacteria 652
160 Ga0436362_0194156 3300039453 Bacteria 1549
161 Ga0436362_0550631 3300039453 Unclassified 899
162 Ga0436362_0642024 3300039453 Bacteria 2587
163 Ga0436362_0732851 3300039453 Bacteria 2361
164 Ga0436362_0986827 3300039453 Bacteria 1770
165 Ga0436362_0992442 3300039453 Bacteria 545
166 Ga0436362_1079685 3300039453 Bacteria 815
167 Ga0436362_1166718 3300039453 Bacteria 542
168 Ga0466966_0163239 3300044684 Bacteria 1356
169 Ga0466963_0210083 3300044694 Bacteria 1362
170 Ga0466963_0440809 3300044694 Bacteria 919
171 Ga0466959_0597247 3300045049 Unclassified 743
172 Ga0466959_0769210 3300045049 Bacteria 644
173 Ga0496103_0575644 3300048906 Bacteria 718
174 Ga0496104_0645063 3300048907 Bacteria 968
175 Ga0496108_1072541 3300048911 Bacteria 685
176 Ga0496109_1415339 3300048912 Bacteria 631
177 Ga0496112_0142565 3300048915 Bacteria 2365
178 Ga0496115_0016442 3300048918 Bacteria 5635
179 Ga0501032_0005541 3300049569 Bacteria 9368
180 Ga0501033_0018604 3300049570 Bacteria 5250
181 Ga0501034_0165706 3300049571 Bacteria 2178
182 Ga0501036_0006398 3300049572 Bacteria 9559
183 Ga0501037_0010963 3300049573 Bacteria 6665
184 Ga0501038_0007123 3300049574 Bacteria 10332
185 Ga0501039_0186051 3300049575 Bacteria 1633
186 Ga0501043_0022621 3300049579 Bacteria 4928
187 Ga0501046_0008030 3300049580 Bacteria 9224
188 Ga0501047_0239458 3300049581 Bacteria 1665
189 Ga0501048_0149241 3300049582 Bacteria 1653
190 Ga0501067_0007847 3300049583 Bacteria 5931
191 Ga0501068_0207208 3300049584 Bacteria 1244
192 Ga0501069_0001490 3300049585 Bacteria 11556
193 Ga0501070_0030585 3300049586 Bacteria 4511
194 Ga0501072_0000773 3300049588 Bacteria 23368
195 Ga0501074_0040649 3300049590 Bacteria 3367
196 Ga0501076_0038799 3300049592 Bacteria 3739
197 Ga0501079_0030396 3300049741 Bacteria 4149
198 Ga0501080_0943131 3300049742 Bacteria 750
199 Ga0501083_0292533 3300049744 Bacteria 1059
200 Ga0501035_0049283 3300049822 Bacteria 3774
201 Ga0501044_0147723 3300049823 Bacteria 2334
202 nmdc:mga0n895_179495_c1 3300050512 Bacteria 2148
203 nmdc:mga0a205_589121_c1 3300050515 Bacteria 966
204 Ga0495612_0468148 3300053078 Bacteria 577
205 Ga0501084_0000975 3300054114 Bacteria 22193
206 Ga0501082_0027928 3300060353 Bacteria 4859
207 Ga0530510_0093863 3300061734 Bacteria 2191
208 Ga0466958_0061600
209 Ga0058863_11577071
210 Ga0065707_10591486
211 Ga0070658_11283384
212 Ga0070683_100450833
213 Ga0070683_101333861
214 Ga0070680_100020243
215 Ga0070682_100986232
216 Ga0070660_100009995
217 Ga0070660_100123665
218 Ga0070687_100274393
219 Ga0070661_100307153
220 Ga0070692_10162459
221 Ga0070669_100025210
222 Ga0070659_100188627
223 Ga0070709_10200755
224 Ga0070713_100277117
225 Ga0070713_100286823
226 Ga0070713_101923007
227 Ga0070713_102272993
228 Ga0070710_10482097
229 Ga0070701_10269761
230 Ga0070711_100089925
231 Ga0070678_100907313
232 Ga0070662_101380274
233 Ga0070681_10149159
234 Ga0070681_10185358
235 Ga0070681_10612954
236 Ga0068867_100048173
237 Ga0070679_100140326
238 Ga0068853_100025326
239 Ga0070665_100548036
240 Ga0068855_100049679
241 Ga0068854_100384891
242 Ga0068856_100072037
243 Ga0068856_100105729
244 Ga0068856_100197406
245 Ga0068852_100550547
246 Ga0068859_100144924
247 Ga0068863_102227739
248 Ga0068862_100007482
249 Ga0081455_10018137
250 Ga0070717_10116679
251 Ga0070717_10231578
252 Ga0070716_101168300
253 Ga0070712_102005542
254 Ga0097621_100877120
255 Ga0068871_100237650
256 Ga0068871_100676754
257 Ga0075428_101540538
258 Ga0097620_100144923
259 Ga0114129_11307203
260 Ga0105241_10102316
261 Ga0105248_10727016
262 Ga0105237_11102102
263 Ga0157371_10115216
264 Ga0157370_10197005
265 Ga0157370_10442091
266 Ga0157369_10002504
267 Ga0157369_10109478
268 Ga0157369_10159079
269 Ga0157374_10246253
270 Ga0157374_10587366
271 Ga0163162_13046937
272 Ga0157372_10097251
273 Ga0157372_10195139
274 Ga0157372_10517420
275 Ga0157376_10382945
276 Ga0206349_1001769
277 Ga0213873_10018619
278 Ga0213872_10000228
279 Ga0213874_10050250
280 Ga0213876_10001771
281 Ga0213876_10025252
282 Ga0213876_10336051
283 Ga0213875_10000006
284 Ga0213875_10001571
285 Ga0213875_10043001
286 Ga0213875_10063239
287 Ga0213875_10079488
288 Ga0213875_10102352
289 Ga0213875_10137079
290 Ga0213875_10376518
291 Ga0213871_10052501
292 Ga0224712_10012277
293 Ga0207692_10761213
294 Ga0207699_10251976
295 Ga0207707_10194036
296 Ga0207707_10228843
297 Ga0207707_10505180
298 Ga0207663_10573398
299 Ga0207660_10104172
300 Ga0207657_10052260
301 Ga0207657_10126974
302 Ga0207649_10236732
303 Ga0207652_10023661
304 Ga0207681_10004993
305 Ga0207664_10985775
306 Ga0207690_10447489
307 Ga0207711_10763707
308 Ga0207661_11228355
309 Ga0207661_11396624
310 Ga0207679_10043931
311 Ga0207667_10040327
312 Ga0207667_10382188
313 Ga0207651_10744831
314 Ga0207640_10305997
315 Ga0207640_10639411
316 Ga0207639_10018482
317 Ga0207708_10028469
318 Ga0207702_10005178
319 Ga0207702_10733669
320 Ga0207641_12155045
321 Ga0207683_10148664
322 Ga0207698_10384137
323 Ga0268266_10244626
324 Ga0268265_10210548
325 Ga0373935_0539586
326 Ga0373925_0066221
327 Ga0373925_0989565
328 Ga0395898_0580187
329 Ga0436364_0056033
330 Ga0436364_0235972
331 Ga0436364_0239224
332 Ga0436364_0330016
333 Ga0436364_0478514
334 Ga0436364_0580009
335 Ga0436364_0601128
336 Ga0436364_0680140
337 Ga0436364_0825054
338 Ga0436364_0834588
339 Ga0436364_0903663
340 Ga0436364_0955829
341 Ga0436364_0986873
342 Ga0436364_1023667
343 Ga0436364_1191337
344 Ga0436364_1219825
345 Ga0436364_1302461
346 Ga0436364_1478792
347 Ga0436364_1552890
348 Ga0436365_0024991
349 Ga0436365_0153194
350 Ga0436365_0221108
351 Ga0436365_0260405
352 Ga0436365_0319102
353 Ga0436365_0391802
354 Ga0436365_0468713
355 Ga0436365_1361083
356 Ga0436365_1611839
357 Ga0436360_0067805
358 Ga0436360_1353299
359 Ga0436361_0419405
360 Ga0436361_0789476
361 Ga0436363_0037731
362 Ga0436363_0215847
363 Ga0436363_1029510
364 Ga0436363_1086657
365 Ga0436363_1106592
366 Ga0436363_1708765
367 Ga0436362_0194156
368 Ga0436362_0550631
369 Ga0436362_0642024
370 Ga0436362_0732851
371 Ga0436362_0986827
372 Ga0436362_0992442
373 Ga0436362_1079685
374 Ga0436362_1166718
375 Ga0466966_0163239
376 Ga0466963_0210083
377 Ga0466963_0440809
378 Ga0466959_0597247
379 Ga0466959_0769210
380 Ga0496103_0575644
381 Ga0496104_0645063
382 Ga0496108_1072541
383 Ga0496109_1415339
384 Ga0496112_0142565
385 Ga0496115_0016442
386 Ga0501032_0005541
387 Ga0501033_0018604
388 Ga0501034_0165706
389 Ga0501036_0006398
390 Ga0501037_0010963
391 Ga0501038_0007123
392 Ga0501039_0186051
393 Ga0501043_0022621
394 Ga0501046_0008030
395 Ga0501047_0239458
396 Ga0501048_0149241
397 Ga0501067_0007847
398 Ga0501068_0207208
399 Ga0501069_0001490
400 Ga0501070_0030585
401 Ga0501072_0000773
402 Ga0501074_0040649
403 Ga0501076_0038799
404 Ga0501079_0030396
405 Ga0501080_0943131
406 Ga0501083_0292533
407 Ga0501035_0049283
408 Ga0501044_0147723
409 nmdc:mga0n895_179495_c1
410 nmdc:mga0a205_589121_c1
411 Ga0495612_0468148
412 Ga0501084_0000975
413 Ga0501082_0027928
414 Ga0530510_0093863

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07963

N_methyl

Prokaryotic N-terminal methylation motif

33

59

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lw9-assembly6.cif.gz_F crystal structure of vibrio cholera major pseudopilin epsg 0.8441 38 93
6t8s-assembly3.cif.gz_CCC structure of the major type iv pilin pila1 from clostridium difficile 0.7877 32 84
1t92-assembly1.cif.gz_B crystal structure of n-terminal truncated pseudopilin pulg 0.6902 36 107
4tsm-assembly1.cif.gz_A mbp-fusion protein of pila1 from c. difficile r20291 residues 26-166 0.6374 14 81
3gn9-assembly3.cif.gz_C crystal structure of the major pseudopilin from the type 2 secretion system of vibrio vulnificus 0.6084 34 112
ID Description Score Start End Superfamily
af_Q2G2J0_11_103_3.30.700.10 Alpha Beta;2-Layer Sandwich;Glycoprotein, Type 4 Pilin;Glycoprotein, Type 4 Pilin 0.7549 16 78 3.30.700.10
1t92B01 Alpha Beta;2-Layer Sandwich;Glycoprotein, Type 4 Pilin;Glycoprotein, Type 4 Pilin 0.6991 36 106 3.30.700.10
af_Q2FY39_1_193_1.10.287.1490 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.5862 1 72 1.10.287.1490
af_P36647_8_140_3.30.700.10 Alpha Beta;2-Layer Sandwich;Glycoprotein, Type 4 Pilin;Glycoprotein, Type 4 Pilin 0.5792 17 60 3.30.700.10
1ay2A00 Alpha Beta;2-Layer Sandwich;Glycoprotein, Type 4 Pilin;Glycoprotein, Type 4 Pilin 0.5273 17 74 3.30.700.10
ID Description Score Start End GO Terms
AF-A0A1F5RK58-F1-model_v4 Tetratricopeptide repeat protein 0.9792 38 84
AF-A0A432QPQ0-F1-model_v4 Tetratricopeptide repeat protein 0.9788 35 84
AF-A0A2U3JVA2-F1-model_v4 TonB C-terminal domain-containing protein 0.9777 30 129 GO:0005886
GO:0015031
GO:0055085
AF-A0A1W9U6X2-F1-model_v4 Tetratricopeptide repeat protein 0.9694 35 84
AF-A0A7D5ZA03-F1-model_v4 Uncharacterized protein 0.9627 37 83

Map