F316647

General Info

Members Datasets Scaffolds Average Seq Length
207 131 414 217

Family's Representative Sequence

Representative Sequence 3300031456|Ga0307513_10001210|Ga0307513_1000121027
Length 236
Sequence MPNPVIIIVGAGPGVGAATARKFAAAGYDIGLLARNAKRLEEFANELEKAGANVGWAAVDIADPVALDATLRRMTDQTGRVDVLVHNVSAFRPVRATELTVEELLADLGVGAASLLTAVQAVLPILREQRTGTIIATGSGAADHPNVEAASLGMQKAALRNLIQVLAAELSGDGIHVATLTVRGSIADGTPFSADNIAEVFAGLVAETSTDQANWHTLLNLTKDGVSQLTQSGVVQ

Samples

Sample ID Description Type Environment
1 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
15 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
16 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
17 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
18 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
20 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
21 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
22 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
23 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
24 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
25 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
27 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
28 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
29 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
30 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
31 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
32 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
33 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
34 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
49 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
50 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
51 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
52 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
53 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
54 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
55 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
56 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
57 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
58 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
59 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
60 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
61 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
62 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
63 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
64 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
65 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
66 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
67 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
68 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
69 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
70 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
71 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
72 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
73 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
74 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
75 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
76 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
77 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
78 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
79 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
80 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
81 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
82 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
83 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
84 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
85 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
86 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
87 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
88 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
89 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
90 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
91 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
92 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
93 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
101 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
102 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
103 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
104 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
105 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
106 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
107 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
108 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
109 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
112 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
113 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
114 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
115 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
116 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
117 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
118 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
119 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
120 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
121 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
122 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
123 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
124 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
125 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
126 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
127 2643221615 Nocardioides sp. Root224 Isolate Unclassified
128 2643221641 Nocardioides sp. Root122 Isolate Unclassified
129 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
130 2739367898 Nocardioides sp. CF479 Isolate Unclassified
131 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.58
Metatranscriptomes 0
Isolates 2.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.01
Nodule 0.48
Rhizoplane 9.66
Rhizosphere 69.57
Stem 0
Stem Tuber 0
Unclassified 1.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307513_10001210 3300031456 Bacteria 37454
2 JGI25406J46586_10010854 3300003203 Bacteria 4018
3 rootL2_10096661 3300003322 Bacteria 1495
4 Ga0070683_100156521 3300005329 Bacteria 2161
5 Ga0070677_10395779 3300005333 Bacteria 727
6 Ga0070682_100058155 3300005337 Bacteria 2437
7 Ga0070682_100504725 3300005337 Bacteria 938
8 Ga0068868_100068800 3300005338 Bacteria 2820
9 Ga0070668_100197440 3300005347 Bacteria 1651
10 Ga0070674_100332848 3300005356 Bacteria 1221
11 Ga0070700_100051000 3300005441 Bacteria 2574
12 Ga0070678_100214019 3300005456 Bacteria 1598
13 Ga0070685_10110829 3300005466 Bacteria 1690
14 Ga0070684_100172973 3300005535 Bacteria 1962
15 Ga0070684_100245805 3300005535 Bacteria 1635
16 Ga0070672_100814202 3300005543 Bacteria 822
17 Ga0070664_100812986 3300005564 Bacteria 874
18 Ga0068861_100613681 3300005719 Bacteria 1000
19 Ga0068870_10497936 3300005840 Bacteria 812
20 Ga0081539_10000717 3300005985 Bacteria 66511
21 Ga0081539_10025338 3300005985 Bacteria 3823
22 Ga0075365_10048127 3300006038 Bacteria 2805
23 Ga0075365_10262282 3300006038 Bacteria 1215
24 Ga0075368_10000401 3300006042 Bacteria 12702
25 Ga0075368_10169862 3300006042 Bacteria 916
26 Ga0075368_10242759 3300006042 Bacteria 768
27 Ga0075363_100005690 3300006048 Bacteria 5579
28 Ga0075363_100022058 3300006048 Bacteria 3215
29 Ga0075364_10010155 3300006051 Bacteria 5678
30 Ga0075367_10074758 3300006178 Bacteria 2043
31 Ga0075367_10096624 3300006178 Bacteria 1802
32 Ga0075370_10001982 3300006353 Bacteria 9277
33 Ga0111539_11589631 3300009094 Bacteria 758
34 Ga0105245_10471481 3300009098 Bacteria 1267
35 Ga0105243_10139607 3300009148 Bacteria 2066
36 Ga0105243_10209721 3300009148 Bacteria 1715
37 Ga0105243_10684668 3300009148 Bacteria 998
38 Ga0105238_10226593 3300009551 Bacteria 1846
39 Ga0105249_10111842 3300009553 Bacteria 2582
40 Ga0105249_10602101 3300009553 Bacteria 1154
41 Ga0163162_10616451 3300013306 Bacteria 1210
42 Ga0157375_10016569 3300013308 Bacteria 6626
43 Ga0157380_10532611 3300014326 Bacteria 1148
44 Ga0163161_10766068 3300017792 Bacteria 808
45 Ga0207642_10194396 3300025899 Bacteria 1116
46 Ga0207659_10221885 3300025926 Bacteria 1520
47 Ga0207709_10308141 3300025935 Bacteria 1180
48 Ga0207709_10344500 3300025935 Bacteria 1123
49 Ga0207691_10072436 3300025940 Bacteria 3108
50 Ga0207661_10613245 3300025944 Bacteria 999
51 Ga0207679_10773378 3300025945 Bacteria 874
52 Ga0207651_11019252 3300025960 Bacteria 740
53 Ga0207712_10481746 3300025961 Bacteria 1058
54 Ga0207668_10473626 3300025972 Bacteria 1073
55 Ga0207677_10931742 3300026023 Bacteria 784
56 Ga0207708_10004745 3300026075 Bacteria 10001
57 Ga0207708_10405901 3300026075 Bacteria 1128
58 Ga0207648_10238867 3300026089 Bacteria 1617
59 Ga0207675_100027880 3300026118 Bacteria 5261
60 Ga0207675_100151341 3300026118 Bacteria 2208
61 Ga0207683_10077690 3300026121 Bacteria 2940
62 Ga0209813_10184109 3300027866 Bacteria 765
63 Ga0307408_100390863 3300031548 Bacteria 1192
64 Ga0307405_10081826 3300031731 Bacteria 2112
65 Ga0307405_10146028 3300031731 Bacteria 1657
66 Ga0307413_10031235 3300031824 Bacteria 3003
67 Ga0307410_10134641 3300031852 Bacteria 1820
68 Ga0307410_10176604 3300031852 Bacteria 1614
69 Ga0307410_10201190 3300031852 Bacteria 1521
70 Ga0307410_10314705 3300031852 Bacteria 1240
71 Ga0307410_10480930 3300031852 Bacteria 1019
72 Ga0307406_10062692 3300031901 Bacteria 2406
73 Ga0307406_10092176 3300031901 Bacteria 2043
74 Ga0307407_10107152 3300031903 Bacteria 1747
75 Ga0307407_10308716 3300031903 Bacteria 1106
76 Ga0307407_10509821 3300031903 Unclassified 883
77 Ga0307412_10083101 3300031911 Bacteria 2219
78 Ga0307412_10243181 3300031911 Bacteria 1393
79 Ga0307412_10486128 3300031911 Bacteria 1025
80 Ga0307409_100041439 3300031995 Bacteria 3439
81 Ga0307409_100144179 3300031995 Bacteria 2057
82 Ga0307409_100162110 3300031995 Bacteria 1957
83 Ga0307409_100195736 3300031995 Bacteria 1804
84 Ga0307409_100467334 3300031995 Bacteria 1221
85 Ga0307409_100472472 3300031995 Bacteria 1215
86 Ga0307409_100613090 3300031995 Bacteria 1077
87 Ga0307416_100027813 3300032002 Bacteria 4195
88 Ga0307416_100316199 3300032002 Bacteria 1561
89 Ga0307411_10028049 3300032005 Bacteria 3417
90 Ga0307411_10153458 3300032005 Bacteria 1715
91 Ga0307411_10743192 3300032005 Bacteria 859
92 Ga0307415_100020798 3300032126 Bacteria 4016
93 Ga0307415_100131324 3300032126 Bacteria 1897
94 Ga0307415_100302125 3300032126 Bacteria 1326
95 Ga0307415_100308395 3300032126 Bacteria 1314
96 Ga0395898_0383805 3300037466 Unclassified 1340
97 Ga0395905_0057419 3300037471 Bacteria 3641
98 Ga0395901_0061413 3300038443 Bacteria 3910
99 Ga0395901_0185100 3300038443 Bacteria 2184
100 Ga0451789_1235943 3300041443 Bacteria 801
101 Ga0451789_1247839 3300041443 Unclassified 670
102 Ga0451791_0001299 3300041451 Bacteria 1954
103 Ga0451800_0914655 3300041459 Bacteria 719
104 Ga0451837_0223300 3300041494 Bacteria 804
105 Ga0451841_0670942 3300041498 Bacteria 968
106 Ga0451841_1201254 3300041498 Bacteria 1254
107 Ga0451843_1094427 3300041509 Bacteria 2644
108 Ga0451843_1755625 3300041509 Bacteria 2218
109 Ga0451853_1663260 3300041512 Bacteria 821
110 Ga0466972_0018159 3300044658 Bacteria 3518
111 Ga0466972_0055844 3300044658 Bacteria 1899
112 Ga0466965_0044781 3300044683 Bacteria 2188
113 Ga0466965_0090858 3300044683 Bacteria 1553
114 Ga0466966_0186213 3300044684 Bacteria 1258
115 Ga0466961_0088992 3300044693 Bacteria 1950
116 Ga0466963_0133180 3300044694 Bacteria 1718
117 Ga0466971_0052688 3300044719 Bacteria 1833
118 Ga0466971_0296946 3300044719 Bacteria 775
119 Ga0466970_0031091 3300044765 Bacteria 2819
120 Ga0466970_0139346 3300044765 Bacteria 1335
121 Ga0466957_0001303 3300044842 Bacteria 13030
122 Ga0466957_0059002 3300044842 Bacteria 2351
123 Ga0466957_0159850 3300044842 Bacteria 1463
124 Ga0466960_0005256 3300044901 Bacteria 5114
125 Ga0466960_0261852 3300044901 Bacteria 964
126 Ga0466967_0159498 3300045976 Bacteria 2116
127 Ga0466967_0665530 3300045976 Bacteria 1030
128 Ga0495664_0240744 3300046477 Bacteria 1095
129 Ga0495620_0133657 3300046515 Bacteria 972
130 Ga0496100_0159213 3300048903 Bacteria 1617
131 Ga0496101_0621302 3300048904 Bacteria 854
132 Ga0496102_0073319 3300048905 Bacteria 3146
133 Ga0496103_0044377 3300048906 Bacteria 2739
134 Ga0496105_0232710 3300048908 Bacteria 1497
135 Ga0496105_0239492 3300048908 Bacteria 1473
136 Ga0496106_0185952 3300048909 Bacteria 1650
137 Ga0496109_0217560 3300048912 Bacteria 1796
138 Ga0496109_0615065 3300048912 Bacteria 1023
139 Ga0496109_0927978 3300048912 Bacteria 808
140 Ga0496110_0198022 3300048913 Bacteria 1825
141 Ga0496110_0357557 3300048913 Bacteria 1330
142 Ga0496111_0343020 3300048914 Bacteria 1106
143 Ga0496111_0352460 3300048914 Bacteria 1089
144 Ga0496114_0261434 3300048917 Bacteria 1524
145 Ga0496114_0534258 3300048917 Bacteria 1037
146 Ga0496117_0342755 3300048920 Bacteria 775
147 Ga0501031_0063066 3300049568 Bacteria 2415
148 Ga0501031_0308378 3300049568 Bacteria 1025
149 Ga0501036_0627974 3300049572 Bacteria 890
150 Ga0501036_0940323 3300049572 Bacteria 709
151 Ga0501039_0029265 3300049575 Bacteria 4242
152 Ga0501039_0077285 3300049575 Bacteria 2589
153 Ga0501039_0689337 3300049575 Bacteria 799
154 Ga0501040_0022766 3300049576 Bacteria 4198
155 Ga0501040_0165758 3300049576 Bacteria 1563
156 Ga0501040_0664690 3300049576 Bacteria 753
157 Ga0501041_0171130 3300049577 Bacteria 1359
158 Ga0501042_0065859 3300049578 Bacteria 2589
159 Ga0501042_0200301 3300049578 Bacteria 1440
160 Ga0501048_0411614 3300049582 Bacteria 967
161 Ga0501067_0025041 3300049583 Bacteria 3309
162 Ga0501067_0117843 3300049583 Bacteria 1477
163 Ga0501067_0252530 3300049583 Bacteria 982
164 Ga0501068_0058708 3300049584 Bacteria 2335
165 Ga0501068_0288470 3300049584 Bacteria 1049
166 Ga0501069_0248971 3300049585 Bacteria 1036
167 Ga0501071_0047819 3300049587 Bacteria 3074
168 Ga0501071_0144023 3300049587 Bacteria 1776
169 Ga0501074_0246601 3300049590 Bacteria 1270
170 Ga0501074_0488191 3300049590 Bacteria 873
171 Ga0501075_0164251 3300049591 Bacteria 1694
172 Ga0501075_0241972 3300049591 Bacteria 1376
173 Ga0501075_0364250 3300049591 Bacteria 1102
174 Ga0501217_096951 3300049661 Bacteria 834
175 Ga0501079_0641689 3300049741 Bacteria 836
176 Ga0501081_0153843 3300049743 Bacteria 1654
177 Ga0501035_0616453 3300049822 Bacteria 883
178 Ga0501045_0052400 3300049824 Bacteria 2979
179 Ga0501045_0069007 3300049824 Bacteria 2598
180 Ga0501045_0188030 3300049824 Bacteria 1539
181 Ga0501045_0276768 3300049824 Bacteria 1249
182 Ga0501204_023076 3300049850 Bacteria 825
183 nmdc:mga03683_15772_c1 3300050489 Bacteria 2826
184 nmdc:mga03n38_11245_c1 3300050490 Bacteria 3327
185 nmdc:mga03n38_159590_c1 3300050490 Bacteria 1141
186 nmdc:mga00v17_28818_c1 3300050491 Bacteria 3255
187 nmdc:mga00v17_51877_c1 3300050491 Bacteria 2494
188 nmdc:mga0yw44_100452_c1 3300050492 Bacteria 1842
189 nmdc:mga0yw44_46849_c1 3300050492 Bacteria 2599
190 nmdc:mga06z11_24613_c1 3300050494 Bacteria 2843
191 nmdc:mga04h51_143093_c1 3300050495 Bacteria 908
192 nmdc:mga04h51_5389_c1 3300050495 Bacteria 3260
193 nmdc:mga07m45_8923_c1 3300050496 Bacteria 5177
194 Ga0495601_0093756 3300053077 Bacteria 1934
195 Ga0500644_0000172 3300053088 Bacteria 41281
196 Ga0500556_0000671 3300053104 Bacteria 21241
197 Ga0500593_000209 3300053117 Bacteria 24034
198 Ga0500573_0059201 3300053140 Bacteria 2195
199 Ga0500616_0001413 3300053153 Bacteria 23136
200 Ga0500616_0001557 3300053153 Bacteria 21492
201 Ga0466962_0046925 3300061719 Bacteria 2064
202 Ga0530510_0089644 3300061734 Bacteria 2243
203 2644089912 2643221615 Bacteria 5487866
204 2644230818 2643221641 Bacteria 4490190
205 2644319757 2643221657 Bacteria 5490246
206 2740167554 2739367898 Bacteria 4367674
207 8054613128 8054609563 Bacteria 5170090
208 Ga0307513_10001210
209 JGI25406J46586_10010854
210 rootL2_10096661
211 Ga0070683_100156521
212 Ga0070677_10395779
213 Ga0070682_100058155
214 Ga0070682_100504725
215 Ga0068868_100068800
216 Ga0070668_100197440
217 Ga0070674_100332848
218 Ga0070700_100051000
219 Ga0070678_100214019
220 Ga0070685_10110829
221 Ga0070684_100172973
222 Ga0070684_100245805
223 Ga0070672_100814202
224 Ga0070664_100812986
225 Ga0068861_100613681
226 Ga0068870_10497936
227 Ga0081539_10000717
228 Ga0081539_10025338
229 Ga0075365_10048127
230 Ga0075365_10262282
231 Ga0075368_10000401
232 Ga0075368_10169862
233 Ga0075368_10242759
234 Ga0075363_100005690
235 Ga0075363_100022058
236 Ga0075364_10010155
237 Ga0075367_10074758
238 Ga0075367_10096624
239 Ga0075370_10001982
240 Ga0111539_11589631
241 Ga0105245_10471481
242 Ga0105243_10139607
243 Ga0105243_10209721
244 Ga0105243_10684668
245 Ga0105238_10226593
246 Ga0105249_10111842
247 Ga0105249_10602101
248 Ga0163162_10616451
249 Ga0157375_10016569
250 Ga0157380_10532611
251 Ga0163161_10766068
252 Ga0207642_10194396
253 Ga0207659_10221885
254 Ga0207709_10308141
255 Ga0207709_10344500
256 Ga0207691_10072436
257 Ga0207661_10613245
258 Ga0207679_10773378
259 Ga0207651_11019252
260 Ga0207712_10481746
261 Ga0207668_10473626
262 Ga0207677_10931742
263 Ga0207708_10004745
264 Ga0207708_10405901
265 Ga0207648_10238867
266 Ga0207675_100027880
267 Ga0207675_100151341
268 Ga0207683_10077690
269 Ga0209813_10184109
270 Ga0307408_100390863
271 Ga0307405_10081826
272 Ga0307405_10146028
273 Ga0307413_10031235
274 Ga0307410_10134641
275 Ga0307410_10176604
276 Ga0307410_10201190
277 Ga0307410_10314705
278 Ga0307410_10480930
279 Ga0307406_10062692
280 Ga0307406_10092176
281 Ga0307407_10107152
282 Ga0307407_10308716
283 Ga0307407_10509821
284 Ga0307412_10083101
285 Ga0307412_10243181
286 Ga0307412_10486128
287 Ga0307409_100041439
288 Ga0307409_100144179
289 Ga0307409_100162110
290 Ga0307409_100195736
291 Ga0307409_100467334
292 Ga0307409_100472472
293 Ga0307409_100613090
294 Ga0307416_100027813
295 Ga0307416_100316199
296 Ga0307411_10028049
297 Ga0307411_10153458
298 Ga0307411_10743192
299 Ga0307415_100020798
300 Ga0307415_100131324
301 Ga0307415_100302125
302 Ga0307415_100308395
303 Ga0395898_0383805
304 Ga0395905_0057419
305 Ga0395901_0061413
306 Ga0395901_0185100
307 Ga0451789_1235943
308 Ga0451789_1247839
309 Ga0451791_0001299
310 Ga0451800_0914655
311 Ga0451837_0223300
312 Ga0451841_0670942
313 Ga0451841_1201254
314 Ga0451843_1094427
315 Ga0451843_1755625
316 Ga0451853_1663260
317 Ga0466972_0018159
318 Ga0466972_0055844
319 Ga0466965_0044781
320 Ga0466965_0090858
321 Ga0466966_0186213
322 Ga0466961_0088992
323 Ga0466963_0133180
324 Ga0466971_0052688
325 Ga0466971_0296946
326 Ga0466970_0031091
327 Ga0466970_0139346
328 Ga0466957_0001303
329 Ga0466957_0059002
330 Ga0466957_0159850
331 Ga0466960_0005256
332 Ga0466960_0261852
333 Ga0466967_0159498
334 Ga0466967_0665530
335 Ga0495664_0240744
336 Ga0495620_0133657
337 Ga0496100_0159213
338 Ga0496101_0621302
339 Ga0496102_0073319
340 Ga0496103_0044377
341 Ga0496105_0232710
342 Ga0496105_0239492
343 Ga0496106_0185952
344 Ga0496109_0217560
345 Ga0496109_0615065
346 Ga0496109_0927978
347 Ga0496110_0198022
348 Ga0496110_0357557
349 Ga0496111_0343020
350 Ga0496111_0352460
351 Ga0496114_0261434
352 Ga0496114_0534258
353 Ga0496117_0342755
354 Ga0501031_0063066
355 Ga0501031_0308378
356 Ga0501036_0627974
357 Ga0501036_0940323
358 Ga0501039_0029265
359 Ga0501039_0077285
360 Ga0501039_0689337
361 Ga0501040_0022766
362 Ga0501040_0165758
363 Ga0501040_0664690
364 Ga0501041_0171130
365 Ga0501042_0065859
366 Ga0501042_0200301
367 Ga0501048_0411614
368 Ga0501067_0025041
369 Ga0501067_0117843
370 Ga0501067_0252530
371 Ga0501068_0058708
372 Ga0501068_0288470
373 Ga0501069_0248971
374 Ga0501071_0047819
375 Ga0501071_0144023
376 Ga0501074_0246601
377 Ga0501074_0488191
378 Ga0501075_0164251
379 Ga0501075_0241972
380 Ga0501075_0364250
381 Ga0501217_096951
382 Ga0501079_0641689
383 Ga0501081_0153843
384 Ga0501035_0616453
385 Ga0501045_0052400
386 Ga0501045_0069007
387 Ga0501045_0188030
388 Ga0501045_0276768
389 Ga0501204_023076
390 nmdc:mga03683_15772_c1
391 nmdc:mga03n38_11245_c1
392 nmdc:mga03n38_159590_c1
393 nmdc:mga00v17_28818_c1
394 nmdc:mga00v17_51877_c1
395 nmdc:mga0yw44_100452_c1
396 nmdc:mga0yw44_46849_c1
397 nmdc:mga06z11_24613_c1
398 nmdc:mga04h51_143093_c1
399 nmdc:mga04h51_5389_c1
400 nmdc:mga07m45_8923_c1
401 Ga0495601_0093756
402 Ga0500644_0000172
403 Ga0500556_0000671
404 Ga0500593_000209
405 Ga0500573_0059201
406 Ga0500616_0001413
407 Ga0500616_0001557
408 Ga0466962_0046925
409 Ga0530510_0089644
410 2644089912
411 2644230818
412 2644319757
413 2740167554
414 8054613128

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

4

194

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

10

191

0.93

PF08659

KR

KR domain

4

181

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7e6o-assembly1.cif.gz_D crystal structure of polyol dehydrogenase from paracoccus denitrificans 0.8952 4 172
3gvc-assembly2.cif.gz_D-3 crystal structure of probable short-chain dehydrogenase-reductase from mycobacterium tuberculosis 0.8936 4 210
4trr-assembly2.cif.gz_E crystal structure of a putative putative d-beta-hydroxybutyrate dehydrogenase from burkholderia cenocepacia j2315 0.8915 1 210
1ae1-assembly1.cif.gz_A tropinone reductase-i complex with nadp 0.8842 4 209
6oz7-assembly2.cif.gz_G putative oxidoreductase from escherichia coli str. k-12 0.8826 4 210
ID Description Score Start End Superfamily
af_A0A1D6ED38_49_231_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9195 1 168 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9154 4 172 3.40.50.720
af_Q62730_83_351_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9015 3 174 3.40.50.720
af_A0A0P0Y501_3_211_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8977 4 174 3.40.50.720
4e6pC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8965 4 177 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A853CA76-F1-model_v4 NADP-dependent 3-hydroxy acid dehydrogenase YdfG 0.9777 4 211
AF-A0A543PBW8-F1-model_v4 NADP-dependent 3-hydroxy acid dehydrogenase YdfG 0.9637 1 212
AF-A0A543PBW8-F1-model_v4 NADP-dependent 3-hydroxy acid dehydrogenase YdfG 0.9593 1 212
AF-A0A853CA76-F1-model_v4 NADP-dependent 3-hydroxy acid dehydrogenase YdfG 0.9551 4 211
AF-A0A5P9I5G7-F1-model_v4 Putative oxidoreductase (EC 1.-.-.-) 0.9541 4 191 GO:0008667
GO:0019290

Map