F316301

General Info

Members Datasets Scaffolds Average Seq Length
207 115 414 196

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100011704|Ga0075428_1000117044
Length 223
Sequence VRASLSLVGSGEEASGMRGGSVHMWNRWSGSSLIALAVVSWLALSPSQALGESGDLPKIGPAPAFSLTTQAGARLSLQDLRGKVVAVTFIYASCADTCPLLTAKLAGLQARLGTAVGTKVFFVAITVDPERDTPEVLTRYAQAHGVNLAGWAFLTGTPAEIQQVARHYGIYAKKRPRGAVDHTFLTSLIDHRGTLRVQYLGVRFDPEELLHDLQALVQEEAQS

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
41 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
79 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
80 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
81 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
82 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
83 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
84 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
85 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
86 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
87 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
88 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
89 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
90 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
91 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
92 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
95 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
96 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
97 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
98 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
99 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
100 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
101 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
102 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
103 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
104 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
105 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
106 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
107 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
108 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
109 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
110 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
111 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
112 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
113 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
114 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
115 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.07
Metatranscriptomes 0.97
Isolates 0.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0.97
Rhizoplane 2.42
Rhizosphere 95.65
Stem 0
Stem Tuber 0
Unclassified 18.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100011704 3300006844 Bacteria 9766
2 MRS1b_contig_5274169 2162886011 Bacteria 3580
3 MBSR1b_contig_3562783 2162886012 Bacteria 5192
4 MBSR1b_contig_6294703 2162886012 Bacteria 4096
5 JGI25406J46586_10008196 3300003203 Bacteria 4743
6 Ga0058859_11266254 3300004798 Bacteria 1977
7 Ga0058860_10585609 3300004801 Bacteria 1895
8 Ga0065715_10001660 3300005293 Bacteria 11961
9 Ga0065715_10104775 3300005293 Bacteria 2936
10 Ga0065707_10096695 3300005295 Bacteria 3243
11 Ga0070690_100082812 3300005330 Unclassified 2101
12 Ga0068869_100182266 3300005334 Unclassified 1647
13 Ga0068868_100567518 3300005338 Unclassified 1002
14 Ga0070660_100065231 3300005339 Bacteria 2834
15 Ga0070660_101102580 3300005339 Unclassified 672
16 Ga0070689_100091218 3300005340 Unclassified 2402
17 Ga0070687_100164982 3300005343 Unclassified 1313
18 Ga0070675_100495501 3300005354 Unclassified 1100
19 Ga0070659_100014621 3300005366 Bacteria 5868
20 Ga0070708_100057111 3300005445 Bacteria 3474
21 Ga0070708_100355409 3300005445 Bacteria 1381
22 Ga0070678_100330768 3300005456 Bacteria 1304
23 Ga0070662_100004030 3300005457 Bacteria 9218
24 Ga0070706_100027881 3300005467 Bacteria 5194
25 Ga0070707_100283554 3300005468 Bacteria 1610
26 Ga0070698_101211199 3300005471 Bacteria 704
27 Ga0070699_100211693 3300005518 Bacteria 1726
28 Ga0070699_100444221 3300005518 Bacteria 1175
29 Ga0070684_100518852 3300005535 Unclassified 1104
30 Ga0070697_100396128 3300005536 Bacteria 1198
31 Ga0070672_100265166 3300005543 Unclassified 1449
32 Ga0070695_100541605 3300005545 Bacteria 906
33 Ga0070696_100006217 3300005546 Bacteria 7990
34 Ga0070704_100821202 3300005549 Unclassified 832
35 Ga0068855_100179789 3300005563 Bacteria 2392
36 Ga0070664_100031881 3300005564 Bacteria 4407
37 Ga0068856_100112712 3300005614 Bacteria 2718
38 Ga0068859_100305325 3300005617 Unclassified 1685
39 Ga0068859_100519071 3300005617 Bacteria 1286
40 Ga0068861_100545503 3300005719 Unclassified 1056
41 Ga0068863_100053259 3300005841 Bacteria 3835
42 Ga0068863_100608071 3300005841 Bacteria 1082
43 Ga0068858_100933386 3300005842 Bacteria 849
44 Ga0081455_10073657 3300005937 Bacteria 2823
45 Ga0081538_10028243 3300005981 Bacteria 3865
46 Ga0081538_10051736 3300005981 Bacteria 2462
47 Ga0081539_10000083 3300005985 Bacteria 218881
48 Ga0081539_10044357 3300005985 Bacteria 2568
49 Ga0075432_10129968 3300006058 Bacteria 953
50 Ga0070715_10031871 3300006163 Bacteria 2143
51 Ga0075428_100023315 3300006844 Bacteria 6848
52 Ga0075428_100049762 3300006844 Bacteria 4598
53 Ga0075428_100193986 3300006844 Bacteria 2197
54 Ga0075428_100212884 3300006844 Bacteria 2088
55 Ga0075428_100597728 3300006844 Bacteria 1179
56 Ga0075428_100703321 3300006844 Bacteria 1076
57 Ga0075430_100084361 3300006846 Bacteria 2660
58 Ga0075431_100014824 3300006847 Bacteria 7891
59 Ga0075431_100150712 3300006847 Bacteria 2394
60 Ga0075431_100221762 3300006847 Bacteria 1929
61 Ga0075431_100430801 3300006847 Bacteria 1317
62 Ga0075433_10023599 3300006852 Bacteria 5179
63 Ga0075433_10033743 3300006852 Bacteria 4390
64 Ga0075433_10250939 3300006852 Unclassified 1570
65 Ga0075433_10458416 3300006852 Bacteria 1123
66 Ga0075434_100004031 3300006871 Bacteria 13169
67 Ga0075434_100023901 3300006871 Bacteria 5965
68 Ga0075434_100032605 3300006871 Bacteria 5138
69 Ga0075429_100024440 3300006880 Bacteria 5242
70 Ga0075429_100158566 3300006880 Bacteria 1981
71 Ga0075429_100170109 3300006880 Bacteria 1909
72 Ga0075436_100000170 3300006914 Bacteria 41018
73 Ga0075436_100040534 3300006914 Bacteria 3214
74 Ga0075436_100135113 3300006914 Bacteria 1731
75 Ga0075436_100262290 3300006914 Bacteria 1232
76 Ga0097620_100305312 3300006931 Unclassified 1685
77 Ga0097620_100519088 3300006931 Bacteria 1286
78 Ga0075435_100000256 3300007076 Bacteria 33084
79 Ga0075435_100013883 3300007076 Bacteria 6007
80 Ga0075435_100034930 3300007076 Bacteria 3987
81 Ga0075435_100113686 3300007076 Bacteria 2253
82 Ga0111539_10079064 3300009094 Bacteria 3868
83 Ga0111539_10084638 3300009094 Bacteria 3728
84 Ga0111539_10182663 3300009094 Bacteria 2449
85 Ga0111539_10186553 3300009094 Bacteria 2422
86 Ga0111539_10231011 3300009094 Unclassified 2154
87 Ga0111539_10787143 3300009094 Bacteria 1107
88 Ga0114129_10058230 3300009147 Bacteria 5405
89 Ga0114129_10059023 3300009147 Bacteria 5365
90 Ga0114129_10089180 3300009147 Bacteria 4275
91 Ga0114129_10114085 3300009147 Bacteria 3726
92 Ga0114129_10114343 3300009147 Bacteria 3721
93 Ga0114129_10271794 3300009147 Unclassified 2267
94 Ga0114129_10327738 3300009147 Bacteria 2034
95 Ga0114129_10397088 3300009147 Bacteria 1818
96 Ga0114129_10461487 3300009147 Bacteria 1664
97 Ga0114129_10481009 3300009147 Unclassified 1625
98 Ga0114129_10485606 3300009147 Bacteria 1616
99 Ga0114129_11041829 3300009147 Unclassified 1028
100 Ga0105242_10077036 3300009176 Bacteria 2781
101 Ga0105248_11469966 3300009177 Bacteria 771
102 Ga0105249_10056640 3300009553 Bacteria 3588
103 Ga0105249_10171069 3300009553 Bacteria 2107
104 Ga0105239_10400960 3300010375 Unclassified 1552
105 Ga0163162_10142772 3300013306 Bacteria 2508
106 Ga0163162_11786099 3300013306 Bacteria 703
107 Ga0157375_11146999 3300013308 Bacteria 911
108 Ga0163163_11664950 3300014325 Bacteria 699
109 Ga0157379_10289634 3300014968 Bacteria 1491
110 Ga0157376_10563288 3300014969 Bacteria 1129
111 Ga0207685_10024513 3300025905 Bacteria 2069
112 Ga0207684_10074361 3300025910 Bacteria 2887
113 Ga0207657_10058563 3300025919 Bacteria 3314
114 Ga0207646_10067396 3300025922 Bacteria 3196
115 Ga0207681_10103818 3300025923 Unclassified 2055
116 Ga0207659_10272942 3300025926 Bacteria 1380
117 Ga0207690_10008584 3300025932 Bacteria 6063
118 Ga0207706_10011303 3300025933 Bacteria 8133
119 Ga0207706_10024310 3300025933 Bacteria 5431
120 Ga0207709_10083311 3300025935 Bacteria 2067
121 Ga0207665_10160561 3300025939 Bacteria 1616
122 Ga0207691_10580874 3300025940 Unclassified 949
123 Ga0207679_10089542 3300025945 Bacteria 2376
124 Ga0207667_10085788 3300025949 Bacteria 3259
125 Ga0207641_10496182 3300026088 Bacteria 1185
126 Ga0207648_10553126 3300026089 Bacteria 1057
127 Ga0207428_10034618 3300027907 Bacteria 4135
128 Ga0268264_11431747 3300028381 Unclassified 702
129 Ga0307408_100631603 3300031548 Bacteria 955
130 Ga0307406_10076523 3300031901 Bacteria 2211
131 Ga0373930_0072875 3300034816 Bacteria 783
132 Ga0373939_0037538 3300035114 Bacteria 1439
133 Ga0373939_0106499 3300035114 Bacteria 970
134 Ga0373931_0003422 3300035691 Bacteria 7122
135 Ga0373931_0018823 3300035691 Bacteria 3438
136 Ga0373931_0097368 3300035691 Bacteria 1649
137 Ga0395899_0027056 3300037312 Bacteria 4325
138 Ga0395901_0000703 3300038443 Bacteria 38220
139 Ga0439435_0099846 3300042436 Bacteria 891
140 Ga0451576_0006484 3300045051 Bacteria 14340
141 Ga0451576_0080309 3300045051 Bacteria 3393
142 Ga0451576_0092677 3300045051 Bacteria 3142
143 Ga0451576_0231373 3300045051 Bacteria 1930
144 Ga0496104_0261037 3300048907 Unclassified 1645
145 Ga0496106_0311985 3300048909 Unclassified 1262
146 Ga0496108_0512182 3300048911 Unclassified 1048
147 Ga0496112_0005004 3300048915 Bacteria 11371
148 Ga0496113_0098559 3300048916 Bacteria 2263
149 Ga0501040_0261816 3300049576 Bacteria 1234
150 Ga0501042_0614484 3300049578 Unclassified 790
151 Ga0501042_0697911 3300049578 Bacteria 738
152 Ga0501072_0050146 3300049588 Bacteria 3287
153 Ga0501072_0509843 3300049588 Bacteria 951
154 Ga0501075_0055730 3300049591 Bacteria 2975
155 Ga0501076_0033798 3300049592 Bacteria 3993
156 Ga0501076_0145382 3300049592 Unclassified 1928
157 Ga0501076_0278212 3300049592 Bacteria 1371
158 Ga0501076_0626216 3300049592 Unclassified 888
159 Ga0501077_0502874 3300049593 Bacteria 777
160 Ga0501079_0090466 3300049741 Bacteria 2371
161 Ga0501079_0657874 3300049741 Unclassified 825
162 Ga0501080_1057154 3300049742 Unclassified 702
163 Ga0501081_0097264 3300049743 Bacteria 2077
164 Ga0501035_0633105 3300049822 Archaea 869
165 nmdc:mga05p37_105820_c1 3300050507 Bacteria 3461
166 nmdc:mga05p37_107231_c1 3300050507 Bacteria 3437
167 nmdc:mga05p37_139731_c1 3300050507 Bacteria 2968
168 nmdc:mga05p37_213237_c1 3300050507 Bacteria 2333
169 nmdc:mga05p37_266929_c1 3300050507 Bacteria 2046
170 nmdc:mga05p37_372980_c1 3300050507 Bacteria 1674
171 nmdc:mga05p37_58250_c1 3300050507 Bacteria 4758
172 nmdc:mga05p37_98890_c1 3300050507 Bacteria 3594
173 nmdc:mga09592_152846_c1 3300050508 Bacteria 1992
174 nmdc:mga09592_3796_c1 3300050508 Bacteria 12158
175 nmdc:mga09592_500117_c1 3300050508 Unclassified 1047
176 nmdc:mga0qj67_81816_c1 3300050509 Bacteria 2589
177 nmdc:mga06r32_19209_c1 3300050510 Bacteria 6272
178 nmdc:mga06r32_22120_c1 3300050510 Bacteria 5875
179 nmdc:mga06r32_435872_c1 3300050510 Bacteria 1291
180 nmdc:mga08y16_1889_c1 3300050511 Bacteria 9726
181 nmdc:mga08y16_444624_c1 3300050511 Unclassified 1323
182 nmdc:mga08y16_688755_c1 3300050511 Bacteria 1023
183 nmdc:mga08y16_86350_c1 3300050511 Bacteria 3270
184 nmdc:mga0n895_109852_c1 3300050512 Bacteria 2773
185 nmdc:mga0n895_5727_c1 3300050512 Bacteria 10428
186 nmdc:mga0n895_638_c1 3300050512 Bacteria 24372
187 nmdc:mga0n895_831432_c1 3300050512 Unclassified 912
188 nmdc:mga0rr50_14221_c1 3300050513 Bacteria 5212
189 nmdc:mga0rr50_172220_c1 3300050513 Bacteria 1765
190 nmdc:mga0rr50_32376_c1 3300050513 Bacteria 3724
191 nmdc:mga0rr50_596_c1 3300050513 Bacteria 19360
192 nmdc:mga08x19_228490_c1 3300050514 Unclassified 1280
193 nmdc:mga08x19_720_c1 3300050514 Bacteria 21167
194 nmdc:mga08x19_74985_c1 3300050514 Bacteria 2211
195 nmdc:mga0a205_128363_c1 3300050515 Bacteria 2435
196 nmdc:mga0a205_192009_c2 3300050515 Unclassified 1512
197 nmdc:mga0a205_20073_c1 3300050515 Bacteria 6305
198 nmdc:mga0a205_793_c1 3300050515 Bacteria 25630
199 Ga0501084_0428439 3300054114 Unclassified 1118
200 Ga0501082_0040975 3300060353 Bacteria 3993
201 Ga0501082_0096731 3300060353 Unclassified 2552
202 Ga0530510_0070906 3300061734 Bacteria 2529
203 Ga0530510_0078509 3300061734 Bacteria 2400
204 Ga0530510_0104371 3300061734 Bacteria 2074
205 Ga0530510_0525373 3300061734 Unclassified 898
206 2509145229 2508501127 Bacteria 7037543
207 2874127314 2874123672 Bacteria 7238285
208 Ga0075428_100011704
209 MRS1b_contig_5274169
210 MBSR1b_contig_3562783
211 MBSR1b_contig_6294703
212 JGI25406J46586_10008196
213 Ga0058859_11266254
214 Ga0058860_10585609
215 Ga0065715_10001660
216 Ga0065715_10104775
217 Ga0065707_10096695
218 Ga0070690_100082812
219 Ga0068869_100182266
220 Ga0068868_100567518
221 Ga0070660_100065231
222 Ga0070660_101102580
223 Ga0070689_100091218
224 Ga0070687_100164982
225 Ga0070675_100495501
226 Ga0070659_100014621
227 Ga0070708_100057111
228 Ga0070708_100355409
229 Ga0070678_100330768
230 Ga0070662_100004030
231 Ga0070706_100027881
232 Ga0070707_100283554
233 Ga0070698_101211199
234 Ga0070699_100211693
235 Ga0070699_100444221
236 Ga0070684_100518852
237 Ga0070697_100396128
238 Ga0070672_100265166
239 Ga0070695_100541605
240 Ga0070696_100006217
241 Ga0070704_100821202
242 Ga0068855_100179789
243 Ga0070664_100031881
244 Ga0068856_100112712
245 Ga0068859_100305325
246 Ga0068859_100519071
247 Ga0068861_100545503
248 Ga0068863_100053259
249 Ga0068863_100608071
250 Ga0068858_100933386
251 Ga0081455_10073657
252 Ga0081538_10028243
253 Ga0081538_10051736
254 Ga0081539_10000083
255 Ga0081539_10044357
256 Ga0075432_10129968
257 Ga0070715_10031871
258 Ga0075428_100023315
259 Ga0075428_100049762
260 Ga0075428_100193986
261 Ga0075428_100212884
262 Ga0075428_100597728
263 Ga0075428_100703321
264 Ga0075430_100084361
265 Ga0075431_100014824
266 Ga0075431_100150712
267 Ga0075431_100221762
268 Ga0075431_100430801
269 Ga0075433_10023599
270 Ga0075433_10033743
271 Ga0075433_10250939
272 Ga0075433_10458416
273 Ga0075434_100004031
274 Ga0075434_100023901
275 Ga0075434_100032605
276 Ga0075429_100024440
277 Ga0075429_100158566
278 Ga0075429_100170109
279 Ga0075436_100000170
280 Ga0075436_100040534
281 Ga0075436_100135113
282 Ga0075436_100262290
283 Ga0097620_100305312
284 Ga0097620_100519088
285 Ga0075435_100000256
286 Ga0075435_100013883
287 Ga0075435_100034930
288 Ga0075435_100113686
289 Ga0111539_10079064
290 Ga0111539_10084638
291 Ga0111539_10182663
292 Ga0111539_10186553
293 Ga0111539_10231011
294 Ga0111539_10787143
295 Ga0114129_10058230
296 Ga0114129_10059023
297 Ga0114129_10089180
298 Ga0114129_10114085
299 Ga0114129_10114343
300 Ga0114129_10271794
301 Ga0114129_10327738
302 Ga0114129_10397088
303 Ga0114129_10461487
304 Ga0114129_10481009
305 Ga0114129_10485606
306 Ga0114129_11041829
307 Ga0105242_10077036
308 Ga0105248_11469966
309 Ga0105249_10056640
310 Ga0105249_10171069
311 Ga0105239_10400960
312 Ga0163162_10142772
313 Ga0163162_11786099
314 Ga0157375_11146999
315 Ga0163163_11664950
316 Ga0157379_10289634
317 Ga0157376_10563288
318 Ga0207685_10024513
319 Ga0207684_10074361
320 Ga0207657_10058563
321 Ga0207646_10067396
322 Ga0207681_10103818
323 Ga0207659_10272942
324 Ga0207690_10008584
325 Ga0207706_10011303
326 Ga0207706_10024310
327 Ga0207709_10083311
328 Ga0207665_10160561
329 Ga0207691_10580874
330 Ga0207679_10089542
331 Ga0207667_10085788
332 Ga0207641_10496182
333 Ga0207648_10553126
334 Ga0207428_10034618
335 Ga0268264_11431747
336 Ga0307408_100631603
337 Ga0307406_10076523
338 Ga0373930_0072875
339 Ga0373939_0037538
340 Ga0373939_0106499
341 Ga0373931_0003422
342 Ga0373931_0018823
343 Ga0373931_0097368
344 Ga0395899_0027056
345 Ga0395901_0000703
346 Ga0439435_0099846
347 Ga0451576_0006484
348 Ga0451576_0080309
349 Ga0451576_0092677
350 Ga0451576_0231373
351 Ga0496104_0261037
352 Ga0496106_0311985
353 Ga0496108_0512182
354 Ga0496112_0005004
355 Ga0496113_0098559
356 Ga0501040_0261816
357 Ga0501042_0614484
358 Ga0501042_0697911
359 Ga0501072_0050146
360 Ga0501072_0509843
361 Ga0501075_0055730
362 Ga0501076_0033798
363 Ga0501076_0145382
364 Ga0501076_0278212
365 Ga0501076_0626216
366 Ga0501077_0502874
367 Ga0501079_0090466
368 Ga0501079_0657874
369 Ga0501080_1057154
370 Ga0501081_0097264
371 Ga0501035_0633105
372 nmdc:mga05p37_105820_c1
373 nmdc:mga05p37_107231_c1
374 nmdc:mga05p37_139731_c1
375 nmdc:mga05p37_213237_c1
376 nmdc:mga05p37_266929_c1
377 nmdc:mga05p37_372980_c1
378 nmdc:mga05p37_58250_c1
379 nmdc:mga05p37_98890_c1
380 nmdc:mga09592_152846_c1
381 nmdc:mga09592_3796_c1
382 nmdc:mga09592_500117_c1
383 nmdc:mga0qj67_81816_c1
384 nmdc:mga06r32_19209_c1
385 nmdc:mga06r32_22120_c1
386 nmdc:mga06r32_435872_c1
387 nmdc:mga08y16_1889_c1
388 nmdc:mga08y16_444624_c1
389 nmdc:mga08y16_688755_c1
390 nmdc:mga08y16_86350_c1
391 nmdc:mga0n895_109852_c1
392 nmdc:mga0n895_5727_c1
393 nmdc:mga0n895_638_c1
394 nmdc:mga0n895_831432_c1
395 nmdc:mga0rr50_14221_c1
396 nmdc:mga0rr50_172220_c1
397 nmdc:mga0rr50_32376_c1
398 nmdc:mga0rr50_596_c1
399 nmdc:mga08x19_228490_c1
400 nmdc:mga08x19_720_c1
401 nmdc:mga08x19_74985_c1
402 nmdc:mga0a205_128363_c1
403 nmdc:mga0a205_192009_c2
404 nmdc:mga0a205_20073_c1
405 nmdc:mga0a205_793_c1
406 Ga0501084_0428439
407 Ga0501082_0040975
408 Ga0501082_0096731
409 Ga0530510_0070906
410 Ga0530510_0078509
411 Ga0530510_0104371
412 Ga0530510_0525373
413 2509145229
414 2874127314

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02630

SCO1-SenC

SCO1/SenC

62

195

0.95

PF00578

AhpC-TSA

AhpC/TSA family

60

202

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hde-assembly1.cif.gz_A the crystal structure of a sco1/senc family lipoprotein from bacillus anthracis str. ames 0.9053 35 191
3me8-assembly1.cif.gz_A crystal structure of putative electron transfer protein aq_2194 from aquifex aeolicus vf5 0.8821 35 191
1st9-assembly2.cif.gz_B crystal structure of a soluble domain of resa in the oxidised form 0.8786 36 191
4wbr-assembly1.cif.gz_D structure of bradyrhizobium japonicum scoi with copper bound 0.8774 36 191
6n5u-assembly2.cif.gz_B crystal structure of arabidopsis thaliana scoi with copper bound 0.8702 37 198
ID Description Score Start End Superfamily
af_Q54TT7_154_312_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9104 38 194 3.40.30.10
af_Q54TT7_154_312_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8941 38 194 3.40.30.10
af_Q8IC00_108_304_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8932 32 198 3.40.30.10
af_Q4CYL4_166_345_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.885 35 196 3.40.30.10
af_Q17557_120_303_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.876 33 198 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A7V4PQQ0-F1-model_v4 Uncharacterized protein 0.9738 96 197 GO:0046872
AF-A0A1F9CXI4-F1-model_v4 Thioredoxin domain-containing protein 0.9619 31 192 GO:0046872
AF-A0A7I8DH84-F1-model_v4 Thioredoxin domain-containing protein 0.9569 31 192 GO:0016020
GO:0046872
AF-A0A2V5K5J2-F1-model_v4 SCO family protein 0.9531 29 193 GO:0016020
GO:0046872
AF-A0A2R6Y4F1-F1-model_v4 Cytochrome oxidase biogenesis protein Sco1/SenC/PrrC, putative copper metallochaperone 0.9493 28 192 GO:0046872

Map