F316233

General Info

Members Datasets Scaffolds Average Seq Length
207 153 414 256

Family's Representative Sequence

Representative Sequence 3300005617|Ga0068859_100156688|Ga0068859_1001566882
Length 283
Sequence MPIRIAAALHNAGLIPLGQKTDVTTITDMGLLDGKNIVITGVLTDASLAFGVAKLAQEEGASIXXXXAGRALSLTERVARKLPDPVDVYELDVTVPEHLDNVRAALETKWGRVDGVLHSIGFAPEACLGDDFMAPQWSDVSIALHISAYSFKALADAFAPLMTNGGSFVGLDFDNSVAWPAYNWMGVSKSALESISRYLAVALGGRGIRSNLIAAGPVKTMAAKSIPGFKKFEDVWDDRAPLGWDVTDSSAVAKACIVLLSDWFPATTGEIIHVDGGYHATGA

Samples

Sample ID Description Type Environment
1 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
46 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
47 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
69 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
71 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
72 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
73 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
74 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
75 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
76 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
77 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
78 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
79 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
80 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
81 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
82 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
83 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
84 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
85 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
86 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
87 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
88 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
89 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
90 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
91 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
92 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
93 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
94 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
95 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
96 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
97 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
98 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
99 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
100 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
101 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
102 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
103 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
104 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
105 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
106 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
107 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
108 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
109 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
110 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
111 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
112 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
113 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
114 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
115 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
116 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
117 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
118 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
119 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
130 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
131 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
132 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
133 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
134 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
135 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
136 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
137 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
139 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
140 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
141 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
142 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
143 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
144 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
145 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
146 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
147 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
148 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
149 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
150 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
151 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
152 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
153 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.03
Metatranscriptomes 0.48
Isolates 0.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.43
Nodule 0
Rhizoplane 3.86
Rhizosphere 76.33
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068859_100156688 3300005617 Bacteria 2355
2 JGI25406J46586_10015482 3300003203 Bacteria 3215
3 Ga0070658_10001032 3300005327 Bacteria 23831
4 Ga0070683_100309923 3300005329 Bacteria 1502
5 Ga0070690_100037659 3300005330 Bacteria 3049
6 Ga0070670_100356729 3300005331 Bacteria 1285
7 Ga0070680_100002942 3300005336 Bacteria 12662
8 Ga0070671_100003149 3300005355 Bacteria 12861
9 Ga0070671_100630975 3300005355 Bacteria 927
10 Ga0070674_100045080 3300005356 Bacteria 3012
11 Ga0070688_100246258 3300005365 Bacteria 1271
12 Ga0070701_10233492 3300005438 Bacteria 1103
13 Ga0070705_100072938 3300005440 Bacteria 2081
14 Ga0070662_100093006 3300005457 Bacteria 2268
15 Ga0070681_10000025 3300005458 Bacteria 110322
16 Ga0070681_10017781 3300005458 Bacteria 7104
17 Ga0070681_10250243 3300005458 Bacteria 1685
18 Ga0070685_10286362 3300005466 Bacteria 1105
19 Ga0070706_100338454 3300005467 Bacteria 1403
20 Ga0070679_100002372 3300005530 Bacteria 17068
21 Ga0070679_100043468 3300005530 Bacteria 4476
22 Ga0070684_100131461 3300005535 Bacteria 2258
23 Ga0070697_100527602 3300005536 Bacteria 1034
24 Ga0068853_100168076 3300005539 Bacteria 1983
25 Ga0070672_100139773 3300005543 Bacteria 1997
26 Ga0070686_100365213 3300005544 Bacteria 1088
27 Ga0070695_100077051 3300005545 Bacteria 2196
28 Ga0068864_100439527 3300005618 Bacteria 1246
29 Ga0068866_10042576 3300005718 Bacteria 2261
30 Ga0068858_100028725 3300005842 Bacteria 5165
31 Ga0068860_100247465 3300005843 Bacteria 1735
32 Ga0081539_10000352 3300005985 Bacteria 100942
33 Ga0081539_10033073 3300005985 Bacteria 3155
34 Ga0075365_10003861 3300006038 Bacteria 7831
35 Ga0075365_10004886 3300006038 Bacteria 7160
36 Ga0075365_10009827 3300006038 Bacteria 5532
37 Ga0075365_10012486 3300006038 Bacteria 5048
38 Ga0075365_10163254 3300006038 Bacteria 1553
39 Ga0075363_100017747 3300006048 Bacteria 3534
40 Ga0075363_100077283 3300006048 Bacteria 1816
41 Ga0075363_100145669 3300006048 Bacteria 1335
42 Ga0075364_10004311 3300006051 Bacteria 8159
43 Ga0075364_10011314 3300006051 Bacteria 5420
44 Ga0075364_10027534 3300006051 Bacteria 3632
45 Ga0075362_10040759 3300006177 Bacteria 2046
46 Ga0097621_100167412 3300006237 Bacteria 1893
47 Ga0075370_10022808 3300006353 Bacteria 3441
48 Ga0097620_100156677 3300006931 Bacteria 2355
49 Ga0105245_10352402 3300009098 Bacteria 1459
50 Ga0105243_10138068 3300009148 Bacteria 2077
51 Ga0105243_10308188 3300009148 Bacteria 1438
52 Ga0105243_10674033 3300009148 Bacteria 1005
53 Ga0105242_10043089 3300009176 Bacteria 3649
54 Ga0105248_10560116 3300009177 Bacteria 1289
55 Ga0157369_10137182 3300013105 Bacteria 2589
56 Ga0157378_10119762 3300013297 Bacteria 2425
57 Ga0163162_10604122 3300013306 Bacteria 1223
58 Ga0157375_10118413 3300013308 Bacteria 2755
59 Ga0163163_10178858 3300014325 Bacteria 2168
60 Ga0157380_10317513 3300014326 Bacteria 1443
61 Ga0163161_10036886 3300017792 Bacteria 3502
62 Ga0224712_10154495 3300022467 Bacteria 1019
63 Ga0207688_10176467 3300025901 Bacteria 1273
64 Ga0207705_10000514 3300025909 Bacteria 33010
65 Ga0207684_10202915 3300025910 Bacteria 1710
66 Ga0207707_10000023 3300025912 Bacteria 183706
67 Ga0207707_10001958 3300025912 Bacteria 18719
68 Ga0207707_10217663 3300025912 Bacteria 1663
69 Ga0207707_10334601 3300025912 Bacteria 1306
70 Ga0207660_10000406 3300025917 Bacteria 28378
71 Ga0207660_10069223 3300025917 Bacteria 2562
72 Ga0207657_10100452 3300025919 Bacteria 2402
73 Ga0207652_10000039 3300025921 Bacteria 131660
74 Ga0207659_10625816 3300025926 Bacteria 919
75 Ga0207644_10001346 3300025931 Bacteria 15801
76 Ga0207686_10041108 3300025934 Bacteria 2817
77 Ga0207709_10039184 3300025935 Bacteria 2829
78 Ga0207709_10062315 3300025935 Bacteria 2334
79 Ga0207709_10315349 3300025935 Bacteria 1168
80 Ga0207670_10033658 3300025936 Bacteria 3304
81 Ga0207691_10162867 3300025940 Bacteria 1956
82 Ga0207691_10192856 3300025940 Bacteria 1776
83 Ga0207668_10416679 3300025972 Bacteria 1139
84 Ga0207703_10020294 3300026035 Bacteria 5196
85 Ga0207639_10184112 3300026041 Bacteria 1779
86 Ga0207708_10389672 3300026075 Bacteria 1150
87 Ga0207675_100151840 3300026118 Bacteria 2205
88 Ga0207675_100488988 3300026118 Bacteria 1224
89 Ga0207683_10135075 3300026121 Bacteria 2220
90 Ga0207698_10414722 3300026142 Bacteria 1291
91 Ga0209813_10016720 3300027866 Bacteria 2005
92 Ga0268266_10485053 3300028379 Bacteria 1179
93 Ga0307515_10101050 3300028794 Bacteria 3485
94 Ga0265327_10042369 3300031251 Bacteria 2444
95 Ga0307513_10047138 3300031456 Bacteria 4690
96 Ga0316579_10232480 3300031691 Bacteria 892
97 Ga0316576_10007970 3300031727 Bacteria 6710
98 Ga0316576_10015553 3300031727 Bacteria 5111
99 Ga0316578_10009505 3300031728 Bacteria 5002
100 Ga0307413_10149032 3300031824 Bacteria 1628
101 Ga0307410_10170177 3300031852 Bacteria 1641
102 Ga0307406_10280497 3300031901 Bacteria 1271
103 Ga0307407_10527343 3300031903 Bacteria 870
104 Ga0307416_100473930 3300032002 Bacteria 1310
105 Ga0307414_10327533 3300032004 Bacteria 1306
106 Ga0307411_10191601 3300032005 Bacteria 1562
107 Ga0307415_100322087 3300032126 Bacteria 1289
108 Ga0307507_10030571 3300033179 Bacteria 5676
109 Ga0373930_0000732 3300034816 Bacteria 4641
110 Ga0373928_0000711 3300035084 Bacteria 6532
111 Ga0373932_0000047 3300035112 Bacteria 29179
112 Ga0316574_0008607 3300035398 Bacteria 5674
113 Ga0316574_0030003 3300035398 Bacteria 3289
114 Ga0316574_0039820 3300035398 Bacteria 2892
115 Ga0373931_0000001 3300035691 Bacteria 634029
116 Ga0373931_0000104 3300035691 Bacteria 38471
117 Ga0316584_0022146 3300036712 Bacteria 4632
118 Ga0316584_0105266 3300036712 Bacteria 2111
119 Ga0316584_0282795 3300036712 Bacteria 1205
120 Ga0436365_0384188 3300039437 Bacteria 4488
121 Ga0436362_0191495 3300039453 Bacteria 1199
122 Ga0439452_024911 3300042010 Bacteria 1524
123 Ga0439434_0028876 3300042435 Bacteria 1681
124 Ga0451577_0002895 3300042876 Bacteria 19688
125 Ga0451577_0372358 3300042876 Bacteria 1296
126 Ga0453684_0022419 3300044712 Bacteria 9367
127 Ga0466959_0160148 3300045049 Bacteria 1583
128 Ga0466967_0536693 3300045976 Bacteria 1150
129 Ga0495641_0163029 3300046461 Bacteria 997
130 Ga0495651_0100510 3300046462 Bacteria 2154
131 Ga0495628_0062300 3300046516 Bacteria 2924
132 Ga0495630_0127343 3300046517 Bacteria 1933
133 Ga0495630_0248738 3300046517 Bacteria 1358
134 Ga0495652_0277525 3300046529 Bacteria 1229
135 Ga0495667_0044801 3300046559 Bacteria 2929
136 Ga0495657_0023979 3300046675 Bacteria 4352
137 Ga0495623_0029681 3300046679 Bacteria 3519
138 Ga0495600_0009483 3300046809 Bacteria 6017
139 Ga0495581_0093372 3300047315 Bacteria 1747
140 Ga0495672_0001867 3300047320 Bacteria 20060
141 Ga0495676_0232121 3300047321 Bacteria 1267
142 Ga0495680_0079375 3300047322 Bacteria 2482
143 Ga0496104_0098404 3300048907 Bacteria 2800
144 Ga0496104_0282815 3300048907 Bacteria 1572
145 Ga0496104_0397921 3300048907 Bacteria 1290
146 Ga0496105_0037522 3300048908 Bacteria 3990
147 Ga0496110_0015098 3300048913 Bacteria 6423
148 Ga0496114_0112587 3300048917 Bacteria 2333
149 Ga0496114_0118625 3300048917 Bacteria 2273
150 Ga0496114_0156083 3300048917 Bacteria 1982
151 Ga0496118_0078231 3300048921 Bacteria 2341
152 Ga0496122_0001610 3300048925 Bacteria 35298
153 Ga0496125_0000025 3300048928 Bacteria 440074
154 Ga0501033_0001120 3300049570 Bacteria 24292
155 Ga0501034_0037522 3300049571 Bacteria 4907
156 Ga0501036_0292999 3300049572 Bacteria 1361
157 Ga0501036_0496758 3300049572 Bacteria 1015
158 Ga0501037_0231871 3300049573 Bacteria 1296
159 Ga0501038_0396826 3300049574 Bacteria 1068
160 Ga0501039_0086315 3300049575 Bacteria 2444
161 Ga0501040_0163400 3300049576 Bacteria 1574
162 Ga0501042_0185266 3300049578 Bacteria 1502
163 Ga0501046_0012017 3300049580 Bacteria 7386
164 Ga0501048_0442842 3300049582 Bacteria 930
165 Ga0501069_0000055 3300049585 Bacteria 66919
166 Ga0501069_0159356 3300049585 Bacteria 1299
167 Ga0501070_0000059 3300049586 Bacteria 94646
168 Ga0501071_0001580 3300049587 Bacteria 13343
169 Ga0501071_0006743 3300049587 Bacteria 7474
170 Ga0501071_0237407 3300049587 Bacteria 1374
171 Ga0501071_0309647 3300049587 Bacteria 1198
172 Ga0501072_0014331 3300049588 Bacteria 6077
173 Ga0501074_0210469 3300049590 Bacteria 1385
174 Ga0501075_0049623 3300049591 Bacteria 3155
175 Ga0501075_0359373 3300049591 Bacteria 1110
176 Ga0501075_0382114 3300049591 Bacteria 1074
177 Ga0501076_0015905 3300049592 Bacteria 5693
178 Ga0501080_0000061 3300049742 Bacteria 70965
179 Ga0501044_0001904 3300049823 Bacteria 24146
180 Ga0501045_0262538 3300049824 Bacteria 1285
181 Ga0501045_0372868 3300049824 Bacteria 1062
182 nmdc:mga03683_127058_c1 3300050489 Bacteria 1138
183 nmdc:mga03683_19388_c1 3300050489 Bacteria 2596
184 nmdc:mga03n38_15422_c1 3300050490 Bacteria 2950
185 nmdc:mga03n38_212523_c1 3300050490 Bacteria 1006
186 nmdc:mga03n38_9996_c1 3300050490 Bacteria 3473
187 nmdc:mga00v17_12228_c1 3300050491 Bacteria 4735
188 nmdc:mga00v17_311999_c1 3300050491 Bacteria 1022
189 nmdc:mga00v17_37335_c1 3300050491 Bacteria 2900
190 nmdc:mga00v17_8470_c1 3300050491 Bacteria 5535
191 nmdc:mga0yw44_16805_c1 3300050492 Bacteria 3964
192 nmdc:mga0yw44_2150_c1 3300050492 Bacteria 8267
193 nmdc:mga0yw44_251214_c1 3300050492 Bacteria 1177
194 nmdc:mga0yw44_3873_c1 3300050492 Bacteria 6739
195 nmdc:mga0yw44_4836_c1 3300050492 Bacteria 6258
196 nmdc:mga0yw44_49344_c1 3300050492 Bacteria 2540
197 nmdc:mga06z11_62479_c1 3300050494 Bacteria 1946
198 nmdc:mga04h51_7196_c1 3300050495 Bacteria 2927
199 Ga0495595_0013171 3300053084 Bacteria 3489
200 Ga0495619_0008138 3300053085 Bacteria 6635
201 Ga0500566_0000334 3300053094 Bacteria 25678
202 Ga0500628_005121 3300053129 Bacteria 2182
203 Ga0500616_0011977 3300053153 Bacteria 5094
204 Ga0501084_0344000 3300054114 Bacteria 1260
205 Ga0501082_0073169 3300060353 Bacteria 2952
206 Ga0530510_0016794 3300061734 Bacteria 5183
207 2791914606 2791354901 Bacteria 8322202
208 Ga0068859_100156688
209 JGI25406J46586_10015482
210 Ga0070658_10001032
211 Ga0070683_100309923
212 Ga0070690_100037659
213 Ga0070670_100356729
214 Ga0070680_100002942
215 Ga0070671_100003149
216 Ga0070671_100630975
217 Ga0070674_100045080
218 Ga0070688_100246258
219 Ga0070701_10233492
220 Ga0070705_100072938
221 Ga0070662_100093006
222 Ga0070681_10000025
223 Ga0070681_10017781
224 Ga0070681_10250243
225 Ga0070685_10286362
226 Ga0070706_100338454
227 Ga0070679_100002372
228 Ga0070679_100043468
229 Ga0070684_100131461
230 Ga0070697_100527602
231 Ga0068853_100168076
232 Ga0070672_100139773
233 Ga0070686_100365213
234 Ga0070695_100077051
235 Ga0068864_100439527
236 Ga0068866_10042576
237 Ga0068858_100028725
238 Ga0068860_100247465
239 Ga0081539_10000352
240 Ga0081539_10033073
241 Ga0075365_10003861
242 Ga0075365_10004886
243 Ga0075365_10009827
244 Ga0075365_10012486
245 Ga0075365_10163254
246 Ga0075363_100017747
247 Ga0075363_100077283
248 Ga0075363_100145669
249 Ga0075364_10004311
250 Ga0075364_10011314
251 Ga0075364_10027534
252 Ga0075362_10040759
253 Ga0097621_100167412
254 Ga0075370_10022808
255 Ga0097620_100156677
256 Ga0105245_10352402
257 Ga0105243_10138068
258 Ga0105243_10308188
259 Ga0105243_10674033
260 Ga0105242_10043089
261 Ga0105248_10560116
262 Ga0157369_10137182
263 Ga0157378_10119762
264 Ga0163162_10604122
265 Ga0157375_10118413
266 Ga0163163_10178858
267 Ga0157380_10317513
268 Ga0163161_10036886
269 Ga0224712_10154495
270 Ga0207688_10176467
271 Ga0207705_10000514
272 Ga0207684_10202915
273 Ga0207707_10000023
274 Ga0207707_10001958
275 Ga0207707_10217663
276 Ga0207707_10334601
277 Ga0207660_10000406
278 Ga0207660_10069223
279 Ga0207657_10100452
280 Ga0207652_10000039
281 Ga0207659_10625816
282 Ga0207644_10001346
283 Ga0207686_10041108
284 Ga0207709_10039184
285 Ga0207709_10062315
286 Ga0207709_10315349
287 Ga0207670_10033658
288 Ga0207691_10162867
289 Ga0207691_10192856
290 Ga0207668_10416679
291 Ga0207703_10020294
292 Ga0207639_10184112
293 Ga0207708_10389672
294 Ga0207675_100151840
295 Ga0207675_100488988
296 Ga0207683_10135075
297 Ga0207698_10414722
298 Ga0209813_10016720
299 Ga0268266_10485053
300 Ga0307515_10101050
301 Ga0265327_10042369
302 Ga0307513_10047138
303 Ga0316579_10232480
304 Ga0316576_10007970
305 Ga0316576_10015553
306 Ga0316578_10009505
307 Ga0307413_10149032
308 Ga0307410_10170177
309 Ga0307406_10280497
310 Ga0307407_10527343
311 Ga0307416_100473930
312 Ga0307414_10327533
313 Ga0307411_10191601
314 Ga0307415_100322087
315 Ga0307507_10030571
316 Ga0373930_0000732
317 Ga0373928_0000711
318 Ga0373932_0000047
319 Ga0316574_0008607
320 Ga0316574_0030003
321 Ga0316574_0039820
322 Ga0373931_0000001
323 Ga0373931_0000104
324 Ga0316584_0022146
325 Ga0316584_0105266
326 Ga0316584_0282795
327 Ga0436365_0384188
328 Ga0436362_0191495
329 Ga0439452_024911
330 Ga0439434_0028876
331 Ga0451577_0002895
332 Ga0451577_0372358
333 Ga0453684_0022419
334 Ga0466959_0160148
335 Ga0466967_0536693
336 Ga0495641_0163029
337 Ga0495651_0100510
338 Ga0495628_0062300
339 Ga0495630_0127343
340 Ga0495630_0248738
341 Ga0495652_0277525
342 Ga0495667_0044801
343 Ga0495657_0023979
344 Ga0495623_0029681
345 Ga0495600_0009483
346 Ga0495581_0093372
347 Ga0495672_0001867
348 Ga0495676_0232121
349 Ga0495680_0079375
350 Ga0496104_0098404
351 Ga0496104_0282815
352 Ga0496104_0397921
353 Ga0496105_0037522
354 Ga0496110_0015098
355 Ga0496114_0112587
356 Ga0496114_0118625
357 Ga0496114_0156083
358 Ga0496118_0078231
359 Ga0496122_0001610
360 Ga0496125_0000025
361 Ga0501033_0001120
362 Ga0501034_0037522
363 Ga0501036_0292999
364 Ga0501036_0496758
365 Ga0501037_0231871
366 Ga0501038_0396826
367 Ga0501039_0086315
368 Ga0501040_0163400
369 Ga0501042_0185266
370 Ga0501046_0012017
371 Ga0501048_0442842
372 Ga0501069_0000055
373 Ga0501069_0159356
374 Ga0501070_0000059
375 Ga0501071_0001580
376 Ga0501071_0006743
377 Ga0501071_0237407
378 Ga0501071_0309647
379 Ga0501072_0014331
380 Ga0501074_0210469
381 Ga0501075_0049623
382 Ga0501075_0359373
383 Ga0501075_0382114
384 Ga0501076_0015905
385 Ga0501080_0000061
386 Ga0501044_0001904
387 Ga0501045_0262538
388 Ga0501045_0372868
389 nmdc:mga03683_127058_c1
390 nmdc:mga03683_19388_c1
391 nmdc:mga03n38_15422_c1
392 nmdc:mga03n38_212523_c1
393 nmdc:mga03n38_9996_c1
394 nmdc:mga00v17_12228_c1
395 nmdc:mga00v17_311999_c1
396 nmdc:mga00v17_37335_c1
397 nmdc:mga00v17_8470_c1
398 nmdc:mga0yw44_16805_c1
399 nmdc:mga0yw44_2150_c1
400 nmdc:mga0yw44_251214_c1
401 nmdc:mga0yw44_3873_c1
402 nmdc:mga0yw44_4836_c1
403 nmdc:mga0yw44_49344_c1
404 nmdc:mga06z11_62479_c1
405 nmdc:mga04h51_7196_c1
406 Ga0495595_0013171
407 Ga0495619_0008138
408 Ga0500566_0000334
409 Ga0500628_005121
410 Ga0500616_0011977
411 Ga0501084_0344000
412 Ga0501082_0073169
413 Ga0530510_0016794
414 2791914606

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

41

279

0.97

PF00106

adh_short

short chain dehydrogenase

35

230

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7k73-assembly1.cif.gz_G structure of enoyl-[acyl-carrier-protein] reductase [nadh] from mycobacterium fortuitum bound to nad 0.9594 1 255
7k73-assembly1.cif.gz_E structure of enoyl-[acyl-carrier-protein] reductase [nadh] from mycobacterium fortuitum bound to nad 0.9589 1 255
5coq-assembly1.cif.gz_A the effect of valine to alanine mutation on inha enzyme crystallization pattern and substrate binding loop conformation and flexibility 0.9589 1 255
4bqr-assembly1.cif.gz_C mtb inha complex with methyl-thiazole compound 11 0.9582 1 255
4qxm-assembly1.cif.gz_G crystal structure of the inha:gsk_sb713 complex 0.9581 1 255
ID Description Score Start End Superfamily
af_P9WGR1_1_269_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.96 2 255 3.40.50.720
af_P9WGR1_1_269_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9454 2 255 3.40.50.720
4cv1H00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9374 4 257 3.40.50.720
4alnK00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9284 4 255 3.40.50.720
2p91C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.925 4 257 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2G6JX08-F1-model_v4 Enoyl-[acyl-carrier-protein] reductase [NADH] (EC 1.3.1.9) 0.9822 1 257 GO:0004318
GO:0006633
AF-A0A7K1ETT1-F1-model_v4 SDR family oxidoreductase 0.9797 1 187 GO:0004318
GO:0006633
AF-A0A259SXD2-F1-model_v4 Enoyl-[acyl-carrier-protein] reductase 0.9792 1 198 GO:0004318
GO:0006633
AF-A0A3N4Z729-F1-model_v4 Enoyl-[acyl-carrier-protein] reductase [NADH] (EC 1.3.1.9) 0.9773 1 257 GO:0004318
GO:0006633
AF-A0A356WEV1-F1-model_v4 Enoyl-[acyl-carrier-protein] reductase [NADH] (EC 1.3.1.9) 0.9746 2 257 GO:0004318
GO:0006633

Map