F315787
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 206 | 143 | 188 | 295 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2527291627|2528206601 |
| Length | 356 |
| Sequence | PRLRIPGSASPAPHPRPLGDLPHPPVSSLTMTDAAAPRTPSRGSLGAVAPQPLRVEPAEVDRNRLAVIVNPSAGHGRAMRMLDGVRVELARWARDVRVTPTRDLAHADDLAAAATAQGRVVVALGGDGLAGSVAGGVARCGGVLAVLPGGRGNDFVRGLGLPRDPCRVAAGLAHARERRVDLPEVGGRPFLGIASVGYDSDVQVIANRTRFLRGQQVYTYAALRALAAWRPARFTVTVDDLAPRDLVGWTVAAANSAYYGGGMRFAPGADIADGLLDVLLISRTSRLTFLALFPRVFSGRHVDTRHVRVLRARRVRIEADRPFAVYADGDPLASLPAEIVVRPGALRLLVPVIPAS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2506783011 | Frankia datiscae Dg1 | Isolate | Nodule |
| 2 | 2527291627 | Frankia casuarinae Thr | Isolate | Nodule |
| 3 | 2527291629 | Frankia sp. BMG5.23 | Isolate | Nodule |
| 4 | 2546825537 | Frankia sp. CcI6 | Isolate | Rhizoplane |
| 5 | 2576861822 | Frankia sp. CeD | Isolate | Nodule |
| 6 | 2579778521 | Frankia torreyi CpI1-S | Isolate | Unclassified |
| 7 | 2619618881 | Frankia sp. ACN1ag | Isolate | Unclassified |
| 8 | 2619619003 | Frankia sp. CpI1-P | Isolate | Nodule |
| 9 | 2626541554 | Frankia sp. AvcI.1 | Isolate | Nodule |
| 10 | 2684623036 | Frankia sp. CgIM4 | Isolate | Nodule |
| 11 | 2687453743 | Frankia colletiae Cc1.17 | Isolate | Nodule |
| 12 | 2710264753 | Frankia sp. KB5 | Isolate | Nodule |
| 13 | 2773857924 | Frankia sp. CgIS1 | Isolate | Nodule |
| 14 | 2773857933 | Frankia sp. BMG5.30 | Isolate | Nodule |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 29 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 35 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 36 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 37 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 38 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 39 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 40 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 41 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 42 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 43 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 44 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 46 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 48 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 93 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 94 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 95 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 96 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 97 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 98 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 99 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 100 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 101 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 102 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 103 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 104 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 105 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 106 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 107 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 111 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 112 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 113 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 114 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 115 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 116 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 117 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 118 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 119 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 120 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 121 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 122 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 123 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 124 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 125 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 126 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 127 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 128 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 129 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 130 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 131 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 132 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 133 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 134 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 135 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 136 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 137 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 138 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 139 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 140 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 141 | 637000116 | Frankia casuarinae CcI3 | Isolate | Nodule |
| 142 | 8054913762 | Frankia gtarii Agncl-10 | Isolate | Nodule |
| 143 | 8055157932 | Frankia umida Ag45/Mut15 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.26 |
| Metatranscriptomes | 0 |
| Isolates | 8.74 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.94 |
| Nodule | 7.28 |
| Rhizoplane | 16.5 |
| Rhizosphere | 71.84 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.43 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070683_100103613 | 3300005329 | Bacteria | 2681 |
| 2 | Ga0070683_100267633 | 3300005329 | Bacteria | 1625 |
| 3 | Ga0070690_100132614 | 3300005330 | Bacteria | 1684 |
| 4 | Ga0068869_100393290 | 3300005334 | Bacteria | 1138 |
| 5 | Ga0070666_10088220 | 3300005335 | Bacteria | 2128 |
| 6 | Ga0068868_100116849 | 3300005338 | Bacteria | 2172 |
| 7 | Ga0070660_100291454 | 3300005339 | Bacteria | 1337 |
| 8 | Ga0070668_100055489 | 3300005347 | Bacteria | 3058 |
| 9 | Ga0070668_100180473 | 3300005347 | Bacteria | 1724 |
| 10 | Ga0070668_100319039 | 3300005347 | Bacteria | 1308 |
| 11 | Ga0070675_100516215 | 3300005354 | Bacteria | 1078 |
| 12 | Ga0070659_100095749 | 3300005366 | Bacteria | 2384 |
| 13 | Ga0070700_100105832 | 3300005441 | Bacteria | 1861 |
| 14 | Ga0070700_100283620 | 3300005441 | Bacteria | 1202 |
| 15 | Ga0070700_100335489 | 3300005441 | Bacteria | 1116 |
| 16 | Ga0070663_100145019 | 3300005455 | Bacteria | 1816 |
| 17 | Ga0070662_100249113 | 3300005457 | Bacteria | 1427 |
| 18 | Ga0070662_100305143 | 3300005457 | Bacteria | 1294 |
| 19 | Ga0070681_10556787 | 3300005458 | Bacteria | 1060 |
| 20 | Ga0068867_100059172 | 3300005459 | Bacteria | 2840 |
| 21 | Ga0070685_10057466 | 3300005466 | Bacteria | 2265 |
| 22 | Ga0070679_100058802 | 3300005530 | Bacteria | 3831 |
| 23 | Ga0070672_100424164 | 3300005543 | Bacteria | 1143 |
| 24 | Ga0070686_100266363 | 3300005544 | Unclassified | 1258 |
| 25 | Ga0070695_100123283 | 3300005545 | Bacteria | 1776 |
| 26 | Ga0068857_100184134 | 3300005577 | Bacteria | 1901 |
| 27 | Ga0068857_100573532 | 3300005577 | Bacteria | 1064 |
| 28 | Ga0068852_100079862 | 3300005616 | Bacteria | 2898 |
| 29 | Ga0068859_100021588 | 3300005617 | Bacteria | 6462 |
| 30 | Ga0068864_100112104 | 3300005618 | Bacteria | 2431 |
| 31 | Ga0068866_10171903 | 3300005718 | Bacteria | 1273 |
| 32 | Ga0068861_100016744 | 3300005719 | Bacteria | 5193 |
| 33 | Ga0068861_100130085 | 3300005719 | Bacteria | 2042 |
| 34 | Ga0068851_10105506 | 3300005834 | Bacteria | 1500 |
| 35 | Ga0068851_10164402 | 3300005834 | Bacteria | 1221 |
| 36 | Ga0068870_10012340 | 3300005840 | Bacteria | 3990 |
| 37 | Ga0075365_10104812 | 3300006038 | Bacteria | 1939 |
| 38 | Ga0075363_100259100 | 3300006048 | Bacteria | 1003 |
| 39 | Ga0070712_100191668 | 3300006175 | Bacteria | 1600 |
| 40 | Ga0068865_100074354 | 3300006881 | Bacteria | 2419 |
| 41 | Ga0097620_100021589 | 3300006931 | Bacteria | 6462 |
| 42 | Ga0075435_100016829 | 3300007076 | Bacteria | 5520 |
| 43 | Ga0111539_10040083 | 3300009094 | Bacteria | 5641 |
| 44 | Ga0111539_10099899 | 3300009094 | Bacteria | 3407 |
| 45 | Ga0111539_10117630 | 3300009094 | Bacteria | 3115 |
| 46 | Ga0111539_10710301 | 3300009094 | Unclassified | 1170 |
| 47 | Ga0105245_10087843 | 3300009098 | Bacteria | 2854 |
| 48 | Ga0105245_10309309 | 3300009098 | Bacteria | 1553 |
| 49 | Ga0105245_10351967 | 3300009098 | Bacteria | 1460 |
| 50 | Ga0105245_10434696 | 3300009098 | Bacteria | 1318 |
| 51 | Ga0105247_10000057 | 3300009101 | Bacteria | 133165 |
| 52 | Ga0105247_10252195 | 3300009101 | Bacteria | 1207 |
| 53 | Ga0114129_10109559 | 3300009147 | Bacteria | 3812 |
| 54 | Ga0114129_10155550 | 3300009147 | Bacteria | 3127 |
| 55 | Ga0105243_10069240 | 3300009148 | Bacteria | 2846 |
| 56 | Ga0105243_10224412 | 3300009148 | Bacteria | 1663 |
| 57 | Ga0105242_10079948 | 3300009176 | Bacteria | 2731 |
| 58 | Ga0105248_10007560 | 3300009177 | Bacteria | 11933 |
| 59 | Ga0105249_10098356 | 3300009553 | Bacteria | 2748 |
| 60 | Ga0105249_10385461 | 3300009553 | Bacteria | 1428 |
| 61 | Ga0105239_10305804 | 3300010375 | Bacteria | 1791 |
| 62 | Ga0157374_10478065 | 3300013296 | Bacteria | 1249 |
| 63 | Ga0163162_10244450 | 3300013306 | Bacteria | 1926 |
| 64 | Ga0163162_10595811 | 3300013306 | Bacteria | 1232 |
| 65 | Ga0163162_10831750 | 3300013306 | Bacteria | 1039 |
| 66 | Ga0157372_10237073 | 3300013307 | Bacteria | 2116 |
| 67 | Ga0163163_10339866 | 3300014325 | Bacteria | 1556 |
| 68 | Ga0157377_10046959 | 3300014745 | Bacteria | 2417 |
| 69 | Ga0157379_10084007 | 3300014968 | Bacteria | 2854 |
| 70 | Ga0157379_10781579 | 3300014968 | Bacteria | 900 |
| 71 | Ga0207642_10031959 | 3300025899 | Bacteria | 2211 |
| 72 | Ga0207642_10125549 | 3300025899 | Bacteria | 1331 |
| 73 | Ga0207710_10000011 | 3300025900 | Bacteria | 428560 |
| 74 | Ga0207710_10093039 | 3300025900 | Bacteria | 1414 |
| 75 | Ga0207688_10019358 | 3300025901 | Bacteria | 3707 |
| 76 | Ga0207688_10041338 | 3300025901 | Bacteria | 2564 |
| 77 | Ga0207688_10161775 | 3300025901 | Bacteria | 1327 |
| 78 | Ga0207707_10103391 | 3300025912 | Bacteria | 2490 |
| 79 | Ga0207707_10492923 | 3300025912 | Bacteria | 1046 |
| 80 | Ga0207693_10338333 | 3300025915 | Bacteria | 1178 |
| 81 | Ga0207660_10362106 | 3300025917 | Bacteria | 1164 |
| 82 | Ga0207662_10021297 | 3300025918 | Bacteria | 3705 |
| 83 | Ga0207652_10069180 | 3300025921 | Bacteria | 3065 |
| 84 | Ga0207652_10080826 | 3300025921 | Bacteria | 2842 |
| 85 | Ga0207687_10187851 | 3300025927 | Bacteria | 1606 |
| 86 | Ga0207709_10117586 | 3300025935 | Bacteria | 1789 |
| 87 | Ga0207704_10068373 | 3300025938 | Bacteria | 2239 |
| 88 | Ga0207691_10079536 | 3300025940 | Bacteria | 2950 |
| 89 | Ga0207691_10107399 | 3300025940 | Bacteria | 2485 |
| 90 | Ga0207711_10012226 | 3300025941 | Bacteria | 7139 |
| 91 | Ga0207689_10075954 | 3300025942 | Bacteria | 2762 |
| 92 | Ga0207689_10235680 | 3300025942 | Bacteria | 1513 |
| 93 | Ga0207651_10618372 | 3300025960 | Bacteria | 949 |
| 94 | Ga0207668_10048332 | 3300025972 | Bacteria | 2919 |
| 95 | Ga0207668_10275963 | 3300025972 | Bacteria | 1376 |
| 96 | Ga0207640_10084451 | 3300025981 | Bacteria | 2180 |
| 97 | Ga0207640_10150856 | 3300025981 | Bacteria | 1707 |
| 98 | Ga0207677_10343378 | 3300026023 | Bacteria | 1248 |
| 99 | Ga0207703_10379412 | 3300026035 | Bacteria | 1307 |
| 100 | Ga0207678_10070745 | 3300026067 | Bacteria | 2991 |
| 101 | Ga0207678_10252233 | 3300026067 | Bacteria | 1511 |
| 102 | Ga0207708_10003667 | 3300026075 | Bacteria | 11340 |
| 103 | Ga0207708_10134072 | 3300026075 | Bacteria | 1938 |
| 104 | Ga0207708_10306767 | 3300026075 | Bacteria | 1292 |
| 105 | Ga0207702_10073403 | 3300026078 | Bacteria | 2950 |
| 106 | Ga0207702_10202652 | 3300026078 | Bacteria | 1840 |
| 107 | Ga0207648_10110605 | 3300026089 | Bacteria | 2412 |
| 108 | Ga0207676_10196318 | 3300026095 | Bacteria | 1780 |
| 109 | Ga0207676_10260500 | 3300026095 | Bacteria | 1566 |
| 110 | Ga0207674_10349489 | 3300026116 | Bacteria | 1429 |
| 111 | Ga0207675_100018720 | 3300026118 | Bacteria | 6464 |
| 112 | Ga0207683_10040875 | 3300026121 | Bacteria | 4048 |
| 113 | Ga0207698_10065420 | 3300026142 | Bacteria | 2855 |
| 114 | Ga0268265_10560970 | 3300028380 | Unclassified | 1086 |
| 115 | Ga0307408_100341030 | 3300031548 | Bacteria | 1268 |
| 116 | Ga0307405_10007162 | 3300031731 | Bacteria | 5550 |
| 117 | Ga0307413_10015083 | 3300031824 | Bacteria | 3950 |
| 118 | Ga0307407_10063410 | 3300031903 | Bacteria | 2168 |
| 119 | Ga0307411_10186310 | 3300032005 | Bacteria | 1580 |
| 120 | Ga0307415_100167652 | 3300032126 | Bacteria | 1709 |
| 121 | Ga0373946_0023609 | 3300035171 | Bacteria | 2405 |
| 122 | Ga0373947_0085793 | 3300035725 | Bacteria | 1956 |
| 123 | Ga0395898_0102186 | 3300037466 | Bacteria | 2752 |
| 124 | Ga0395898_0359295 | 3300037466 | Bacteria | 1389 |
| 125 | Ga0395901_0005701 | 3300038443 | Bacteria | 12604 |
| 126 | Ga0395901_0145432 | 3300038443 | Bacteria | 2492 |
| 127 | Ga0466961_0036203 | 3300044693 | Bacteria | 3168 |
| 128 | Ga0466963_0012320 | 3300044694 | Bacteria | 5230 |
| 129 | Ga0466963_0014174 | 3300044694 | Bacteria | 4911 |
| 130 | Ga0466964_0025998 | 3300044706 | Unclassified | 2289 |
| 131 | Ga0466957_0077956 | 3300044842 | Bacteria | 2059 |
| 132 | Ga0466967_0009025 | 3300045976 | Bacteria | 7369 |
| 133 | Ga0466967_0101714 | 3300045976 | Bacteria | 2627 |
| 134 | Ga0466967_0403565 | 3300045976 | Bacteria | 1330 |
| 135 | Ga0466967_0771179 | 3300045976 | Bacteria | 954 |
| 136 | Ga0495603_0024306 | 3300046455 | Bacteria | 3664 |
| 137 | Ga0495582_0273161 | 3300046473 | Bacteria | 970 |
| 138 | Ga0495648_0014067 | 3300046524 | Bacteria | 5882 |
| 139 | Ga0496100_0109673 | 3300048903 | Bacteria | 1915 |
| 140 | Ga0496100_0435921 | 3300048903 | Bacteria | 1003 |
| 141 | Ga0496100_0468446 | 3300048903 | Bacteria | 968 |
| 142 | Ga0496101_0567346 | 3300048904 | Bacteria | 897 |
| 143 | Ga0496103_0273649 | 3300048906 | Bacteria | 1086 |
| 144 | Ga0496104_0012421 | 3300048907 | Bacteria | 7657 |
| 145 | Ga0496104_0046267 | 3300048907 | Bacteria | 4097 |
| 146 | Ga0496104_0117113 | 3300048907 | Bacteria | 2557 |
| 147 | Ga0496105_0017696 | 3300048908 | Bacteria | 5718 |
| 148 | Ga0496105_0068727 | 3300048908 | Bacteria | 2927 |
| 149 | Ga0496106_0195428 | 3300048909 | Bacteria | 1609 |
| 150 | Ga0496106_0296876 | 3300048909 | Bacteria | 1295 |
| 151 | Ga0496107_0019548 | 3300048910 | Bacteria | 4779 |
| 152 | Ga0496107_0069843 | 3300048910 | Bacteria | 2550 |
| 153 | Ga0496107_0085598 | 3300048910 | Bacteria | 2300 |
| 154 | Ga0496107_0113295 | 3300048910 | Bacteria | 1994 |
| 155 | Ga0496107_0277738 | 3300048910 | Bacteria | 1247 |
| 156 | Ga0496108_0015537 | 3300048911 | Bacteria | 6208 |
| 157 | Ga0496108_0076041 | 3300048911 | Bacteria | 2837 |
| 158 | Ga0496109_0095709 | 3300048912 | Bacteria | 2750 |
| 159 | Ga0496109_0253988 | 3300048912 | Bacteria | 1655 |
| 160 | Ga0496110_0000310 | 3300048913 | Bacteria | 32264 |
| 161 | Ga0496110_0263619 | 3300048913 | Bacteria | 1568 |
| 162 | Ga0496111_0009371 | 3300048914 | Bacteria | 6529 |
| 163 | Ga0496111_0061865 | 3300048914 | Bacteria | 2714 |
| 164 | Ga0496112_0007994 | 3300048915 | Bacteria | 9434 |
| 165 | Ga0496112_0017900 | 3300048915 | Bacteria | 6668 |
| 166 | Ga0496112_0269073 | 3300048915 | Bacteria | 1652 |
| 167 | Ga0496112_0630820 | 3300048915 | Bacteria | 1002 |
| 168 | Ga0496113_0040937 | 3300048916 | Bacteria | 3416 |
| 169 | Ga0496113_0127971 | 3300048916 | Bacteria | 1990 |
| 170 | Ga0496114_0098423 | 3300048917 | Bacteria | 2494 |
| 171 | Ga0496114_0143050 | 3300048917 | Bacteria | 2072 |
| 172 | Ga0496119_0000696 | 3300048922 | Bacteria | 45021 |
| 173 | Ga0496120_0000072 | 3300048923 | Bacteria | 164400 |
| 174 | Ga0496121_0021638 | 3300048924 | Bacteria | 6289 |
| 175 | Ga0501067_0289144 | 3300049583 | Bacteria | 913 |
| 176 | Ga0501070_0122585 | 3300049586 | Bacteria | 2148 |
| 177 | Ga0501072_0030195 | 3300049588 | Bacteria | 4237 |
| 178 | Ga0501073_0031481 | 3300049589 | Bacteria | 3785 |
| 179 | Ga0501074_0018519 | 3300049590 | Bacteria | 5059 |
| 180 | Ga0501079_0076182 | 3300049741 | Bacteria | 2595 |
| 181 | Ga0501080_0123963 | 3300049742 | Bacteria | 2393 |
| 182 | nmdc:mga05p37_598164_c1 | 3300050507 | Bacteria | 1245 |
| 183 | nmdc:mga09592_280443_c1 | 3300050508 | Bacteria | 1445 |
| 184 | nmdc:mga0n895_135659_c1 | 3300050512 | Bacteria | 2487 |
| 185 | nmdc:mga0rr50_51261_c1 | 3300050513 | Bacteria | 3061 |
| 186 | Ga0500556_0000226 | 3300053104 | Bacteria | 45612 |
| 187 | Ga0500616_0001741 | 3300053153 | Bacteria | 19953 |
| 188 | Ga0466962_0107141 | 3300061719 | Bacteria | 1344 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049583 | Ga0501067_0289144 | Ga0501067_0289144_44_850 | 261 |
| 2 | 3300048924 | Ga0496121_0021638 | Ga0496121_0021638_2101_3072 | 267 |
| 3 | 3300048903 | Ga0496100_0435921 | Ga0496100_0435921_57_866 | 269 |
| 4 | 3300005544 | Ga0070686_100266363 | Ga0070686_1002663632 | 272 |
| 5 | 3300009101 | Ga0105247_10000057 | Ga0105247_1000005787 | 273 |
| 6 | 3300009177 | Ga0105248_10007560 | Ga0105248_100075604 | 273 |
| 7 | 3300014968 | Ga0157379_10084007 | Ga0157379_100840072 | 273 |
| 8 | 3300025900 | Ga0207710_10000011 | Ga0207710_10000011223 | 273 |
| 9 | 3300025941 | Ga0207711_10012226 | Ga0207711_100122263 | 273 |
| 10 | 3300031731 | Ga0307405_10007162 | Ga0307405_100071624 | 273 |
| 11 | 3300031824 | Ga0307413_10015083 | Ga0307413_100150834 | 273 |
| 12 | 3300032005 | Ga0307411_10186310 | Ga0307411_101863101 | 273 |
| 13 | 3300048910 | Ga0496107_0085598 | Ga0496107_0085598_570_1484 | 273 |
| 14 | 3300048922 | Ga0496119_0000696 | Ga0496119_0000696_12575_13489 | 273 |
| 15 | 3300048923 | Ga0496120_0000072 | Ga0496120_0000072_116434_117348 | 273 |
| 16 | 3300025960 | Ga0207651_10618372 | Ga0207651_106183721 | 274 |
| 17 | 3300037466 | Ga0395898_0102186 | Ga0395898_0102186_553_1422 | 277 |
| 18 | 3300038443 | Ga0395901_0005701 | Ga0395901_0005701_2578_3447 | 277 |
| 19 | 3300045976 | Ga0466967_0403565 | Ga0466967_0403565_311_1189 | 277 |
| 20 | 3300037466 | Ga0395898_0359295 | Ga0395898_0359295_375_1241 | 288 |
| 21 | 3300005334 | Ga0068869_100393290 | Ga0068869_1003932901 | 289 |
| 22 | 3300005347 | Ga0070668_100319039 | Ga0070668_1003190392 | 289 |
| 23 | 3300005543 | Ga0070672_100424164 | Ga0070672_1004241642 | 289 |
| 24 | 3300005719 | Ga0068861_100016744 | Ga0068861_1000167444 | 289 |
| 25 | 3300005834 | Ga0068851_10164402 | Ga0068851_101644022 | 289 |
| 26 | 3300009098 | Ga0105245_10351967 | Ga0105245_103519672 | 289 |
| 27 | 3300013296 | Ga0157374_10478065 | Ga0157374_104780652 | 289 |
| 28 | 3300013306 | Ga0163162_10831750 | Ga0163162_108317501 | 289 |
| 29 | 3300025899 | Ga0207642_10125549 | Ga0207642_101255492 | 289 |
| 30 | 3300025901 | Ga0207688_10041338 | Ga0207688_100413383 | 289 |
| 31 | 3300025901 | Ga0207688_10161775 | Ga0207688_101617752 | 289 |
| 32 | 3300025927 | Ga0207687_10187851 | Ga0207687_101878512 | 289 |
| 33 | 3300025938 | Ga0207704_10068373 | Ga0207704_100683732 | 289 |
| 34 | 3300025940 | Ga0207691_10107399 | Ga0207691_101073992 | 289 |
| 35 | 3300025942 | Ga0207689_10235680 | Ga0207689_102356802 | 289 |
| 36 | 3300025972 | Ga0207668_10275963 | Ga0207668_102759632 | 289 |
| 37 | 3300025981 | Ga0207640_10150856 | Ga0207640_101508562 | 289 |
| 38 | 3300026075 | Ga0207708_10003667 | Ga0207708_100036678 | 289 |
| 39 | 3300026095 | Ga0207676_10260500 | Ga0207676_102605002 | 289 |
| 40 | 3300026118 | Ga0207675_100018720 | Ga0207675_1000187207 | 289 |
| 41 | 3300048906 | Ga0496103_0273649 | Ga0496103_0273649_12_881 | 289 |
| 42 | 3300048907 | Ga0496104_0046267 | Ga0496104_0046267_110_979 | 289 |
| 43 | 3300048907 | Ga0496104_0117113 | Ga0496104_0117113_722_1591 | 289 |
| 44 | 3300048908 | Ga0496105_0017696 | Ga0496105_0017696_4165_5034 | 289 |
| 45 | 3300048908 | Ga0496105_0068727 | Ga0496105_0068727_1682_2551 | 289 |
| 46 | 3300048910 | Ga0496107_0069843 | Ga0496107_0069843_663_1532 | 289 |
| 47 | 3300048912 | Ga0496109_0095709 | Ga0496109_0095709_904_1773 | 289 |
| 48 | 3300048913 | Ga0496110_0263619 | Ga0496110_0263619_28_897 | 289 |
| 49 | 3300048915 | Ga0496112_0269073 | Ga0496112_0269073_675_1544 | 289 |
| 50 | 3300048916 | Ga0496113_0127971 | Ga0496113_0127971_449_1318 | 289 |
| 51 | 3300050507 | nmdc:mga05p37_598164_c1 | nmdc:mga05p37_598164_c1_109_978 | 289 |
| 52 | 3300050508 | nmdc:mga09592_280443_c1 | nmdc:mga09592_280443_c1_15_884 | 289 |
| 53 | 3300005347 | Ga0070668_100055489 | Ga0070668_1000554894 | 290 |
| 54 | 3300005441 | Ga0070700_100283620 | Ga0070700_1002836202 | 290 |
| 55 | 3300009148 | Ga0105243_10069240 | Ga0105243_100692402 | 290 |
| 56 | 3300026067 | Ga0207678_10252233 | Ga0207678_102522332 | 290 |
| 57 | 3300048915 | Ga0496112_0630820 | Ga0496112_0630820_24_896 | 290 |
| 58 | iso_pu_bacteria | 2579778521 | 2579852802 | 290 |
| 59 | iso_pu_bacteria | 2619618881 | 2619856611 | 290 |
| 60 | iso_pu_bacteria | 2619619003 | 2620348822 | 290 |
| 61 | 3300005329 | Ga0070683_100267633 | Ga0070683_1002676331 | 291 |
| 62 | 3300005330 | Ga0070690_100132614 | Ga0070690_1001326141 | 291 |
| 63 | 3300005335 | Ga0070666_10088220 | Ga0070666_100882202 | 291 |
| 64 | 3300005338 | Ga0068868_100116849 | Ga0068868_1001168492 | 291 |
| 65 | 3300005339 | Ga0070660_100291454 | Ga0070660_1002914542 | 291 |
| 66 | 3300005354 | Ga0070675_100516215 | Ga0070675_1005162151 | 291 |
| 67 | 3300005366 | Ga0070659_100095749 | Ga0070659_1000957492 | 291 |
| 68 | 3300005457 | Ga0070662_100305143 | Ga0070662_1003051432 | 291 |
| 69 | 3300005459 | Ga0068867_100059172 | Ga0068867_1000591722 | 291 |
| 70 | 3300005466 | Ga0070685_10057466 | Ga0070685_100574662 | 291 |
| 71 | 3300005530 | Ga0070679_100058802 | Ga0070679_1000588021 | 291 |
| 72 | 3300005577 | Ga0068857_100184134 | Ga0068857_1001841342 | 291 |
| 73 | 3300005617 | Ga0068859_100021588 | Ga0068859_1000215882 | 291 |
| 74 | 3300005618 | Ga0068864_100112104 | Ga0068864_1001121043 | 291 |
| 75 | 3300005718 | Ga0068866_10171903 | Ga0068866_101719032 | 291 |
| 76 | 3300005719 | Ga0068861_100130085 | Ga0068861_1001300852 | 291 |
| 77 | 3300005834 | Ga0068851_10105506 | Ga0068851_101055062 | 291 |
| 78 | 3300005840 | Ga0068870_10012340 | Ga0068870_100123402 | 291 |
| 79 | 3300006175 | Ga0070712_100191668 | Ga0070712_1001916682 | 291 |
| 80 | 3300006881 | Ga0068865_100074354 | Ga0068865_1000743543 | 291 |
| 81 | 3300006931 | Ga0097620_100021589 | Ga0097620_1000215899 | 291 |
| 82 | 3300007076 | Ga0075435_100016829 | Ga0075435_1000168295 | 291 |
| 83 | 3300009094 | Ga0111539_10040083 | Ga0111539_100400834 | 291 |
| 84 | 3300009094 | Ga0111539_10117630 | Ga0111539_101176302 | 291 |
| 85 | 3300009094 | Ga0111539_10710301 | Ga0111539_107103012 | 291 |
| 86 | 3300009098 | Ga0105245_10087843 | Ga0105245_100878434 | 291 |
| 87 | 3300009098 | Ga0105245_10309309 | Ga0105245_103093092 | 291 |
| 88 | 3300009101 | Ga0105247_10252195 | Ga0105247_102521952 | 291 |
| 89 | 3300009148 | Ga0105243_10224412 | Ga0105243_102244122 | 291 |
| 90 | 3300009176 | Ga0105242_10079948 | Ga0105242_100799482 | 291 |
| 91 | 3300009553 | Ga0105249_10385461 | Ga0105249_103854612 | 291 |
| 92 | 3300010375 | Ga0105239_10305804 | Ga0105239_103058042 | 291 |
| 93 | 3300013306 | Ga0163162_10244450 | Ga0163162_102444501 | 291 |
| 94 | 3300013307 | Ga0157372_10237073 | Ga0157372_102370732 | 291 |
| 95 | 3300014745 | Ga0157377_10046959 | Ga0157377_100469592 | 291 |
| 96 | 3300014968 | Ga0157379_10781579 | Ga0157379_107815791 | 291 |
| 97 | 3300025899 | Ga0207642_10031959 | Ga0207642_100319592 | 291 |
| 98 | 3300025900 | Ga0207710_10093039 | Ga0207710_100930392 | 291 |
| 99 | 3300025901 | Ga0207688_10019358 | Ga0207688_100193582 | 291 |
| 100 | 3300025912 | Ga0207707_10103391 | Ga0207707_101033912 | 291 |
| 101 | 3300025915 | Ga0207693_10338333 | Ga0207693_103383331 | 291 |
| 102 | 3300025918 | Ga0207662_10021297 | Ga0207662_100212972 | 291 |
| 103 | 3300025921 | Ga0207652_10080826 | Ga0207652_100808262 | 291 |
| 104 | 3300025935 | Ga0207709_10117586 | Ga0207709_101175862 | 291 |
| 105 | 3300025940 | Ga0207691_10079536 | Ga0207691_100795363 | 291 |
| 106 | 3300025942 | Ga0207689_10075954 | Ga0207689_100759543 | 291 |
| 107 | 3300025972 | Ga0207668_10048332 | Ga0207668_100483322 | 291 |
| 108 | 3300025981 | Ga0207640_10084451 | Ga0207640_100844512 | 291 |
| 109 | 3300026023 | Ga0207677_10343378 | Ga0207677_103433782 | 291 |
| 110 | 3300026035 | Ga0207703_10379412 | Ga0207703_103794122 | 291 |
| 111 | 3300026067 | Ga0207678_10070745 | Ga0207678_100707453 | 291 |
| 112 | 3300026078 | Ga0207702_10073403 | Ga0207702_100734032 | 291 |
| 113 | 3300026089 | Ga0207648_10110605 | Ga0207648_101106052 | 291 |
| 114 | 3300026116 | Ga0207674_10349489 | Ga0207674_103494891 | 291 |
| 115 | 3300026121 | Ga0207683_10040875 | Ga0207683_100408754 | 291 |
| 116 | 3300031548 | Ga0307408_100341030 | Ga0307408_1003410302 | 291 |
| 117 | 3300031903 | Ga0307407_10063410 | Ga0307407_100634103 | 291 |
| 118 | 3300032126 | Ga0307415_100167652 | Ga0307415_1001676522 | 291 |
| 119 | 3300044694 | Ga0466963_0012320 | Ga0466963_0012320_1715_2590 | 291 |
| 120 | 3300044694 | Ga0466963_0014174 | Ga0466963_0014174_3788_4663 | 291 |
| 121 | 3300044706 | Ga0466964_0025998 | Ga0466964_0025998_358_1242 | 291 |
| 122 | 3300044842 | Ga0466957_0077956 | Ga0466957_0077956_177_1052 | 291 |
| 123 | 3300045976 | Ga0466967_0009025 | Ga0466967_0009025_3426_4301 | 291 |
| 124 | 3300045976 | Ga0466967_0771179 | Ga0466967_0771179_69_944 | 291 |
| 125 | 3300048903 | Ga0496100_0109673 | Ga0496100_0109673_204_1079 | 291 |
| 126 | 3300048904 | Ga0496101_0567346 | Ga0496101_0567346_11_886 | 291 |
| 127 | 3300048909 | Ga0496106_0296876 | Ga0496106_0296876_136_1011 | 291 |
| 128 | 3300048910 | Ga0496107_0019548 | Ga0496107_0019548_3625_4503 | 291 |
| 129 | 3300048910 | Ga0496107_0113295 | Ga0496107_0113295_790_1665 | 291 |
| 130 | 3300048910 | Ga0496107_0277738 | Ga0496107_0277738_235_1113 | 291 |
| 131 | 3300048911 | Ga0496108_0076041 | Ga0496108_0076041_1697_2572 | 291 |
| 132 | 3300048912 | Ga0496109_0253988 | Ga0496109_0253988_30_905 | 291 |
| 133 | 3300048917 | Ga0496114_0143050 | Ga0496114_0143050_1133_2008 | 291 |
| 134 | 3300050512 | nmdc:mga0n895_135659_c1 | nmdc:mga0n895_135659_c1_698_1573 | 291 |
| 135 | 3300050513 | nmdc:mga0rr50_51261_c1 | nmdc:mga0rr50_51261_c1_561_1439 | 291 |
| 136 | 3300061719 | Ga0466962_0107141 | Ga0466962_0107141_64_939 | 291 |
| 137 | iso_pu_bacteria | 2626541554 | 2626636118 | 291 |
| 138 | iso_pu_bacteria | 2626541554 | 2626640277 | 291 |
| 139 | 3300005347 | Ga0070668_100180473 | Ga0070668_1001804732 | 292 |
| 140 | 3300005441 | Ga0070700_100105832 | Ga0070700_1001058322 | 292 |
| 141 | 3300005441 | Ga0070700_100335489 | Ga0070700_1003354891 | 292 |
| 142 | 3300005457 | Ga0070662_100249113 | Ga0070662_1002491131 | 292 |
| 143 | 3300005458 | Ga0070681_10556787 | Ga0070681_105567871 | 292 |
| 144 | 3300005545 | Ga0070695_100123283 | Ga0070695_1001232832 | 292 |
| 145 | 3300006038 | Ga0075365_10104812 | Ga0075365_101048122 | 292 |
| 146 | 3300006048 | Ga0075363_100259100 | Ga0075363_1002591002 | 292 |
| 147 | 3300009094 | Ga0111539_10099899 | Ga0111539_100998992 | 292 |
| 148 | 3300009098 | Ga0105245_10434696 | Ga0105245_104346962 | 292 |
| 149 | 3300009147 | Ga0114129_10109559 | Ga0114129_101095592 | 292 |
| 150 | 3300009147 | Ga0114129_10155550 | Ga0114129_101555503 | 292 |
| 151 | 3300009553 | Ga0105249_10098356 | Ga0105249_100983562 | 292 |
| 152 | 3300013306 | Ga0163162_10595811 | Ga0163162_105958112 | 292 |
| 153 | 3300025912 | Ga0207707_10492923 | Ga0207707_104929231 | 292 |
| 154 | 3300025917 | Ga0207660_10362106 | Ga0207660_103621062 | 292 |
| 155 | 3300025921 | Ga0207652_10069180 | Ga0207652_100691802 | 292 |
| 156 | 3300026075 | Ga0207708_10134072 | Ga0207708_101340722 | 292 |
| 157 | 3300026075 | Ga0207708_10306767 | Ga0207708_103067671 | 292 |
| 158 | 3300028380 | Ga0268265_10560970 | Ga0268265_105609701 | 292 |
| 159 | 3300038443 | Ga0395901_0145432 | Ga0395901_0145432_704_1636 | 292 |
| 160 | 3300044693 | Ga0466961_0036203 | Ga0466961_0036203_2057_2941 | 292 |
| 161 | 3300045976 | Ga0466967_0101714 | Ga0466967_0101714_910_1788 | 292 |
| 162 | 3300046524 | Ga0495648_0014067 | Ga0495648_0014067_4651_5688 | 292 |
| 163 | 3300048903 | Ga0496100_0468446 | Ga0496100_0468446_34_912 | 292 |
| 164 | 3300048914 | Ga0496111_0061865 | Ga0496111_0061865_1700_2590 | 292 |
| 165 | 3300049586 | Ga0501070_0122585 | Ga0501070_0122585_163_1053 | 292 |
| 166 | 3300049588 | Ga0501072_0030195 | Ga0501072_0030195_2259_3149 | 292 |
| 167 | 3300049589 | Ga0501073_0031481 | Ga0501073_0031481_1367_2257 | 292 |
| 168 | 3300049590 | Ga0501074_0018519 | Ga0501074_0018519_2186_3076 | 292 |
| 169 | 3300049741 | Ga0501079_0076182 | Ga0501079_0076182_1414_2304 | 292 |
| 170 | 3300049742 | Ga0501080_0123963 | Ga0501080_0123963_710_1600 | 292 |
| 171 | 3300053104 | Ga0500556_0000226 | Ga0500556_0000226_14156_15055 | 292 |
| 172 | 3300053153 | Ga0500616_0001741 | Ga0500616_0001741_9589_10488 | 292 |
| 173 | iso_pu_bacteria | 2506783011 | 2506865412 | 292 |
| 174 | iso_pu_bacteria | 2527291627 | 2528206601 | 292 |
| 175 | iso_pu_bacteria | 2527291629 | 2528215627 | 292 |
| 176 | iso_pu_bacteria | 2546825537 | 2546950834 | 292 |
| 177 | iso_pu_bacteria | 2576861822 | 2579749381 | 292 |
| 178 | iso_pu_bacteria | 2684623036 | 2686543995 | 292 |
| 179 | iso_pu_bacteria | 2687453743 | 2689995375 | 292 |
| 180 | iso_pu_bacteria | 2710264753 | 2710604749 | 292 |
| 181 | iso_pu_bacteria | 2773857924 | 2774866892 | 292 |
| 182 | iso_pu_bacteria | 2773857933 | 2774901261 | 292 |
| 183 | iso_pu_bacteria | 637000116 | 637881148 | 292 |
| 184 | iso_pu_bacteria | 8054913762 | 8054918313 | 292 |
| 185 | iso_pu_bacteria | 8055157932 | 8055162480 | 292 |
| 186 | 3300005329 | Ga0070683_100103613 | Ga0070683_1001036132 | 293 |
| 187 | 3300005455 | Ga0070663_100145019 | Ga0070663_1001450192 | 293 |
| 188 | 3300005577 | Ga0068857_100573532 | Ga0068857_1005735322 | 293 |
| 189 | 3300005616 | Ga0068852_100079862 | Ga0068852_1000798623 | 293 |
| 190 | 3300014325 | Ga0163163_10339866 | Ga0163163_103398661 | 293 |
| 191 | 3300026078 | Ga0207702_10202652 | Ga0207702_102026523 | 293 |
| 192 | 3300026095 | Ga0207676_10196318 | Ga0207676_101963182 | 293 |
| 193 | 3300026142 | Ga0207698_10065420 | Ga0207698_100654202 | 293 |
| 194 | 3300035171 | Ga0373946_0023609 | Ga0373946_0023609_407_1300 | 293 |
| 195 | 3300035725 | Ga0373947_0085793 | Ga0373947_0085793_274_1167 | 293 |
| 196 | 3300046455 | Ga0495603_0024306 | Ga0495603_0024306_588_1481 | 293 |
| 197 | 3300046473 | Ga0495582_0273161 | Ga0495582_0273161_63_956 | 293 |
| 198 | 3300048907 | Ga0496104_0012421 | Ga0496104_0012421_5897_6835 | 293 |
| 199 | 3300048909 | Ga0496106_0195428 | Ga0496106_0195428_447_1385 | 293 |
| 200 | 3300048911 | Ga0496108_0015537 | Ga0496108_0015537_3264_4202 | 293 |
| 201 | 3300048913 | Ga0496110_0000310 | Ga0496110_0000310_695_1633 | 293 |
| 202 | 3300048914 | Ga0496111_0009371 | Ga0496111_0009371_3511_4449 | 293 |
| 203 | 3300048915 | Ga0496112_0007994 | Ga0496112_0007994_6420_7346 | 293 |
| 204 | 3300048915 | Ga0496112_0017900 | Ga0496112_0017900_5312_6250 | 293 |
| 205 | 3300048916 | Ga0496113_0040937 | Ga0496113_0040937_783_1721 | 293 |
| 206 | 3300048917 | Ga0496114_0098423 | Ga0496114_0098423_1367_2305 | 293 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3s40-assembly5.cif.gz_D | the crystal structure of a diacylglycerol kinases from bacillus anthracis str. sterne | 0.8768 | 3 | 291 |
| 3s40-assembly5.cif.gz_A | the crystal structure of a diacylglycerol kinases from bacillus anthracis str. sterne | 0.8683 | 3 | 291 |
| 3t5p-assembly1.cif.gz_H | crystal structure of a putative diacylglycerol kinase from bacillus anthracis str. sterne | 0.8673 | 3 | 291 |
| 3t5p-assembly1.cif.gz_F | crystal structure of a putative diacylglycerol kinase from bacillus anthracis str. sterne | 0.8658 | 3 | 291 |
| 2jgr-assembly1.cif.gz_A | crystal structure of yegs in complex with adp | 0.8657 | 4 | 292 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WP29_144_297_2.60.200.40 | Mainly Beta;Sandwich;Tumour Suppressor Smad4; | 0.9572 | 134 | 283 | 2.60.200.40 |
| af_P9WP29_144_297_2.60.200.40 | Mainly Beta;Sandwich;Tumour Suppressor Smad4; | 0.9271 | 134 | 283 | 2.60.200.40 |
| af_Q2FWZ2_3_120_3.40.50.10330 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Probable inorganic polyphosphate/atp-NAD kinase; domain 1 | 0.9059 | 4 | 118 | 3.40.50.10330 |
| af_Q10SE4_189_349_2.60.200.40 | Mainly Beta;Sandwich;Tumour Suppressor Smad4; | 0.8997 | 132 | 284 | 2.60.200.40 |
| af_Q2FWZ2_3_120_3.40.50.10330 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Probable inorganic polyphosphate/atp-NAD kinase; domain 1 | 0.8778 | 4 | 118 | 3.40.50.10330 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538CDI0-F1-model_v4 | Diacylglycerol kinase family lipid kinase | 0.9888 | 6 | 292 |
GO:0005524
GO:0005886 GO:0008654 GO:0016301 |
| AF-A0A538CDI0-F1-model_v4 | Diacylglycerol kinase family lipid kinase | 0.982 | 6 | 292 |
GO:0005524
GO:0005886 GO:0008654 GO:0016301 |
| AF-A0A0S8H1Y2-F1-model_v4 | YegS/DAGK C-terminal domain-containing protein | 0.9744 | 165 | 284 |
|
| AF-A0A1F9LD76-F1-model_v4 | YegS/DAGK C-terminal domain-containing protein | 0.9712 | 177 | 284 |
GO:0004143
GO:0005886 |
| AF-A0A3N1D6F6-F1-model_v4 | YegS/Rv2252/BmrU family lipid kinase | 0.9708 | 4 | 292 |
GO:0005524
GO:0005886 GO:0016301 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar