F315787

General Info

Members Datasets Scaffolds Average Seq Length
206 143 188 295

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2527291627|2528206601
Length 356
Sequence PRLRIPGSASPAPHPRPLGDLPHPPVSSLTMTDAAAPRTPSRGSLGAVAPQPLRVEPAEVDRNRLAVIVNPSAGHGRAMRMLDGVRVELARWARDVRVTPTRDLAHADDLAAAATAQGRVVVALGGDGLAGSVAGGVARCGGVLAVLPGGRGNDFVRGLGLPRDPCRVAAGLAHARERRVDLPEVGGRPFLGIASVGYDSDVQVIANRTRFLRGQQVYTYAALRALAAWRPARFTVTVDDLAPRDLVGWTVAAANSAYYGGGMRFAPGADIADGLLDVLLISRTSRLTFLALFPRVFSGRHVDTRHVRVLRARRVRIEADRPFAVYADGDPLASLPAEIVVRPGALRLLVPVIPAS

Samples

Sample ID Description Type Environment
1 2506783011 Frankia datiscae Dg1 Isolate Nodule
2 2527291627 Frankia casuarinae Thr Isolate Nodule
3 2527291629 Frankia sp. BMG5.23 Isolate Nodule
4 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
5 2576861822 Frankia sp. CeD Isolate Nodule
6 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
7 2619618881 Frankia sp. ACN1ag Isolate Unclassified
8 2619619003 Frankia sp. CpI1-P Isolate Nodule
9 2626541554 Frankia sp. AvcI.1 Isolate Nodule
10 2684623036 Frankia sp. CgIM4 Isolate Nodule
11 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
12 2710264753 Frankia sp. KB5 Isolate Nodule
13 2773857924 Frankia sp. CgIS1 Isolate Nodule
14 2773857933 Frankia sp. BMG5.30 Isolate Nodule
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
93 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
94 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
95 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
96 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
97 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
98 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
99 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
100 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
101 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
102 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
103 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
104 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
105 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
106 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
107 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
108 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
109 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
110 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
111 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
112 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
113 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
114 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
115 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
116 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
117 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
118 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
119 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
120 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
121 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
122 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
123 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
124 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
125 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
126 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
127 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
128 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
129 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
130 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
131 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
132 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
133 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
134 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
135 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
136 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
137 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
138 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
139 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
140 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
141 637000116 Frankia casuarinae CcI3 Isolate Nodule
142 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
143 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.26
Metatranscriptomes 0
Isolates 8.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.94
Nodule 7.28
Rhizoplane 16.5
Rhizosphere 71.84
Stem 0
Stem Tuber 0
Unclassified 2.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100103613 3300005329 Bacteria 2681
2 Ga0070683_100267633 3300005329 Bacteria 1625
3 Ga0070690_100132614 3300005330 Bacteria 1684
4 Ga0068869_100393290 3300005334 Bacteria 1138
5 Ga0070666_10088220 3300005335 Bacteria 2128
6 Ga0068868_100116849 3300005338 Bacteria 2172
7 Ga0070660_100291454 3300005339 Bacteria 1337
8 Ga0070668_100055489 3300005347 Bacteria 3058
9 Ga0070668_100180473 3300005347 Bacteria 1724
10 Ga0070668_100319039 3300005347 Bacteria 1308
11 Ga0070675_100516215 3300005354 Bacteria 1078
12 Ga0070659_100095749 3300005366 Bacteria 2384
13 Ga0070700_100105832 3300005441 Bacteria 1861
14 Ga0070700_100283620 3300005441 Bacteria 1202
15 Ga0070700_100335489 3300005441 Bacteria 1116
16 Ga0070663_100145019 3300005455 Bacteria 1816
17 Ga0070662_100249113 3300005457 Bacteria 1427
18 Ga0070662_100305143 3300005457 Bacteria 1294
19 Ga0070681_10556787 3300005458 Bacteria 1060
20 Ga0068867_100059172 3300005459 Bacteria 2840
21 Ga0070685_10057466 3300005466 Bacteria 2265
22 Ga0070679_100058802 3300005530 Bacteria 3831
23 Ga0070672_100424164 3300005543 Bacteria 1143
24 Ga0070686_100266363 3300005544 Unclassified 1258
25 Ga0070695_100123283 3300005545 Bacteria 1776
26 Ga0068857_100184134 3300005577 Bacteria 1901
27 Ga0068857_100573532 3300005577 Bacteria 1064
28 Ga0068852_100079862 3300005616 Bacteria 2898
29 Ga0068859_100021588 3300005617 Bacteria 6462
30 Ga0068864_100112104 3300005618 Bacteria 2431
31 Ga0068866_10171903 3300005718 Bacteria 1273
32 Ga0068861_100016744 3300005719 Bacteria 5193
33 Ga0068861_100130085 3300005719 Bacteria 2042
34 Ga0068851_10105506 3300005834 Bacteria 1500
35 Ga0068851_10164402 3300005834 Bacteria 1221
36 Ga0068870_10012340 3300005840 Bacteria 3990
37 Ga0075365_10104812 3300006038 Bacteria 1939
38 Ga0075363_100259100 3300006048 Bacteria 1003
39 Ga0070712_100191668 3300006175 Bacteria 1600
40 Ga0068865_100074354 3300006881 Bacteria 2419
41 Ga0097620_100021589 3300006931 Bacteria 6462
42 Ga0075435_100016829 3300007076 Bacteria 5520
43 Ga0111539_10040083 3300009094 Bacteria 5641
44 Ga0111539_10099899 3300009094 Bacteria 3407
45 Ga0111539_10117630 3300009094 Bacteria 3115
46 Ga0111539_10710301 3300009094 Unclassified 1170
47 Ga0105245_10087843 3300009098 Bacteria 2854
48 Ga0105245_10309309 3300009098 Bacteria 1553
49 Ga0105245_10351967 3300009098 Bacteria 1460
50 Ga0105245_10434696 3300009098 Bacteria 1318
51 Ga0105247_10000057 3300009101 Bacteria 133165
52 Ga0105247_10252195 3300009101 Bacteria 1207
53 Ga0114129_10109559 3300009147 Bacteria 3812
54 Ga0114129_10155550 3300009147 Bacteria 3127
55 Ga0105243_10069240 3300009148 Bacteria 2846
56 Ga0105243_10224412 3300009148 Bacteria 1663
57 Ga0105242_10079948 3300009176 Bacteria 2731
58 Ga0105248_10007560 3300009177 Bacteria 11933
59 Ga0105249_10098356 3300009553 Bacteria 2748
60 Ga0105249_10385461 3300009553 Bacteria 1428
61 Ga0105239_10305804 3300010375 Bacteria 1791
62 Ga0157374_10478065 3300013296 Bacteria 1249
63 Ga0163162_10244450 3300013306 Bacteria 1926
64 Ga0163162_10595811 3300013306 Bacteria 1232
65 Ga0163162_10831750 3300013306 Bacteria 1039
66 Ga0157372_10237073 3300013307 Bacteria 2116
67 Ga0163163_10339866 3300014325 Bacteria 1556
68 Ga0157377_10046959 3300014745 Bacteria 2417
69 Ga0157379_10084007 3300014968 Bacteria 2854
70 Ga0157379_10781579 3300014968 Bacteria 900
71 Ga0207642_10031959 3300025899 Bacteria 2211
72 Ga0207642_10125549 3300025899 Bacteria 1331
73 Ga0207710_10000011 3300025900 Bacteria 428560
74 Ga0207710_10093039 3300025900 Bacteria 1414
75 Ga0207688_10019358 3300025901 Bacteria 3707
76 Ga0207688_10041338 3300025901 Bacteria 2564
77 Ga0207688_10161775 3300025901 Bacteria 1327
78 Ga0207707_10103391 3300025912 Bacteria 2490
79 Ga0207707_10492923 3300025912 Bacteria 1046
80 Ga0207693_10338333 3300025915 Bacteria 1178
81 Ga0207660_10362106 3300025917 Bacteria 1164
82 Ga0207662_10021297 3300025918 Bacteria 3705
83 Ga0207652_10069180 3300025921 Bacteria 3065
84 Ga0207652_10080826 3300025921 Bacteria 2842
85 Ga0207687_10187851 3300025927 Bacteria 1606
86 Ga0207709_10117586 3300025935 Bacteria 1789
87 Ga0207704_10068373 3300025938 Bacteria 2239
88 Ga0207691_10079536 3300025940 Bacteria 2950
89 Ga0207691_10107399 3300025940 Bacteria 2485
90 Ga0207711_10012226 3300025941 Bacteria 7139
91 Ga0207689_10075954 3300025942 Bacteria 2762
92 Ga0207689_10235680 3300025942 Bacteria 1513
93 Ga0207651_10618372 3300025960 Bacteria 949
94 Ga0207668_10048332 3300025972 Bacteria 2919
95 Ga0207668_10275963 3300025972 Bacteria 1376
96 Ga0207640_10084451 3300025981 Bacteria 2180
97 Ga0207640_10150856 3300025981 Bacteria 1707
98 Ga0207677_10343378 3300026023 Bacteria 1248
99 Ga0207703_10379412 3300026035 Bacteria 1307
100 Ga0207678_10070745 3300026067 Bacteria 2991
101 Ga0207678_10252233 3300026067 Bacteria 1511
102 Ga0207708_10003667 3300026075 Bacteria 11340
103 Ga0207708_10134072 3300026075 Bacteria 1938
104 Ga0207708_10306767 3300026075 Bacteria 1292
105 Ga0207702_10073403 3300026078 Bacteria 2950
106 Ga0207702_10202652 3300026078 Bacteria 1840
107 Ga0207648_10110605 3300026089 Bacteria 2412
108 Ga0207676_10196318 3300026095 Bacteria 1780
109 Ga0207676_10260500 3300026095 Bacteria 1566
110 Ga0207674_10349489 3300026116 Bacteria 1429
111 Ga0207675_100018720 3300026118 Bacteria 6464
112 Ga0207683_10040875 3300026121 Bacteria 4048
113 Ga0207698_10065420 3300026142 Bacteria 2855
114 Ga0268265_10560970 3300028380 Unclassified 1086
115 Ga0307408_100341030 3300031548 Bacteria 1268
116 Ga0307405_10007162 3300031731 Bacteria 5550
117 Ga0307413_10015083 3300031824 Bacteria 3950
118 Ga0307407_10063410 3300031903 Bacteria 2168
119 Ga0307411_10186310 3300032005 Bacteria 1580
120 Ga0307415_100167652 3300032126 Bacteria 1709
121 Ga0373946_0023609 3300035171 Bacteria 2405
122 Ga0373947_0085793 3300035725 Bacteria 1956
123 Ga0395898_0102186 3300037466 Bacteria 2752
124 Ga0395898_0359295 3300037466 Bacteria 1389
125 Ga0395901_0005701 3300038443 Bacteria 12604
126 Ga0395901_0145432 3300038443 Bacteria 2492
127 Ga0466961_0036203 3300044693 Bacteria 3168
128 Ga0466963_0012320 3300044694 Bacteria 5230
129 Ga0466963_0014174 3300044694 Bacteria 4911
130 Ga0466964_0025998 3300044706 Unclassified 2289
131 Ga0466957_0077956 3300044842 Bacteria 2059
132 Ga0466967_0009025 3300045976 Bacteria 7369
133 Ga0466967_0101714 3300045976 Bacteria 2627
134 Ga0466967_0403565 3300045976 Bacteria 1330
135 Ga0466967_0771179 3300045976 Bacteria 954
136 Ga0495603_0024306 3300046455 Bacteria 3664
137 Ga0495582_0273161 3300046473 Bacteria 970
138 Ga0495648_0014067 3300046524 Bacteria 5882
139 Ga0496100_0109673 3300048903 Bacteria 1915
140 Ga0496100_0435921 3300048903 Bacteria 1003
141 Ga0496100_0468446 3300048903 Bacteria 968
142 Ga0496101_0567346 3300048904 Bacteria 897
143 Ga0496103_0273649 3300048906 Bacteria 1086
144 Ga0496104_0012421 3300048907 Bacteria 7657
145 Ga0496104_0046267 3300048907 Bacteria 4097
146 Ga0496104_0117113 3300048907 Bacteria 2557
147 Ga0496105_0017696 3300048908 Bacteria 5718
148 Ga0496105_0068727 3300048908 Bacteria 2927
149 Ga0496106_0195428 3300048909 Bacteria 1609
150 Ga0496106_0296876 3300048909 Bacteria 1295
151 Ga0496107_0019548 3300048910 Bacteria 4779
152 Ga0496107_0069843 3300048910 Bacteria 2550
153 Ga0496107_0085598 3300048910 Bacteria 2300
154 Ga0496107_0113295 3300048910 Bacteria 1994
155 Ga0496107_0277738 3300048910 Bacteria 1247
156 Ga0496108_0015537 3300048911 Bacteria 6208
157 Ga0496108_0076041 3300048911 Bacteria 2837
158 Ga0496109_0095709 3300048912 Bacteria 2750
159 Ga0496109_0253988 3300048912 Bacteria 1655
160 Ga0496110_0000310 3300048913 Bacteria 32264
161 Ga0496110_0263619 3300048913 Bacteria 1568
162 Ga0496111_0009371 3300048914 Bacteria 6529
163 Ga0496111_0061865 3300048914 Bacteria 2714
164 Ga0496112_0007994 3300048915 Bacteria 9434
165 Ga0496112_0017900 3300048915 Bacteria 6668
166 Ga0496112_0269073 3300048915 Bacteria 1652
167 Ga0496112_0630820 3300048915 Bacteria 1002
168 Ga0496113_0040937 3300048916 Bacteria 3416
169 Ga0496113_0127971 3300048916 Bacteria 1990
170 Ga0496114_0098423 3300048917 Bacteria 2494
171 Ga0496114_0143050 3300048917 Bacteria 2072
172 Ga0496119_0000696 3300048922 Bacteria 45021
173 Ga0496120_0000072 3300048923 Bacteria 164400
174 Ga0496121_0021638 3300048924 Bacteria 6289
175 Ga0501067_0289144 3300049583 Bacteria 913
176 Ga0501070_0122585 3300049586 Bacteria 2148
177 Ga0501072_0030195 3300049588 Bacteria 4237
178 Ga0501073_0031481 3300049589 Bacteria 3785
179 Ga0501074_0018519 3300049590 Bacteria 5059
180 Ga0501079_0076182 3300049741 Bacteria 2595
181 Ga0501080_0123963 3300049742 Bacteria 2393
182 nmdc:mga05p37_598164_c1 3300050507 Bacteria 1245
183 nmdc:mga09592_280443_c1 3300050508 Bacteria 1445
184 nmdc:mga0n895_135659_c1 3300050512 Bacteria 2487
185 nmdc:mga0rr50_51261_c1 3300050513 Bacteria 3061
186 Ga0500556_0000226 3300053104 Bacteria 45612
187 Ga0500616_0001741 3300053153 Bacteria 19953
188 Ga0466962_0107141 3300061719 Bacteria 1344

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049583 Ga0501067_0289144 Ga0501067_0289144_44_850 261
2 3300048924 Ga0496121_0021638 Ga0496121_0021638_2101_3072 267
3 3300048903 Ga0496100_0435921 Ga0496100_0435921_57_866 269
4 3300005544 Ga0070686_100266363 Ga0070686_1002663632 272
5 3300009101 Ga0105247_10000057 Ga0105247_1000005787 273
6 3300009177 Ga0105248_10007560 Ga0105248_100075604 273
7 3300014968 Ga0157379_10084007 Ga0157379_100840072 273
8 3300025900 Ga0207710_10000011 Ga0207710_10000011223 273
9 3300025941 Ga0207711_10012226 Ga0207711_100122263 273
10 3300031731 Ga0307405_10007162 Ga0307405_100071624 273
11 3300031824 Ga0307413_10015083 Ga0307413_100150834 273
12 3300032005 Ga0307411_10186310 Ga0307411_101863101 273
13 3300048910 Ga0496107_0085598 Ga0496107_0085598_570_1484 273
14 3300048922 Ga0496119_0000696 Ga0496119_0000696_12575_13489 273
15 3300048923 Ga0496120_0000072 Ga0496120_0000072_116434_117348 273
16 3300025960 Ga0207651_10618372 Ga0207651_106183721 274
17 3300037466 Ga0395898_0102186 Ga0395898_0102186_553_1422 277
18 3300038443 Ga0395901_0005701 Ga0395901_0005701_2578_3447 277
19 3300045976 Ga0466967_0403565 Ga0466967_0403565_311_1189 277
20 3300037466 Ga0395898_0359295 Ga0395898_0359295_375_1241 288
21 3300005334 Ga0068869_100393290 Ga0068869_1003932901 289
22 3300005347 Ga0070668_100319039 Ga0070668_1003190392 289
23 3300005543 Ga0070672_100424164 Ga0070672_1004241642 289
24 3300005719 Ga0068861_100016744 Ga0068861_1000167444 289
25 3300005834 Ga0068851_10164402 Ga0068851_101644022 289
26 3300009098 Ga0105245_10351967 Ga0105245_103519672 289
27 3300013296 Ga0157374_10478065 Ga0157374_104780652 289
28 3300013306 Ga0163162_10831750 Ga0163162_108317501 289
29 3300025899 Ga0207642_10125549 Ga0207642_101255492 289
30 3300025901 Ga0207688_10041338 Ga0207688_100413383 289
31 3300025901 Ga0207688_10161775 Ga0207688_101617752 289
32 3300025927 Ga0207687_10187851 Ga0207687_101878512 289
33 3300025938 Ga0207704_10068373 Ga0207704_100683732 289
34 3300025940 Ga0207691_10107399 Ga0207691_101073992 289
35 3300025942 Ga0207689_10235680 Ga0207689_102356802 289
36 3300025972 Ga0207668_10275963 Ga0207668_102759632 289
37 3300025981 Ga0207640_10150856 Ga0207640_101508562 289
38 3300026075 Ga0207708_10003667 Ga0207708_100036678 289
39 3300026095 Ga0207676_10260500 Ga0207676_102605002 289
40 3300026118 Ga0207675_100018720 Ga0207675_1000187207 289
41 3300048906 Ga0496103_0273649 Ga0496103_0273649_12_881 289
42 3300048907 Ga0496104_0046267 Ga0496104_0046267_110_979 289
43 3300048907 Ga0496104_0117113 Ga0496104_0117113_722_1591 289
44 3300048908 Ga0496105_0017696 Ga0496105_0017696_4165_5034 289
45 3300048908 Ga0496105_0068727 Ga0496105_0068727_1682_2551 289
46 3300048910 Ga0496107_0069843 Ga0496107_0069843_663_1532 289
47 3300048912 Ga0496109_0095709 Ga0496109_0095709_904_1773 289
48 3300048913 Ga0496110_0263619 Ga0496110_0263619_28_897 289
49 3300048915 Ga0496112_0269073 Ga0496112_0269073_675_1544 289
50 3300048916 Ga0496113_0127971 Ga0496113_0127971_449_1318 289
51 3300050507 nmdc:mga05p37_598164_c1 nmdc:mga05p37_598164_c1_109_978 289
52 3300050508 nmdc:mga09592_280443_c1 nmdc:mga09592_280443_c1_15_884 289
53 3300005347 Ga0070668_100055489 Ga0070668_1000554894 290
54 3300005441 Ga0070700_100283620 Ga0070700_1002836202 290
55 3300009148 Ga0105243_10069240 Ga0105243_100692402 290
56 3300026067 Ga0207678_10252233 Ga0207678_102522332 290
57 3300048915 Ga0496112_0630820 Ga0496112_0630820_24_896 290
58 iso_pu_bacteria 2579778521 2579852802 290
59 iso_pu_bacteria 2619618881 2619856611 290
60 iso_pu_bacteria 2619619003 2620348822 290
61 3300005329 Ga0070683_100267633 Ga0070683_1002676331 291
62 3300005330 Ga0070690_100132614 Ga0070690_1001326141 291
63 3300005335 Ga0070666_10088220 Ga0070666_100882202 291
64 3300005338 Ga0068868_100116849 Ga0068868_1001168492 291
65 3300005339 Ga0070660_100291454 Ga0070660_1002914542 291
66 3300005354 Ga0070675_100516215 Ga0070675_1005162151 291
67 3300005366 Ga0070659_100095749 Ga0070659_1000957492 291
68 3300005457 Ga0070662_100305143 Ga0070662_1003051432 291
69 3300005459 Ga0068867_100059172 Ga0068867_1000591722 291
70 3300005466 Ga0070685_10057466 Ga0070685_100574662 291
71 3300005530 Ga0070679_100058802 Ga0070679_1000588021 291
72 3300005577 Ga0068857_100184134 Ga0068857_1001841342 291
73 3300005617 Ga0068859_100021588 Ga0068859_1000215882 291
74 3300005618 Ga0068864_100112104 Ga0068864_1001121043 291
75 3300005718 Ga0068866_10171903 Ga0068866_101719032 291
76 3300005719 Ga0068861_100130085 Ga0068861_1001300852 291
77 3300005834 Ga0068851_10105506 Ga0068851_101055062 291
78 3300005840 Ga0068870_10012340 Ga0068870_100123402 291
79 3300006175 Ga0070712_100191668 Ga0070712_1001916682 291
80 3300006881 Ga0068865_100074354 Ga0068865_1000743543 291
81 3300006931 Ga0097620_100021589 Ga0097620_1000215899 291
82 3300007076 Ga0075435_100016829 Ga0075435_1000168295 291
83 3300009094 Ga0111539_10040083 Ga0111539_100400834 291
84 3300009094 Ga0111539_10117630 Ga0111539_101176302 291
85 3300009094 Ga0111539_10710301 Ga0111539_107103012 291
86 3300009098 Ga0105245_10087843 Ga0105245_100878434 291
87 3300009098 Ga0105245_10309309 Ga0105245_103093092 291
88 3300009101 Ga0105247_10252195 Ga0105247_102521952 291
89 3300009148 Ga0105243_10224412 Ga0105243_102244122 291
90 3300009176 Ga0105242_10079948 Ga0105242_100799482 291
91 3300009553 Ga0105249_10385461 Ga0105249_103854612 291
92 3300010375 Ga0105239_10305804 Ga0105239_103058042 291
93 3300013306 Ga0163162_10244450 Ga0163162_102444501 291
94 3300013307 Ga0157372_10237073 Ga0157372_102370732 291
95 3300014745 Ga0157377_10046959 Ga0157377_100469592 291
96 3300014968 Ga0157379_10781579 Ga0157379_107815791 291
97 3300025899 Ga0207642_10031959 Ga0207642_100319592 291
98 3300025900 Ga0207710_10093039 Ga0207710_100930392 291
99 3300025901 Ga0207688_10019358 Ga0207688_100193582 291
100 3300025912 Ga0207707_10103391 Ga0207707_101033912 291
101 3300025915 Ga0207693_10338333 Ga0207693_103383331 291
102 3300025918 Ga0207662_10021297 Ga0207662_100212972 291
103 3300025921 Ga0207652_10080826 Ga0207652_100808262 291
104 3300025935 Ga0207709_10117586 Ga0207709_101175862 291
105 3300025940 Ga0207691_10079536 Ga0207691_100795363 291
106 3300025942 Ga0207689_10075954 Ga0207689_100759543 291
107 3300025972 Ga0207668_10048332 Ga0207668_100483322 291
108 3300025981 Ga0207640_10084451 Ga0207640_100844512 291
109 3300026023 Ga0207677_10343378 Ga0207677_103433782 291
110 3300026035 Ga0207703_10379412 Ga0207703_103794122 291
111 3300026067 Ga0207678_10070745 Ga0207678_100707453 291
112 3300026078 Ga0207702_10073403 Ga0207702_100734032 291
113 3300026089 Ga0207648_10110605 Ga0207648_101106052 291
114 3300026116 Ga0207674_10349489 Ga0207674_103494891 291
115 3300026121 Ga0207683_10040875 Ga0207683_100408754 291
116 3300031548 Ga0307408_100341030 Ga0307408_1003410302 291
117 3300031903 Ga0307407_10063410 Ga0307407_100634103 291
118 3300032126 Ga0307415_100167652 Ga0307415_1001676522 291
119 3300044694 Ga0466963_0012320 Ga0466963_0012320_1715_2590 291
120 3300044694 Ga0466963_0014174 Ga0466963_0014174_3788_4663 291
121 3300044706 Ga0466964_0025998 Ga0466964_0025998_358_1242 291
122 3300044842 Ga0466957_0077956 Ga0466957_0077956_177_1052 291
123 3300045976 Ga0466967_0009025 Ga0466967_0009025_3426_4301 291
124 3300045976 Ga0466967_0771179 Ga0466967_0771179_69_944 291
125 3300048903 Ga0496100_0109673 Ga0496100_0109673_204_1079 291
126 3300048904 Ga0496101_0567346 Ga0496101_0567346_11_886 291
127 3300048909 Ga0496106_0296876 Ga0496106_0296876_136_1011 291
128 3300048910 Ga0496107_0019548 Ga0496107_0019548_3625_4503 291
129 3300048910 Ga0496107_0113295 Ga0496107_0113295_790_1665 291
130 3300048910 Ga0496107_0277738 Ga0496107_0277738_235_1113 291
131 3300048911 Ga0496108_0076041 Ga0496108_0076041_1697_2572 291
132 3300048912 Ga0496109_0253988 Ga0496109_0253988_30_905 291
133 3300048917 Ga0496114_0143050 Ga0496114_0143050_1133_2008 291
134 3300050512 nmdc:mga0n895_135659_c1 nmdc:mga0n895_135659_c1_698_1573 291
135 3300050513 nmdc:mga0rr50_51261_c1 nmdc:mga0rr50_51261_c1_561_1439 291
136 3300061719 Ga0466962_0107141 Ga0466962_0107141_64_939 291
137 iso_pu_bacteria 2626541554 2626636118 291
138 iso_pu_bacteria 2626541554 2626640277 291
139 3300005347 Ga0070668_100180473 Ga0070668_1001804732 292
140 3300005441 Ga0070700_100105832 Ga0070700_1001058322 292
141 3300005441 Ga0070700_100335489 Ga0070700_1003354891 292
142 3300005457 Ga0070662_100249113 Ga0070662_1002491131 292
143 3300005458 Ga0070681_10556787 Ga0070681_105567871 292
144 3300005545 Ga0070695_100123283 Ga0070695_1001232832 292
145 3300006038 Ga0075365_10104812 Ga0075365_101048122 292
146 3300006048 Ga0075363_100259100 Ga0075363_1002591002 292
147 3300009094 Ga0111539_10099899 Ga0111539_100998992 292
148 3300009098 Ga0105245_10434696 Ga0105245_104346962 292
149 3300009147 Ga0114129_10109559 Ga0114129_101095592 292
150 3300009147 Ga0114129_10155550 Ga0114129_101555503 292
151 3300009553 Ga0105249_10098356 Ga0105249_100983562 292
152 3300013306 Ga0163162_10595811 Ga0163162_105958112 292
153 3300025912 Ga0207707_10492923 Ga0207707_104929231 292
154 3300025917 Ga0207660_10362106 Ga0207660_103621062 292
155 3300025921 Ga0207652_10069180 Ga0207652_100691802 292
156 3300026075 Ga0207708_10134072 Ga0207708_101340722 292
157 3300026075 Ga0207708_10306767 Ga0207708_103067671 292
158 3300028380 Ga0268265_10560970 Ga0268265_105609701 292
159 3300038443 Ga0395901_0145432 Ga0395901_0145432_704_1636 292
160 3300044693 Ga0466961_0036203 Ga0466961_0036203_2057_2941 292
161 3300045976 Ga0466967_0101714 Ga0466967_0101714_910_1788 292
162 3300046524 Ga0495648_0014067 Ga0495648_0014067_4651_5688 292
163 3300048903 Ga0496100_0468446 Ga0496100_0468446_34_912 292
164 3300048914 Ga0496111_0061865 Ga0496111_0061865_1700_2590 292
165 3300049586 Ga0501070_0122585 Ga0501070_0122585_163_1053 292
166 3300049588 Ga0501072_0030195 Ga0501072_0030195_2259_3149 292
167 3300049589 Ga0501073_0031481 Ga0501073_0031481_1367_2257 292
168 3300049590 Ga0501074_0018519 Ga0501074_0018519_2186_3076 292
169 3300049741 Ga0501079_0076182 Ga0501079_0076182_1414_2304 292
170 3300049742 Ga0501080_0123963 Ga0501080_0123963_710_1600 292
171 3300053104 Ga0500556_0000226 Ga0500556_0000226_14156_15055 292
172 3300053153 Ga0500616_0001741 Ga0500616_0001741_9589_10488 292
173 iso_pu_bacteria 2506783011 2506865412 292
174 iso_pu_bacteria 2527291627 2528206601 292
175 iso_pu_bacteria 2527291629 2528215627 292
176 iso_pu_bacteria 2546825537 2546950834 292
177 iso_pu_bacteria 2576861822 2579749381 292
178 iso_pu_bacteria 2684623036 2686543995 292
179 iso_pu_bacteria 2687453743 2689995375 292
180 iso_pu_bacteria 2710264753 2710604749 292
181 iso_pu_bacteria 2773857924 2774866892 292
182 iso_pu_bacteria 2773857933 2774901261 292
183 iso_pu_bacteria 637000116 637881148 292
184 iso_pu_bacteria 8054913762 8054918313 292
185 iso_pu_bacteria 8055157932 8055162480 292
186 3300005329 Ga0070683_100103613 Ga0070683_1001036132 293
187 3300005455 Ga0070663_100145019 Ga0070663_1001450192 293
188 3300005577 Ga0068857_100573532 Ga0068857_1005735322 293
189 3300005616 Ga0068852_100079862 Ga0068852_1000798623 293
190 3300014325 Ga0163163_10339866 Ga0163163_103398661 293
191 3300026078 Ga0207702_10202652 Ga0207702_102026523 293
192 3300026095 Ga0207676_10196318 Ga0207676_101963182 293
193 3300026142 Ga0207698_10065420 Ga0207698_100654202 293
194 3300035171 Ga0373946_0023609 Ga0373946_0023609_407_1300 293
195 3300035725 Ga0373947_0085793 Ga0373947_0085793_274_1167 293
196 3300046455 Ga0495603_0024306 Ga0495603_0024306_588_1481 293
197 3300046473 Ga0495582_0273161 Ga0495582_0273161_63_956 293
198 3300048907 Ga0496104_0012421 Ga0496104_0012421_5897_6835 293
199 3300048909 Ga0496106_0195428 Ga0496106_0195428_447_1385 293
200 3300048911 Ga0496108_0015537 Ga0496108_0015537_3264_4202 293
201 3300048913 Ga0496110_0000310 Ga0496110_0000310_695_1633 293
202 3300048914 Ga0496111_0009371 Ga0496111_0009371_3511_4449 293
203 3300048915 Ga0496112_0007994 Ga0496112_0007994_6420_7346 293
204 3300048915 Ga0496112_0017900 Ga0496112_0017900_5312_6250 293
205 3300048916 Ga0496113_0040937 Ga0496113_0040937_783_1721 293
206 3300048917 Ga0496114_0098423 Ga0496114_0098423_1367_2305 293

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19279

YegS_C

YegS C-terminal NAD kinase beta sandwich-like domain

192

350

0.97

PF00781

DAGK_cat

Diacylglycerol kinase catalytic domain

64

185

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3s40-assembly5.cif.gz_D the crystal structure of a diacylglycerol kinases from bacillus anthracis str. sterne 0.8768 3 291
3s40-assembly5.cif.gz_A the crystal structure of a diacylglycerol kinases from bacillus anthracis str. sterne 0.8683 3 291
3t5p-assembly1.cif.gz_H crystal structure of a putative diacylglycerol kinase from bacillus anthracis str. sterne 0.8673 3 291
3t5p-assembly1.cif.gz_F crystal structure of a putative diacylglycerol kinase from bacillus anthracis str. sterne 0.8658 3 291
2jgr-assembly1.cif.gz_A crystal structure of yegs in complex with adp 0.8657 4 292
ID Description Score Start End Superfamily
af_P9WP29_144_297_2.60.200.40 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.9572 134 283 2.60.200.40
af_P9WP29_144_297_2.60.200.40 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.9271 134 283 2.60.200.40
af_Q2FWZ2_3_120_3.40.50.10330 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Probable inorganic polyphosphate/atp-NAD kinase; domain 1 0.9059 4 118 3.40.50.10330
af_Q10SE4_189_349_2.60.200.40 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.8997 132 284 2.60.200.40
af_Q2FWZ2_3_120_3.40.50.10330 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Probable inorganic polyphosphate/atp-NAD kinase; domain 1 0.8778 4 118 3.40.50.10330
ID Description Score Start End GO Terms
AF-A0A538CDI0-F1-model_v4 Diacylglycerol kinase family lipid kinase 0.9888 6 292 GO:0005524
GO:0005886
GO:0008654
GO:0016301
AF-A0A538CDI0-F1-model_v4 Diacylglycerol kinase family lipid kinase 0.982 6 292 GO:0005524
GO:0005886
GO:0008654
GO:0016301
AF-A0A0S8H1Y2-F1-model_v4 YegS/DAGK C-terminal domain-containing protein 0.9744 165 284
AF-A0A1F9LD76-F1-model_v4 YegS/DAGK C-terminal domain-containing protein 0.9712 177 284 GO:0004143
GO:0005886
AF-A0A3N1D6F6-F1-model_v4 YegS/Rv2252/BmrU family lipid kinase 0.9708 4 292 GO:0005524
GO:0005886
GO:0016301

Feature Viewer

pLDDT pTM Quality
93.91 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map