F315687

General Info

Members Datasets Scaffolds Average Seq Length
206 155 412 185

Family's Representative Sequence

Representative Sequence 3300049579|Ga0501043_0144774|Ga0501043_0144774_551_1186
Length 211
Sequence MSGGEAGLMAQSTDAGGARPFFTIGHSNRTAEAFVSLLRQAGVDMLVDVRKMPRSRSNPQFNGDVLAAALGERQIGYRHIAALGGLRGRAPAVPISPNTLWRNRSFRNYADYALTDAFREGLAELLRLGQARTCAIMCAEALWWRCHRRIITDYLLNAGADVFHILGPNAVTRAVQTPGALSTPDGLVYAGAPGPAERQGRISASPTHQIE

Samples

Sample ID Description Type Environment
1 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
2 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
3 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
9 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
17 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
18 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
19 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
20 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
21 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
22 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
23 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
24 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
25 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
29 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
30 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
31 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
40 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
41 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
42 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
43 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
44 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
72 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
73 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
74 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
75 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
78 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
79 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
80 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
81 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
82 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
83 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
84 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
85 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
86 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
87 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
88 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
89 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
90 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
91 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
92 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
93 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
94 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
96 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
97 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
98 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
99 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
100 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
101 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
102 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
103 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
104 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
105 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
106 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
107 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
108 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
109 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
110 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
111 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
112 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
113 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
114 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
115 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
116 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
117 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
118 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
119 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
120 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
121 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
122 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
123 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
124 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
125 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
126 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
127 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
128 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
129 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
130 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
131 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
132 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
133 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
134 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
135 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
136 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
137 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
141 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
142 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
143 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
144 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
145 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
146 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
147 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
148 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
149 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
150 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
151 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
152 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
153 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
154 2928963466 Dyella japonica 1073 Isolate Unclassified
155 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.12
Metatranscriptomes 0
Isolates 3.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.91
Nodule 3.4
Rhizoplane 16.02
Rhizosphere 72.33
Stem 0
Stem Tuber 0
Unclassified 2.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501043_0144774 3300049579 Unclassified 1861
2 Ga0055542_1001084 3300003762 Bacteria 16594
3 Ga0055529_1001582 3300003763 Bacteria 6290
4 Ga0070658_10113435 3300005327 Bacteria 2247
5 Ga0070680_100220635 3300005336 Bacteria 1600
6 Ga0070660_100135819 3300005339 Bacteria 1970
7 Ga0070659_100002577 3300005366 Bacteria 12877
8 Ga0070663_100386875 3300005455 Bacteria 1140
9 Ga0070662_100059752 3300005457 Bacteria 2778
10 Ga0070681_10051213 3300005458 Bacteria 4119
11 Ga0070681_10155683 3300005458 Bacteria 2210
12 Ga0070707_100024013 3300005468 Bacteria 5769
13 Ga0070679_100054147 3300005530 Bacteria 3994
14 Ga0070679_100134646 3300005530 Bacteria 2452
15 Ga0068853_100004861 3300005539 Bacteria 10443
16 Ga0068853_100376658 3300005539 Bacteria 1325
17 Ga0068853_100500654 3300005539 Bacteria 1147
18 Ga0068853_100726238 3300005539 Bacteria 948
19 Ga0070696_100989146 3300005546 Bacteria 702
20 Ga0068855_100040613 3300005563 Bacteria 5521
21 Ga0068864_100293036 3300005618 Bacteria 1521
22 Ga0068861_100821855 3300005719 Bacteria 874
23 Ga0068870_10312431 3300005840 Bacteria 996
24 Ga0068863_100905551 3300005841 Bacteria 882
25 Ga0068860_100199635 3300005843 Bacteria 1938
26 Ga0070712_100045398 3300006175 Bacteria 3034
27 Ga0075433_10142443 3300006852 Bacteria 2131
28 Ga0075434_100020422 3300006871 Bacteria 6426
29 Ga0075434_100577268 3300006871 Bacteria 1144
30 Ga0099824_1031258 3300006942 Bacteria 2039
31 Ga0075435_100118276 3300007076 Bacteria 2209
32 Ga0105240_10042528 3300009093 Bacteria 5789
33 Ga0105240_10067226 3300009093 Bacteria 4442
34 Ga0111539_10007553 3300009094 Bacteria 13898
35 Ga0105247_10042156 3300009101 Bacteria 2794
36 Ga0105247_10188880 3300009101 Bacteria 1378
37 Ga0105241_10023182 3300009174 Bacteria 4601
38 Ga0105241_10029241 3300009174 Bacteria 4110
39 Ga0105241_11256389 3300009174 Bacteria 703
40 Ga0105242_11279673 3300009176 Bacteria 756
41 Ga0105248_10247005 3300009177 Bacteria 2009
42 Ga0105237_10404539 3300009545 Bacteria 1370
43 Ga0105238_10000100 3300009551 Bacteria 97757
44 Ga0105238_11517737 3300009551 Bacteria 699
45 Ga0105249_10813288 3300009553 Bacteria 999
46 Ga0105239_10237083 3300010375 Bacteria 2048
47 Ga0105239_10401049 3300010375 Bacteria 1552
48 Ga0105239_11750750 3300010375 Bacteria 720
49 Ga0157369_10216156 3300013105 Bacteria 2008
50 Ga0163162_10041118 3300013306 Bacteria 4624
51 Ga0163162_10475499 3300013306 Bacteria 1381
52 Ga0157372_11012042 3300013307 Bacteria 962
53 Ga0157375_10018208 3300013308 Bacteria 6366
54 Ga0157375_10640376 3300013308 Bacteria 1220
55 Ga0163163_10010538 3300014325 Bacteria 8319
56 Ga0163163_10210583 3300014325 Bacteria 1993
57 Ga0157379_10090738 3300014968 Bacteria 2741
58 Ga0157379_10318742 3300014968 Bacteria 1419
59 Ga0213874_10079480 3300021377 Bacteria 1060
60 Ga0213871_10017245 3300021441 Bacteria 1752
61 Ga0209148_1000126 3300025254 Bacteria 181590
62 Ga0209455_1000105 3300025272 Bacteria 199725
63 Ga0207713_1031626 3300025735 Bacteria 2336
64 Ga0207710_10140278 3300025900 Bacteria 1166
65 Ga0207647_10531764 3300025904 Bacteria 653
66 Ga0207643_10261829 3300025908 Bacteria 1068
67 Ga0207705_10034887 3300025909 Bacteria 3598
68 Ga0207654_10456366 3300025911 Bacteria 897
69 Ga0207707_10134536 3300025912 Bacteria 2162
70 Ga0207707_10239909 3300025912 Bacteria 1576
71 Ga0207695_10074860 3300025913 Unclassified 3446
72 Ga0207695_10128104 3300025913 Bacteria 2498
73 Ga0207671_10012159 3300025914 Bacteria 6944
74 Ga0207693_10009917 3300025915 Bacteria 7744
75 Ga0207693_10157971 3300025915 Bacteria 1784
76 Ga0207660_10011983 3300025917 Bacteria 5661
77 Ga0207657_10000722 3300025919 Bacteria 35100
78 Ga0207652_10004499 3300025921 Bacteria 11325
79 Ga0207646_10317520 3300025922 Bacteria 1408
80 Ga0207681_10368379 3300025923 Bacteria 1154
81 Ga0207694_10000817 3300025924 Bacteria 27808
82 Ga0207690_10658868 3300025932 Bacteria 858
83 Ga0207706_10031054 3300025933 Bacteria 4761
84 Ga0207706_10047416 3300025933 Bacteria 3801
85 Ga0207711_10033390 3300025941 Bacteria 4354
86 Ga0207667_10005260 3300025949 Bacteria 15788
87 Ga0207712_10501596 3300025961 Bacteria 1037
88 Ga0207639_10005409 3300026041 Bacteria 8633
89 Ga0207639_10015088 3300026041 Bacteria 5442
90 Ga0207678_10020147 3300026067 Bacteria 5857
91 Ga0207678_10898489 3300026067 Bacteria 783
92 Ga0207676_10262338 3300026095 Bacteria 1560
93 Ga0207698_11184414 3300026142 Bacteria 778
94 Ga0209389_1000027 3300027296 Bacteria 146917
95 Ga0209589_1000031 3300027357 Bacteria 147054
96 Ga0209489_100057 3300027361 Bacteria 147398
97 Ga0207428_10002151 3300027907 Bacteria 19792
98 Ga0268265_10192885 3300028380 Bacteria 1761
99 Ga0268264_10312624 3300028381 Bacteria 1483
100 Ga0265325_10082312 3300031241 Bacteria 1598
101 Ga0265340_10025441 3300031247 Bacteria 2997
102 Ga0265339_10054697 3300031249 Bacteria 2167
103 Ga0265331_10039509 3300031250 Bacteria 2301
104 Ga0265331_10300227 3300031250 Bacteria 719
105 Ga0265316_10256342 3300031344 Bacteria 1283
106 Ga0307408_100136358 3300031548 Bacteria 1921
107 Ga0265314_10155280 3300031711 Bacteria 1398
108 Ga0265342_10002569 3300031712 Bacteria 15570
109 Ga0307405_10478366 3300031731 Bacteria 994
110 Ga0307409_100070551 3300031995 Bacteria 2774
111 Ga0307416_101029525 3300032002 Bacteria 927
112 Ga0307414_10350055 3300032004 Bacteria 1268
113 Ga0307411_10153957 3300032005 Bacteria 1712
114 Ga0373943_0201406 3300035170 Bacteria 1102
115 Ga0373946_0014722 3300035171 Bacteria 2955
116 Ga0373931_0309471 3300035691 Bacteria 978
117 Ga0373927_0049285 3300035695 Bacteria 2724
118 Ga0373925_0015841 3300037068 Bacteria 5454
119 Ga0395900_0061271 3300037418 Bacteria 3869
120 Ga0395900_0100985 3300037418 Bacteria 2963
121 Ga0395898_0390979 3300037466 Bacteria 1326
122 Ga0395905_0096910 3300037471 Bacteria 2769
123 Ga0395901_0160760 3300038443 Bacteria 2359
124 Ga0395901_0679543 3300038443 Bacteria 1029
125 Ga0436360_0865099 3300039438 Bacteria 6303
126 Ga0436361_0217767 3300039447 Unclassified 1100
127 Ga0436361_0522974 3300039447 Bacteria 3090
128 Ga0436363_0354311 3300039450 Bacteria 2173
129 Ga0436362_0438267 3300039453 Unclassified 2403
130 Ga0436362_1156166 3300039453 Bacteria 780
131 Ga0451577_0020330 3300042876 Bacteria 6094
132 Ga0466972_0072174 3300044658 Bacteria 1646
133 Ga0466966_0000474 3300044684 Bacteria 25834
134 Ga0466961_0000023 3300044693 Bacteria 97134
135 Ga0466961_0001065 3300044693 Bacteria 16911
136 Ga0453684_0018602 3300044712 Bacteria 10651
137 Ga0466959_0000726 3300045049 Bacteria 19220
138 Ga0451576_0020221 3300045051 Bacteria 7250
139 Ga0466958_0027457 3300045836 Bacteria 3369
140 Ga0466967_0312074 3300045976 Bacteria 1515
141 Ga0466967_0486263 3300045976 Bacteria 1210
142 Ga0495629_0263599 3300046459 Bacteria 1184
143 Ga0495662_0061354 3300046476 Unclassified 1816
144 Ga0495640_0003260 3300046533 Bacteria 13053
145 Ga0495613_0360668 3300046689 Bacteria 997
146 Ga0495624_0311697 3300046690 Bacteria 948
147 Ga0495624_0427964 3300046690 Bacteria 794
148 Ga0495674_0022267 3300047319 Bacteria 5844
149 Ga0496100_0383123 3300048903 Bacteria 1068
150 Ga0496101_0265653 3300048904 Bacteria 1339
151 Ga0496102_0006497 3300048905 Bacteria 9971
152 Ga0496102_0078819 3300048905 Bacteria 3033
153 Ga0496102_0206646 3300048905 Bacteria 1851
154 Ga0496103_0032141 3300048906 Bacteria 3202
155 Ga0496103_0262711 3300048906 Bacteria 1111
156 Ga0496104_0009905 3300048907 Bacteria 8509
157 Ga0496104_0136773 3300048907 Bacteria 2354
158 Ga0496104_0926663 3300048907 Bacteria 776
159 Ga0496105_0012361 3300048908 Bacteria 6759
160 Ga0496105_0070225 3300048908 Bacteria 2895
161 Ga0496106_0038152 3300048909 Bacteria 3595
162 Ga0496106_0065029 3300048909 Bacteria 2776
163 Ga0496106_0494343 3300048909 Bacteria 983
164 Ga0496107_0138116 3300048910 Bacteria 1801
165 Ga0496107_0560917 3300048910 Bacteria 845
166 Ga0496107_0868645 3300048910 Bacteria 658
167 Ga0496108_0082456 3300048911 Bacteria 2727
168 Ga0496108_0100385 3300048911 Bacteria 2468
169 Ga0496109_0155441 3300048912 Bacteria 2142
170 Ga0496109_0386050 3300048912 Bacteria 1323
171 Ga0496110_0060451 3300048913 Bacteria 3342
172 Ga0496110_0105350 3300048913 Bacteria 2530
173 Ga0496111_0086919 3300048914 Bacteria 2288
174 Ga0496112_0121273 3300048915 Bacteria 2584
175 Ga0496112_0132167 3300048915 Bacteria 2467
176 Ga0496112_0455321 3300048915 Bacteria 1217
177 Ga0496112_0666707 3300048915 Bacteria 969
178 Ga0496113_0060585 3300048916 Bacteria 2854
179 Ga0496113_0277529 3300048916 Bacteria 1340
180 Ga0496114_0023062 3300048917 Bacteria 5074
181 Ga0496114_0215192 3300048917 Bacteria 1686
182 Ga0496117_0089045 3300048920 Bacteria 1995
183 Ga0496122_0228885 3300048925 Bacteria 1059
184 Ga0496124_0473960 3300048927 Bacteria 847
185 Ga0496126_0069215 3300048929 Bacteria 3149
186 Ga0501034_0869745 3300049571 Bacteria 791
187 Ga0501037_0209801 3300049573 Bacteria 1374
188 Ga0501046_0410589 3300049580 Archaea 977
189 Ga0501046_0814841 3300049580 Bacteria 654
190 Ga0501044_0047243 3300049823 Bacteria 4453
191 nmdc:mga07m45_403454_c1 3300050496 Bacteria 793
192 nmdc:mga08y16_113120_c1 3300050511 Bacteria 2826
193 nmdc:mga0n895_10097_c1 3300050512 Bacteria 8312
194 nmdc:mga0n895_52809_c1 3300050512 Bacteria 3991
195 nmdc:mga0rr50_1227809_c1 3300050513 Bacteria 636
196 nmdc:mga0a205_8519_c1 3300050515 Bacteria 9325
197 Ga0495601_0192267 3300053077 Unclassified 1334
198 Ga0500619_025932 3300053154 Bacteria 1741
199 2516021441 2515154189 Bacteria 9629850
200 2824778264 2824773399 Bacteria 8360218
201 2876382755 2876377896 Bacteria 6565995
202 2876767647 2876761206 Bacteria 10111113
203 2881669290 2881665667 Bacteria 8175609
204 2883095809 2883087390 Bacteria 9532701
205 2928964991 2928963466 Bacteria 5165703
206 2938016965 2938014810 Bacteria 6700592
207 Ga0501043_0144774
208 Ga0055542_1001084
209 Ga0055529_1001582
210 Ga0070658_10113435
211 Ga0070680_100220635
212 Ga0070660_100135819
213 Ga0070659_100002577
214 Ga0070663_100386875
215 Ga0070662_100059752
216 Ga0070681_10051213
217 Ga0070681_10155683
218 Ga0070707_100024013
219 Ga0070679_100054147
220 Ga0070679_100134646
221 Ga0068853_100004861
222 Ga0068853_100376658
223 Ga0068853_100500654
224 Ga0068853_100726238
225 Ga0070696_100989146
226 Ga0068855_100040613
227 Ga0068864_100293036
228 Ga0068861_100821855
229 Ga0068870_10312431
230 Ga0068863_100905551
231 Ga0068860_100199635
232 Ga0070712_100045398
233 Ga0075433_10142443
234 Ga0075434_100020422
235 Ga0075434_100577268
236 Ga0099824_1031258
237 Ga0075435_100118276
238 Ga0105240_10042528
239 Ga0105240_10067226
240 Ga0111539_10007553
241 Ga0105247_10042156
242 Ga0105247_10188880
243 Ga0105241_10023182
244 Ga0105241_10029241
245 Ga0105241_11256389
246 Ga0105242_11279673
247 Ga0105248_10247005
248 Ga0105237_10404539
249 Ga0105238_10000100
250 Ga0105238_11517737
251 Ga0105249_10813288
252 Ga0105239_10237083
253 Ga0105239_10401049
254 Ga0105239_11750750
255 Ga0157369_10216156
256 Ga0163162_10041118
257 Ga0163162_10475499
258 Ga0157372_11012042
259 Ga0157375_10018208
260 Ga0157375_10640376
261 Ga0163163_10010538
262 Ga0163163_10210583
263 Ga0157379_10090738
264 Ga0157379_10318742
265 Ga0213874_10079480
266 Ga0213871_10017245
267 Ga0209148_1000126
268 Ga0209455_1000105
269 Ga0207713_1031626
270 Ga0207710_10140278
271 Ga0207647_10531764
272 Ga0207643_10261829
273 Ga0207705_10034887
274 Ga0207654_10456366
275 Ga0207707_10134536
276 Ga0207707_10239909
277 Ga0207695_10074860
278 Ga0207695_10128104
279 Ga0207671_10012159
280 Ga0207693_10009917
281 Ga0207693_10157971
282 Ga0207660_10011983
283 Ga0207657_10000722
284 Ga0207652_10004499
285 Ga0207646_10317520
286 Ga0207681_10368379
287 Ga0207694_10000817
288 Ga0207690_10658868
289 Ga0207706_10031054
290 Ga0207706_10047416
291 Ga0207711_10033390
292 Ga0207667_10005260
293 Ga0207712_10501596
294 Ga0207639_10005409
295 Ga0207639_10015088
296 Ga0207678_10020147
297 Ga0207678_10898489
298 Ga0207676_10262338
299 Ga0207698_11184414
300 Ga0209389_1000027
301 Ga0209589_1000031
302 Ga0209489_100057
303 Ga0207428_10002151
304 Ga0268265_10192885
305 Ga0268264_10312624
306 Ga0265325_10082312
307 Ga0265340_10025441
308 Ga0265339_10054697
309 Ga0265331_10039509
310 Ga0265331_10300227
311 Ga0265316_10256342
312 Ga0307408_100136358
313 Ga0265314_10155280
314 Ga0265342_10002569
315 Ga0307405_10478366
316 Ga0307409_100070551
317 Ga0307416_101029525
318 Ga0307414_10350055
319 Ga0307411_10153957
320 Ga0373943_0201406
321 Ga0373946_0014722
322 Ga0373931_0309471
323 Ga0373927_0049285
324 Ga0373925_0015841
325 Ga0395900_0061271
326 Ga0395900_0100985
327 Ga0395898_0390979
328 Ga0395905_0096910
329 Ga0395901_0160760
330 Ga0395901_0679543
331 Ga0436360_0865099
332 Ga0436361_0217767
333 Ga0436361_0522974
334 Ga0436363_0354311
335 Ga0436362_0438267
336 Ga0436362_1156166
337 Ga0451577_0020330
338 Ga0466972_0072174
339 Ga0466966_0000474
340 Ga0466961_0000023
341 Ga0466961_0001065
342 Ga0453684_0018602
343 Ga0466959_0000726
344 Ga0451576_0020221
345 Ga0466958_0027457
346 Ga0466967_0312074
347 Ga0466967_0486263
348 Ga0495629_0263599
349 Ga0495662_0061354
350 Ga0495640_0003260
351 Ga0495613_0360668
352 Ga0495624_0311697
353 Ga0495624_0427964
354 Ga0495674_0022267
355 Ga0496100_0383123
356 Ga0496101_0265653
357 Ga0496102_0006497
358 Ga0496102_0078819
359 Ga0496102_0206646
360 Ga0496103_0032141
361 Ga0496103_0262711
362 Ga0496104_0009905
363 Ga0496104_0136773
364 Ga0496104_0926663
365 Ga0496105_0012361
366 Ga0496105_0070225
367 Ga0496106_0038152
368 Ga0496106_0065029
369 Ga0496106_0494343
370 Ga0496107_0138116
371 Ga0496107_0560917
372 Ga0496107_0868645
373 Ga0496108_0082456
374 Ga0496108_0100385
375 Ga0496109_0155441
376 Ga0496109_0386050
377 Ga0496110_0060451
378 Ga0496110_0105350
379 Ga0496111_0086919
380 Ga0496112_0121273
381 Ga0496112_0132167
382 Ga0496112_0455321
383 Ga0496112_0666707
384 Ga0496113_0060585
385 Ga0496113_0277529
386 Ga0496114_0023062
387 Ga0496114_0215192
388 Ga0496117_0089045
389 Ga0496122_0228885
390 Ga0496124_0473960
391 Ga0496126_0069215
392 Ga0501034_0869745
393 Ga0501037_0209801
394 Ga0501046_0410589
395 Ga0501046_0814841
396 Ga0501044_0047243
397 nmdc:mga07m45_403454_c1
398 nmdc:mga08y16_113120_c1
399 nmdc:mga0n895_10097_c1
400 nmdc:mga0n895_52809_c1
401 nmdc:mga0rr50_1227809_c1
402 nmdc:mga0a205_8519_c1
403 Ga0495601_0192267
404 Ga0500619_025932
405 2516021441
406 2824778264
407 2876382755
408 2876767647
409 2881669290
410 2883095809
411 2928964991
412 2938016965

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04343

DUF488

Domain of unknown function DUF488

30

155

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2i6o-assembly1.cif.gz_A crystal structure of the complex of the archaeal sulfolobus ptp-fold phosphatase with phosphopeptides n-g-(p)y-k-n 0.6587 2 143
2i6i-assembly1.cif.gz_A crystal structures of the archaeal sulfolobus ptp-fold phosphatase 0.6546 2 122
2f46-assembly2.cif.gz_B crystal structure of a putative phosphatase (nma1982) from neisseria meningitidis z2491 at 1.41 a resolution 0.6138 6 143
3ndc-assembly1.cif.gz_A crystal structure of precorrin-4 c11-methyltransferase from rhodobacter capsulatus 0.6091 1 160
3ndc-assembly1.cif.gz_B crystal structure of precorrin-4 c11-methyltransferase from rhodobacter capsulatus 0.604 5 160
ID Description Score Start End Superfamily
af_Q2G0A6_1_127_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7625 13 64 3.40.50.620
af_A0A1D8PFT4_9_162_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.6464 7 143 3.90.190.10
2dxpA00 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.6425 2 121 3.90.190.10
af_Q7EYM9_283_443_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.6366 14 123 3.90.190.10
2po3B01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.6279 11 63 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A3S2BV39-F1-model_v4 DUF488 domain-containing protein 1.001 1 148
AF-A0A0D5IU81-F1-model_v4 deleted 0.9963 3 178
AF-A0A530YFJ8-F1-model_v4 DUF488 domain-containing protein 0.996 1 181
AF-A0A837X7D6-F1-model_v4 deleted 0.9948 1 178
AF-A0A853QY02-F1-model_v4 deleted 0.9941 1 178

Map