F315495

General Info

Members Datasets Scaffolds Average Seq Length
206 150 201 236

Family's Representative Sequence

Representative Sequence 3300046453|Ga0495627_008353|Ga0495627_008353_1019_1891
Length 274
Sequence VRLSVASFQTHFSKQRAQARIQELQMSMLKIAKFLTVAFSAAVVTPGIVLVHGGFVDGSGWEGVYKILKKDGYDVTIVQNPTLSLADDVAVTKRAIAAQKGPVVLVGHSYGGVVVTEAGNDEKVAGLVYIAAFAPDKGESVDSLIKNPPPGAPVPPILPPQDGFLMLDKAKFAASFAADVKPETAAFMAHSQVPWGVAALSGAVSEPAWKSKPSWYLVAKDDKMIPPPVQRNMSKRAGAVVTEVPGSHAVYVSNPKAVAAVIERAAGKVAVAGN

Samples

Sample ID Description Type Environment
1 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
2 2643221723 Ensifer sp. Root278 Isolate Unclassified
3 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
4 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
9 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
10 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
11 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
12 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
57 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
69 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
70 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
72 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
76 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
106 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
107 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
108 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
109 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
110 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
111 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
112 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
113 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
114 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
115 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
116 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
117 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
118 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
119 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
120 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
121 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
122 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
123 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
124 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
125 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
126 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
127 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
128 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
129 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
130 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
131 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
132 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
133 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
134 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
135 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
136 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
137 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
138 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
139 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
140 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
141 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
142 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
143 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
144 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
145 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
146 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
147 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
148 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
149 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
150 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.57
Metatranscriptomes 0
Isolates 2.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.17
Nodule 0.49
Rhizoplane 1.94
Rhizosphere 81.55
Stem 0
Stem Tuber 0
Unclassified 4.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1000015 3300002987 Bacteria 142431
2 JGI25151J46595_10011614 3300003187 Bacteria 4042
3 JGI25160J50197_1000003 3300003354 Bacteria 482719
4 JGI25161J50226_1000741 3300003374 Bacteria 12537
5 Ga0055536_1001123 3300003781 Bacteria 16800
6 Ga0055530_10004321 3300003791 Bacteria 7390
7 Ga0055540_1014995 3300003792 Bacteria 2280
8 Ga0055543_1000034 3300004625 Bacteria 128668
9 Ga0065165_1000025 3300005262 Bacteria 246909
10 Ga0065715_10257674 3300005293 Bacteria 1147
11 Ga0070666_10169731 3300005335 Bacteria 1527
12 Ga0068868_100038731 3300005338 Bacteria 3701
13 Ga0068868_100445158 3300005338 Bacteria 1126
14 Ga0068868_100658220 3300005338 Bacteria 933
15 Ga0070668_100253616 3300005347 Bacteria 1461
16 Ga0070668_100272921 3300005347 Bacteria 1410
17 Ga0070668_100296205 3300005347 Bacteria 1355
18 Ga0070669_100133544 3300005353 Bacteria 1907
19 Ga0070671_100040830 3300005355 Bacteria 3855
20 Ga0070673_100226085 3300005364 Bacteria 1622
21 Ga0070673_100717517 3300005364 Bacteria 919
22 Ga0070667_100017667 3300005367 Bacteria 5910
23 Ga0070667_100027210 3300005367 Bacteria 4758
24 Ga0070713_100265260 3300005436 Bacteria 1571
25 Ga0070713_100325319 3300005436 Bacteria 1421
26 Ga0070705_100098877 3300005440 Bacteria 1837
27 Ga0070708_100050358 3300005445 Bacteria 3687
28 Ga0070708_100368062 3300005445 Bacteria 1355
29 Ga0070678_100039949 3300005456 Bacteria 3316
30 Ga0070678_100677237 3300005456 Bacteria 927
31 Ga0070706_100042456 3300005467 Bacteria 4201
32 Ga0070706_100076657 3300005467 Bacteria 3094
33 Ga0070707_100044874 3300005468 Bacteria 4232
34 Ga0070707_100346170 3300005468 Bacteria 1444
35 Ga0070698_100041201 3300005471 Unclassified 4742
36 Ga0070698_100230855 3300005471 Bacteria 1783
37 Ga0070699_100018891 3300005518 Bacteria 5925
38 Ga0070699_100061222 3300005518 Bacteria 3263
39 Ga0070699_100066258 3300005518 Bacteria 3135
40 Ga0070699_100214270 3300005518 Bacteria 1715
41 Ga0070699_100629433 3300005518 Bacteria 979
42 Ga0070684_100123217 3300005535 Bacteria 2333
43 Ga0070697_100079464 3300005536 Bacteria 2700
44 Ga0070697_100123256 3300005536 Bacteria 2169
45 Ga0070697_100341284 3300005536 Bacteria 1292
46 Ga0070697_100376201 3300005536 Bacteria 1230
47 Ga0070672_100020065 3300005543 Bacteria 4868
48 Ga0070696_100361193 3300005546 Bacteria 1127
49 Ga0070693_100210754 3300005547 Unclassified 1268
50 Ga0070665_100256555 3300005548 Bacteria 1749
51 Ga0068857_100182452 3300005577 Bacteria 1910
52 Ga0070702_100189467 3300005615 Bacteria 1352
53 Ga0068859_100215084 3300005617 Bacteria 2009
54 Ga0068864_100687338 3300005618 Bacteria 999
55 Ga0068866_10078558 3300005718 Bacteria 1766
56 Ga0068866_10349631 3300005718 Bacteria 939
57 Ga0068862_100037495 3300005844 Bacteria 4108
58 Ga0081455_10237700 3300005937 Bacteria 1340
59 Ga0081540_1000416 3300005983 Bacteria 42012
60 Ga0070717_10300701 3300006028 Bacteria 1426
61 Ga0070717_10480599 3300006028 Bacteria 1122
62 Ga0070715_10098755 3300006163 Unclassified 1358
63 Ga0070712_100009035 3300006175 Bacteria 6277
64 Ga0070712_100587089 3300006175 Bacteria 942
65 Ga0097621_100339301 3300006237 Bacteria 1334
66 Ga0097621_100424962 3300006237 Bacteria 1193
67 Ga0068871_100092970 3300006358 Bacteria 2516
68 Ga0068871_100311289 3300006358 Bacteria 1384
69 Ga0075428_100047759 3300006844 Bacteria 4700
70 Ga0075428_100090422 3300006844 Unclassified 3339
71 Ga0075431_100178420 3300006847 Bacteria 2180
72 Ga0075431_100297572 3300006847 Bacteria 1631
73 Ga0075433_10018439 3300006852 Bacteria 5801
74 Ga0075434_100063450 3300006871 Bacteria 3677
75 Ga0075434_100065014 3300006871 Bacteria 3633
76 Ga0075434_100169915 3300006871 Bacteria 2200
77 Ga0075434_100405057 3300006871 Bacteria 1385
78 Ga0075429_100253927 3300006880 Bacteria 1540
79 Ga0097620_100215078 3300006931 Bacteria 2009
80 Ga0075435_100189826 3300007076 Bacteria 1739
81 Ga0075435_100360682 3300007076 Bacteria 1247
82 Ga0075435_100880334 3300007076 Bacteria 781
83 Ga0099794_10001779 3300007265 Bacteria 7680
84 Ga0099794_10021124 3300007265 Bacteria 2955
85 Ga0099794_10052173 3300007265 Bacteria 1971
86 Ga0099794_10066596 3300007265 Bacteria 1758
87 Ga0099795_10065167 3300007788 Bacteria 1362
88 Ga0111539_10042103 3300009094 Bacteria 5487
89 Ga0111539_10494438 3300009094 Bacteria 1425
90 Ga0114129_10004894 3300009147 Bacteria 18905
91 Ga0114129_10075263 3300009147 Unclassified 4701
92 Ga0114129_10490076 3300009147 Bacteria 1607
93 Ga0105243_10072280 3300009148 Bacteria 2792
94 Ga0105248_10243539 3300009177 Bacteria 2024
95 Ga0099796_10158260 3300010159 Bacteria 896
96 Ga0105239_10312036 3300010375 Bacteria 1773
97 Ga0105246_10051113 3300011119 Unclassified 2837
98 Ga0105246_10271362 3300011119 Bacteria 1356
99 Ga0157375_10010348 3300013308 Bacteria 8212
100 Ga0157375_10549783 3300013308 Bacteria 1316
101 Ga0157380_10244276 3300014326 Bacteria 1621
102 Ga0157380_10966860 3300014326 Bacteria 883
103 Ga0157376_10096989 3300014969 Bacteria 2567
104 Ga0209436_100130 3300025208 Bacteria 37375
105 Ga0209130_1000005 3300025284 Bacteria 599620
106 Ga0209676_1001927 3300025292 Bacteria 16772
107 Ga0209025_1000105 3300025294 Bacteria 224157
108 Ga0209564_1000113 3300025295 Bacteria 211564
109 Ga0209050_1005247 3300025298 Bacteria 8259
110 Ga0209256_1003107 3300025299 Bacteria 12151
111 Ga0207426_1000015 3300025302 Bacteria 599316
112 Ga0209051_1001056 3300025303 Bacteria 25758
113 Ga0209257_1001948 3300025304 Bacteria 22281
114 Ga0207688_10052819 3300025901 Bacteria 2278
115 Ga0207680_10256362 3300025903 Bacteria 1209
116 Ga0207643_10164548 3300025908 Bacteria 1336
117 Ga0207684_10064916 3300025910 Bacteria 3100
118 Ga0207684_10249074 3300025910 Bacteria 1533
119 Ga0207684_10531198 3300025910 Bacteria 1007
120 Ga0207671_10158447 3300025914 Bacteria 1752
121 Ga0207693_10000334 3300025915 Bacteria 43371
122 Ga0207646_10013393 3300025922 Bacteria 7847
123 Ga0207646_10021940 3300025922 Bacteria 5890
124 Ga0207681_10303683 3300025923 Bacteria 1264
125 Ga0207700_10277723 3300025928 Bacteria 1440
126 Ga0207664_10184688 3300025929 Bacteria 1792
127 Ga0207665_10137331 3300025939 Bacteria 1741
128 Ga0207691_10012375 3300025940 Bacteria 8178
129 Ga0207711_10083101 3300025941 Bacteria 2800
130 Ga0207651_10243208 3300025960 Bacteria 1468
131 Ga0207668_10038709 3300025972 Bacteria 3204
132 Ga0207668_10268699 3300025972 Bacteria 1393
133 Ga0207658_10006385 3300025986 Bacteria 8050
134 Ga0207658_10721682 3300025986 Bacteria 902
135 Ga0207703_10733799 3300026035 Bacteria 940
136 Ga0207641_10188129 3300026088 Bacteria 1896
137 Ga0207641_10674259 3300026088 Bacteria 1017
138 Ga0207648_10158608 3300026089 Bacteria 1998
139 Ga0207676_10826597 3300026095 Bacteria 905
140 Ga0207674_10215458 3300026116 Bacteria 1869
141 Ga0207683_10009534 3300026121 Bacteria 8274
142 Ga0207683_10117080 3300026121 Bacteria 2389
143 Ga0207683_10631139 3300026121 Bacteria 992
144 Ga0209179_1057673 3300027512 Bacteria 840
145 Ga0209588_1006707 3300027671 Bacteria 3360
146 Ga0209588_1041460 3300027671 Bacteria 1486
147 Ga0268266_10225384 3300028379 Bacteria 1724
148 Ga0268265_10044548 3300028380 Bacteria 3304
149 Ga0268264_10023926 3300028381 Bacteria 4983
150 Ga0307515_10015763 3300028794 Bacteria 13904
151 Ga0307515_10056131 3300028794 Bacteria 5733
152 Ga0307515_10118193 3300028794 Bacteria 3028
153 Ga0307513_10008363 3300031456 Bacteria 13252
154 Ga0307513_10490702 3300031456 Bacteria 947
155 Ga0307508_10096484 3300031616 Bacteria 2548
156 Ga0307405_10193823 3300031731 Bacteria 1470
157 Ga0307410_10553712 3300031852 Bacteria 953
158 Ga0307406_10109505 3300031901 Bacteria 1899
159 Ga0307412_10198205 3300031911 Bacteria 1523
160 Ga0307412_10398861 3300031911 Bacteria 1119
161 Ga0307414_10394783 3300032004 Bacteria 1200
162 Ga0307411_10051094 3300032005 Bacteria 2696
163 Ga0307411_10337629 3300032005 Bacteria 1223
164 Ga0307415_100648375 3300032126 Unclassified 946
165 Ga0373923_0231169 3300035111 Bacteria 862
166 Ga0373935_0270022 3300035692 Bacteria 1195
167 Ga0373927_0037794 3300035695 Bacteria 3136
168 Ga0451851_0423840 3300041507 Bacteria 4425
169 Ga0439448_0018774 3300042005 Bacteria 2123
170 Ga0495627_008353 3300046453 Bacteria 3891
171 Ga0495603_0073800 3300046455 Bacteria 2004
172 Ga0495629_0017563 3300046459 Bacteria 5128
173 Ga0495630_0508883 3300046517 Bacteria 923
174 Ga0495632_0080373 3300046519 Bacteria 1555
175 Ga0495586_0095098 3300046535 Bacteria 1648
176 Ga0495587_0323488 3300046536 Bacteria 861
177 Ga0495609_0052546 3300046538 Bacteria 1813
178 Ga0495667_0276245 3300046559 Bacteria 1067
179 Ga0495625_0190696 3300046660 Bacteria 1358
180 Ga0495658_0137783 3300046683 Bacteria 1490
181 Ga0495669_0020132 3300046684 Bacteria 2885
182 Ga0495671_0004969 3300046692 Bacteria 7833
183 Ga0495686_0002421 3300047472 Bacteria 17648
184 Ga0496107_0011367 3300048910 Bacteria 6198
185 Ga0496109_0639583 3300048912 Bacteria 1001
186 Ga0496111_0262431 3300048914 Bacteria 1282
187 nmdc:mga05p37_8269_c1 3300050507 Bacteria 12302
188 nmdc:mga09592_155890_c1 3300050508 Bacteria 1971
189 nmdc:mga0qj67_123557_c1 3300050509 Bacteria 2094
190 nmdc:mga06r32_4070_c1 3300050510 Bacteria 13100
191 nmdc:mga08y16_123643_c1 3300050511 Bacteria 2692
192 nmdc:mga0n895_465482_c1 3300050512 Unclassified 1276
193 nmdc:mga0n895_69261_c1 3300050512 Bacteria 3495
194 nmdc:mga0rr50_104280_c1 3300050513 Bacteria 2233
195 nmdc:mga0rr50_738818_c1 3300050513 Bacteria 840
196 nmdc:mga0a205_20457_c1 3300050515 Bacteria 6244
197 Ga0495601_0280656 3300053077 Bacteria 1086
198 Ga0500610_0000021 3300053079 Bacteria 66361
199 Ga0500646_0015841 3300053090 Bacteria 1965
200 Ga0500583_0115248 3300053092 Bacteria 1326
201 Ga0500593_000450 3300053117 Bacteria 16269

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005467 Ga0070706_100042456 Ga0070706_1000424565 215
2 3300005518 Ga0070699_100629433 Ga0070699_1006294331 215
3 3300005536 Ga0070697_100123256 Ga0070697_1001232563 215
4 3300007076 Ga0075435_100360682 Ga0075435_1003606823 215
5 3300007265 Ga0099794_10052173 Ga0099794_100521732 217
6 3300005338 Ga0068868_100038731 Ga0068868_1000387312 218
7 3300005364 Ga0070673_100717517 Ga0070673_1007175171 218
8 3300005456 Ga0070678_100039949 Ga0070678_1000399492 218
9 3300005543 Ga0070672_100020065 Ga0070672_1000200654 218
10 3300005548 Ga0070665_100256555 Ga0070665_1002565551 218
11 3300006358 Ga0068871_100092970 Ga0068871_1000929703 218
12 3300025940 Ga0207691_10012375 Ga0207691_100123757 218
13 3300026121 Ga0207683_10009534 Ga0207683_100095342 218
14 3300028379 Ga0268266_10225384 Ga0268266_102253842 218
15 3300010159 Ga0099796_10158260 Ga0099796_101582601 220
16 3300025910 Ga0207684_10249074 Ga0207684_102490742 220
17 3300046536 Ga0495587_0323488 Ga0495587_0323488_181_849 222
18 3300005445 Ga0070708_100368062 Ga0070708_1003680621 223
19 3300005518 Ga0070699_100018891 Ga0070699_1000188915 223
20 iso_pu_bacteria 2929219909 2929222526 223
21 3300005347 Ga0070668_100272921 Ga0070668_1002729211 224
22 3300006871 Ga0075434_100063450 Ga0075434_1000634502 224
23 3300007076 Ga0075435_100189826 Ga0075435_1001898262 224
24 3300014326 Ga0157380_10244276 Ga0157380_102442761 224
25 3300025972 Ga0207668_10038709 Ga0207668_100387093 224
26 3300050513 nmdc:mga0rr50_104280_c1 nmdc:mga0rr50_104280_c1_618_1325 224
27 3300007265 Ga0099794_10021124 Ga0099794_100211242 225
28 3300005436 Ga0070713_100265260 Ga0070713_1002652603 226
29 3300005518 Ga0070699_100214270 Ga0070699_1002142702 226
30 3300005536 Ga0070697_100079464 Ga0070697_1000794642 226
31 3300005536 Ga0070697_100376201 Ga0070697_1003762012 226
32 3300006028 Ga0070717_10300701 Ga0070717_103007011 226
33 3300006028 Ga0070717_10480599 Ga0070717_104805992 226
34 3300006175 Ga0070712_100587089 Ga0070712_1005870891 226
35 3300006237 Ga0097621_100424962 Ga0097621_1004249622 226
36 3300006847 Ga0075431_100178420 Ga0075431_1001784202 226
37 3300006880 Ga0075429_100253927 Ga0075429_1002539272 226
38 3300007076 Ga0075435_100880334 Ga0075435_1008803341 226
39 3300013308 Ga0157375_10010348 Ga0157375_100103485 226
40 3300014969 Ga0157376_10096989 Ga0157376_100969893 226
41 3300025929 Ga0207664_10184688 Ga0207664_101846881 226
42 3300048914 Ga0496111_0262431 Ga0496111_0262431_111_806 226
43 3300050508 nmdc:mga09592_155890_c1 nmdc:mga09592_155890_c1_895_1575 226
44 3300050509 nmdc:mga0qj67_123557_c1 nmdc:mga0qj67_123557_c1_715_1395 226
45 3300050510 nmdc:mga06r32_4070_c1 nmdc:mga06r32_4070_c1_694_1374 226
46 3300050513 nmdc:mga0rr50_738818_c1 nmdc:mga0rr50_738818_c1_53_748 226
47 3300005335 Ga0070666_10169731 Ga0070666_101697311 227
48 3300005338 Ga0068868_100445158 Ga0068868_1004451582 227
49 3300005355 Ga0070671_100040830 Ga0070671_1000408305 227
50 3300005364 Ga0070673_100226085 Ga0070673_1002260852 227
51 3300005367 Ga0070667_100027210 Ga0070667_1000272103 227
52 3300005436 Ga0070713_100325319 Ga0070713_1003253191 227
53 3300005546 Ga0070696_100361193 Ga0070696_1003611931 227
54 3300005547 Ga0070693_100210754 Ga0070693_1002107542 227
55 3300005615 Ga0070702_100189467 Ga0070702_1001894672 227
56 3300005718 Ga0068866_10078558 Ga0068866_100785581 227
57 3300006163 Ga0070715_10098755 Ga0070715_100987551 227
58 3300006175 Ga0070712_100009035 Ga0070712_1000090353 227
59 3300006358 Ga0068871_100311289 Ga0068871_1003112892 227
60 3300007265 Ga0099794_10066596 Ga0099794_100665963 227
61 3300007788 Ga0099795_10065167 Ga0099795_100651672 227
62 3300009094 Ga0111539_10494438 Ga0111539_104944382 227
63 3300009177 Ga0105248_10243539 Ga0105248_102435393 227
64 3300025903 Ga0207680_10256362 Ga0207680_102563621 227
65 3300025914 Ga0207671_10158447 Ga0207671_101584472 227
66 3300025915 Ga0207693_10000334 Ga0207693_100003341 227
67 3300025928 Ga0207700_10277723 Ga0207700_102777232 227
68 3300026035 Ga0207703_10733799 Ga0207703_107337991 227
69 3300026088 Ga0207641_10674259 Ga0207641_106742591 227
70 3300026121 Ga0207683_10117080 Ga0207683_101170801 227
71 3300028381 Ga0268264_10023926 Ga0268264_100239265 227
72 3300046559 Ga0495667_0276245 Ga0495667_0276245_25_708 227
73 3300005536 Ga0070697_100341284 Ga0070697_1003412841 228
74 3300005937 Ga0081455_10237700 Ga0081455_102377001 228
75 3300031456 Ga0307513_10490702 Ga0307513_104907022 228
76 3300046535 Ga0495586_0095098 Ga0495586_0095098_108_809 228
77 3300053090 Ga0500646_0015841 Ga0500646_0015841_260_949 228
78 3300005338 Ga0068868_100658220 Ga0068868_1006582201 229
79 3300005468 Ga0070707_100346170 Ga0070707_1003461701 229
80 3300005518 Ga0070699_100061222 Ga0070699_1000612224 229
81 3300005535 Ga0070684_100123217 Ga0070684_1001232171 229
82 3300006844 Ga0075428_100047759 Ga0075428_1000477599 229
83 3300009147 Ga0114129_10490076 Ga0114129_104900762 229
84 3300009148 Ga0105243_10072280 Ga0105243_100722802 229
85 3300025901 Ga0207688_10052819 Ga0207688_100528192 229
86 3300026095 Ga0207676_10826597 Ga0207676_108265971 229
87 3300028794 Ga0307515_10056131 Ga0307515_100561315 229
88 3300046519 Ga0495632_0080373 Ga0495632_0080373_315_1040 229
89 3300005347 Ga0070668_100296205 Ga0070668_1002962052 230
90 3300005353 Ga0070669_100133544 Ga0070669_1001335443 230
91 3300005367 Ga0070667_100017667 Ga0070667_1000176673 230
92 3300005456 Ga0070678_100677237 Ga0070678_1006772371 230
93 3300005618 Ga0068864_100687338 Ga0068864_1006873381 230
94 3300005718 Ga0068866_10349631 Ga0068866_103496312 230
95 3300005844 Ga0068862_100037495 Ga0068862_1000374953 230
96 3300006237 Ga0097621_100339301 Ga0097621_1003393013 230
97 3300007265 Ga0099794_10001779 Ga0099794_100017794 230
98 3300011119 Ga0105246_10271362 Ga0105246_102713621 230
99 3300025923 Ga0207681_10303683 Ga0207681_103036831 230
100 3300025972 Ga0207668_10268699 Ga0207668_102686992 230
101 3300025986 Ga0207658_10006385 Ga0207658_100063852 230
102 3300025986 Ga0207658_10721682 Ga0207658_107216821 230
103 3300026116 Ga0207674_10215458 Ga0207674_102154582 230
104 3300026121 Ga0207683_10631139 Ga0207683_106311391 230
105 3300027671 Ga0209588_1006707 Ga0209588_10067072 230
106 3300028380 Ga0268265_10044548 Ga0268265_100445483 230
107 3300031852 Ga0307410_10553712 Ga0307410_105537122 230
108 3300031901 Ga0307406_10109505 Ga0307406_101095052 230
109 3300031911 Ga0307412_10198205 Ga0307412_101982051 230
110 3300032005 Ga0307411_10051094 Ga0307411_100510945 230
111 3300032126 Ga0307415_100648375 Ga0307415_1006483751 230
112 3300048912 Ga0496109_0639583 Ga0496109_0639583_275_976 230
113 3300005445 Ga0070708_100050358 Ga0070708_1000503582 231
114 3300005467 Ga0070706_100076657 Ga0070706_1000766572 231
115 3300005468 Ga0070707_100044874 Ga0070707_1000448743 231
116 3300005518 Ga0070699_100066258 Ga0070699_1000662582 231
117 3300005617 Ga0068859_100215084 Ga0068859_1002150843 231
118 3300006931 Ga0097620_100215078 Ga0097620_1002150781 231
119 3300013308 Ga0157375_10549783 Ga0157375_105497832 231
120 3300014326 Ga0157380_10966860 Ga0157380_109668602 231
121 3300025910 Ga0207684_10064916 Ga0207684_100649162 231
122 3300025910 Ga0207684_10531198 Ga0207684_105311981 231
123 3300025922 Ga0207646_10021940 Ga0207646_100219402 231
124 3300046517 Ga0495630_0508883 Ga0495630_0508883_47_760 231
125 3300048910 Ga0496107_0011367 Ga0496107_0011367_133_846 231
126 3300053077 Ga0495601_0280656 Ga0495601_0280656_87_806 231
127 3300005577 Ga0068857_100182452 Ga0068857_1001824523 232
128 3300006847 Ga0075431_100297572 Ga0075431_1002975722 232
129 3300046538 Ga0495609_0052546 Ga0495609_0052546_26_742 232
130 3300010375 Ga0105239_10312036 Ga0105239_103120362 233
131 3300025941 Ga0207711_10083101 Ga0207711_100831011 233
132 3300025960 Ga0207651_10243208 Ga0207651_102432082 233
133 3300026088 Ga0207641_10188129 Ga0207641_101881292 233
134 3300026089 Ga0207648_10158608 Ga0207648_101586081 233
135 3300028794 Ga0307515_10015763 Ga0307515_100157634 233
136 3300031456 Ga0307513_10008363 Ga0307513_1000836310 233
137 3300031731 Ga0307405_10193823 Ga0307405_101938233 233
138 3300031911 Ga0307412_10398861 Ga0307412_103988612 233
139 3300032004 Ga0307414_10394783 Ga0307414_103947832 233
140 3300032005 Ga0307411_10337629 Ga0307411_103376291 233
141 3300046684 Ga0495669_0020132 Ga0495669_0020132_658_1368 233
142 3300005347 Ga0070668_100253616 Ga0070668_1002536161 234
143 3300005471 Ga0070698_100041201 Ga0070698_1000412012 234
144 3300005983 Ga0081540_1000416 Ga0081540_100041618 234
145 3300006844 Ga0075428_100090422 Ga0075428_1000904222 234
146 3300006871 Ga0075434_100169915 Ga0075434_1001699152 234
147 3300006871 Ga0075434_100405057 Ga0075434_1004050572 234
148 3300011119 Ga0105246_10051113 Ga0105246_100511133 234
149 3300027512 Ga0209179_1057673 Ga0209179_10576731 234
150 3300027671 Ga0209588_1041460 Ga0209588_10414602 234
151 3300031616 Ga0307508_10096484 Ga0307508_100964843 234
152 3300035111 Ga0373923_0231169 Ga0373923_0231169_34_744 234
153 3300035692 Ga0373935_0270022 Ga0373935_0270022_207_917 234
154 3300035695 Ga0373927_0037794 Ga0373927_0037794_2050_2760 234
155 3300042005 Ga0439448_0018774 Ga0439448_0018774_747_1463 234
156 3300046455 Ga0495603_0073800 Ga0495603_0073800_510_1220 234
157 3300046459 Ga0495629_0017563 Ga0495629_0017563_2464_3174 234
158 3300046683 Ga0495658_0137783 Ga0495658_0137783_559_1269 234
159 3300050512 nmdc:mga0n895_465482_c1 nmdc:mga0n895_465482_c1_220_924 234
160 3300005293 Ga0065715_10257674 Ga0065715_102576742 235
161 3300006852 Ga0075433_10018439 Ga0075433_100184394 235
162 3300006871 Ga0075434_100065014 Ga0075434_1000650144 235
163 3300009147 Ga0114129_10004894 Ga0114129_1000489410 235
164 3300009147 Ga0114129_10075263 Ga0114129_100752632 235
165 3300050507 nmdc:mga05p37_8269_c1 nmdc:mga05p37_8269_c1_2451_3170 235
166 3300050512 nmdc:mga0n895_69261_c1 nmdc:mga0n895_69261_c1_811_1530 235
167 3300050515 nmdc:mga0a205_20457_c1 nmdc:mga0a205_20457_c1_2735_3454 235
168 3300009094 Ga0111539_10042103 Ga0111539_100421033 236
169 3300025908 Ga0207643_10164548 Ga0207643_101645482 236
170 3300050511 nmdc:mga08y16_123643_c1 nmdc:mga08y16_123643_c1_1421_2149 236
171 3300025922 Ga0207646_10013393 Ga0207646_100133935 238
172 3300005440 Ga0070705_100098877 Ga0070705_1000988771 239
173 3300005471 Ga0070698_100230855 Ga0070698_1002308552 239
174 3300025939 Ga0207665_10137331 Ga0207665_101373312 239
175 3300028794 Ga0307515_10118193 Ga0307515_101181933 239
176 iso_pu_bacteria 8057529695 8057531809 244
177 iso_pu_bacteria 2775506901 2776259360 246
178 3300053092 Ga0500583_0115248 Ga0500583_0115248_93_881 248
179 iso_pu_bacteria 2599185352 2600195362 248
180 iso_pu_bacteria 2643221723 2644671554 248
181 3300041507 Ga0451851_0423840 Ga0451851_0423840_3218_3982 250
182 3300047472 Ga0495686_0002421 Ga0495686_0002421_775_1560 251
183 3300002987 JGI25159J45721_1000015 JGI25159J45721_100001571 252
184 3300003187 JGI25151J46595_10011614 JGI25151J46595_100116142 252
185 3300003354 JGI25160J50197_1000003 JGI25160J50197_1000003113 252
186 3300003374 JGI25161J50226_1000741 JGI25161J50226_10007413 252
187 3300003781 Ga0055536_1001123 Ga0055536_100112317 252
188 3300003791 Ga0055530_10004321 Ga0055530_100043218 252
189 3300003792 Ga0055540_1014995 Ga0055540_10149952 252
190 3300004625 Ga0055543_1000034 Ga0055543_100003441 252
191 3300005262 Ga0065165_1000025 Ga0065165_1000025220 252
192 3300025208 Ga0209436_100130 Ga0209436_10013014 252
193 3300025284 Ga0209130_1000005 Ga0209130_1000005368 252
194 3300025292 Ga0209676_1001927 Ga0209676_100192717 252
195 3300025294 Ga0209025_1000105 Ga0209025_100010550 252
196 3300025295 Ga0209564_1000113 Ga0209564_100011356 252
197 3300025298 Ga0209050_1005247 Ga0209050_10052476 252
198 3300025299 Ga0209256_1003107 Ga0209256_100310716 252
199 3300025302 Ga0207426_1000015 Ga0207426_1000015231 252
200 3300025303 Ga0209051_1001056 Ga0209051_10010568 252
201 3300025304 Ga0209257_1001948 Ga0209257_100194815 252
202 3300046453 Ga0495627_008353 Ga0495627_008353_1019_1891 252
203 3300046660 Ga0495625_0190696 Ga0495625_0190696_27_899 252
204 3300046692 Ga0495671_0004969 Ga0495671_0004969_3807_4679 252
205 3300053079 Ga0500610_0000021 Ga0500610_0000021_22840_23712 252
206 3300053117 Ga0500593_000450 Ga0500593_000450_7889_8761 252

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12695

Abhydrolase_5

Alpha/beta hydrolase family

47

180

0.76

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

48

261

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hfw-assembly1.cif.gz_B the crystal structure of alpha/beta fold hydrolase 0.9169 30 246
8hfw-assembly2.cif.gz_C-2 the crystal structure of alpha/beta fold hydrolase 0.9017 30 248
7wwf-assembly3.cif.gz_E crystal structure of bioh3 from mycolicibacterium smegmatis 0.8962 29 246
5y5r-assembly6.cif.gz_F crystal structure of a novel pyrethroid hydrolase pyth with bif 0.8769 27 250
8hfw-assembly1.cif.gz_A the crystal structure of alpha/beta fold hydrolase 0.8734 30 246
ID Description Score Start End Superfamily
af_Q54QE7_5_233_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9497 29 252 3.40.50.1820
af_Q54QE7_5_233_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9255 29 252 3.40.50.1820
af_F4JRA6_1_133_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8959 27 121 3.40.50.1820
af_Q9FVW3_95_346_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8573 27 249 3.40.50.1820
af_Q8S9K8_14_275_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8543 27 252 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A3N5GK32-F1-model_v4 Alpha/beta hydrolase 1.004 27 111 GO:0016787
AF-G0FR54-F1-model_v4 deleted 0.9986 27 250
AF-A0A7U9KPQ2-F1-model_v4 Alpha/beta hydrolase 0.9979 39 248 GO:0016787
AF-A0A010Z156-F1-model_v4 DNA-binding protein with HTH domain 0.9968 27 249 GO:0003677
GO:0006355
AF-A0A6H1MW89-F1-model_v4 Alpha/beta hydrolase 0.9963 25 249 GO:0016787

Feature Viewer

pLDDT pTM Quality
91.01 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map