F315475

General Info

Members Datasets Scaffolds Average Seq Length
206 173 412 365

Family's Representative Sequence

Representative Sequence 3300044719|Ga0466971_0016490|Ga0466971_0016490_121_1320
Length 399
Sequence MRAGELIREETMAVSLDNSARNRASAPAEVRSEPVPASAGAGLTFDIRPAAAPTSEADRTAKLKDPGFGRVFTDHMAIVRYDQAKGWHGARIESRANFALDPALAVLHYAQEIFEGLKAYKRDDGGVNLFRPDANARRFRDSADRLAMAQLPEDAFIGAVEQLVRIDRAWIPGGEGSLYLRPFMIASEVFLGVKPSSEYLFAVIASPVGSYFKGGPAPVSIWVSENYTRAAIGGTGAVKCGGNYAASLRAQAEAIEHGCDQVVFLDAVERRYVEELGGMNIFFVFDDGSLATPPLGTILPGITRDSIIALARDAGRRVREETYSVEQWRADAASGKLKEAFACGTAAVISPIGKVSSTSGEFLISGGAAGPVAMGLRKQLVDIQYGRTNDPHNWIRKVF

Samples

Sample ID Description Type Environment
1 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
2 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
24 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
37 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
38 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
52 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
55 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
57 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
87 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
88 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
89 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
90 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
91 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
92 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
93 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
94 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
95 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
96 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
97 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
98 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
99 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
100 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
103 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
104 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
105 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
106 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
107 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
108 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
109 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
110 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
111 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
112 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
113 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
114 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
115 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
116 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
117 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
118 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
119 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
120 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
121 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
122 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
123 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
124 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
125 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
126 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
127 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
128 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
129 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
130 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
131 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
138 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
139 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
140 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
141 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
142 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
143 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
144 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
145 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
146 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
147 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
148 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
149 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
150 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
151 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
152 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
153 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
154 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
155 2547132424 Nocardia nova SH22a Isolate Unclassified
156 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
157 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
158 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
159 2643221692 Nocardia sp. Root136 Isolate Unclassified
160 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
161 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
162 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
163 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
164 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
165 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
166 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
167 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
168 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
169 2909399089 Nguyenibacter vanlangensis LMG 31431 Isolate Unclassified
170 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
171 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
172 641228493 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
173 643348555 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 89.81
Metatranscriptomes 0.97
Isolates 9.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.25
Nodule 0
Rhizoplane 1.46
Rhizosphere 71.84
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466971_0016490 3300044719 Bacteria 3261
2 JGI24745J21846_1006205 3300002073 Bacteria 1320
3 Ga0070682_100014206 3300005337 Bacteria 4599
4 Ga0070660_100099253 3300005339 Bacteria 2305
5 Ga0070661_100023363 3300005344 Bacteria 4430
6 Ga0070692_10019018 3300005345 Bacteria 3311
7 Ga0070671_100097692 3300005355 Bacteria 2463
8 Ga0070674_100249346 3300005356 Bacteria 1394
9 Ga0070711_100023956 3300005439 Bacteria 3977
10 Ga0070700_100102564 3300005441 Bacteria 1887
11 Ga0070663_100143923 3300005455 Bacteria 1822
12 Ga0070678_100104020 3300005456 Bacteria 2207
13 Ga0070662_100276058 3300005457 Bacteria 1359
14 Ga0070685_10057941 3300005466 Bacteria 2256
15 Ga0070707_100007401 3300005468 Bacteria 10195
16 Ga0070707_100255359 3300005468 Bacteria 1706
17 Ga0070684_100182540 3300005535 Bacteria 1908
18 Ga0070665_100351864 3300005548 Bacteria 1479
19 Ga0070664_100091629 3300005564 Bacteria 2631
20 Ga0068857_100204160 3300005577 Bacteria 1802
21 Ga0068854_100005169 3300005578 Bacteria 8229
22 Ga0068854_100045519 3300005578 Bacteria 3121
23 Ga0068852_100394244 3300005616 Bacteria 1360
24 Ga0068864_100373175 3300005618 Bacteria 1350
25 Ga0068851_10081057 3300005834 Bacteria 1695
26 Ga0068870_10064277 3300005840 Bacteria 1981
27 Ga0068863_100248863 3300005841 Bacteria 1716
28 Ga0068858_100273492 3300005842 Bacteria 1608
29 Ga0081455_10016547 3300005937 Bacteria 7115
30 Ga0081538_10081798 3300005981 Bacteria 1716
31 Ga0081539_10004696 3300005985 Bacteria 14818
32 Ga0070717_10060182 3300006028 Bacteria 3144
33 Ga0070717_10079969 3300006028 Bacteria 2742
34 Ga0070717_10207733 3300006028 Bacteria 1717
35 Ga0070712_100009293 3300006175 Bacteria 6194
36 Ga0070712_100117254 3300006175 Bacteria 1998
37 Ga0075428_100413139 3300006844 Bacteria 1446
38 Ga0075430_100224560 3300006846 Bacteria 1558
39 Ga0075431_100116772 3300006847 Bacteria 2754
40 Ga0075429_100080673 3300006880 Bacteria 2837
41 Ga0075435_100127695 3300007076 Bacteria 2126
42 Ga0105251_10070015 3300009011 Bacteria 1635
43 Ga0105244_10100831 3300009036 Bacteria 1412
44 Ga0111539_10170548 3300009094 Bacteria 2542
45 Ga0105245_10026255 3300009098 Bacteria 5126
46 Ga0105245_10064213 3300009098 Bacteria 3318
47 Ga0114129_10035098 3300009147 Bacteria 7085
48 Ga0105243_10035094 3300009148 Bacteria 3887
49 Ga0105237_10031546 3300009545 Bacteria 5370
50 Ga0105237_10288169 3300009545 Bacteria 1645
51 Ga0105238_10152995 3300009551 Bacteria 2282
52 Ga0105239_10012942 3300010375 Bacteria 9282
53 Ga0105239_10113024 3300010375 Bacteria 3011
54 Ga0105246_10202472 3300011119 Bacteria 1544
55 Ga0157370_10212250 3300013104 Bacteria 1794
56 Ga0157369_10279462 3300013105 Bacteria 1739
57 Ga0157372_10144295 3300013307 Bacteria 2745
58 Ga0157375_10245590 3300013308 Bacteria 1950
59 Ga0157375_10618466 3300013308 Bacteria 1241
60 Ga0157377_10115463 3300014745 Bacteria 1620
61 Ga0206356_10085689 3300020070 Bacteria 1330
62 Ga0206354_10310339 3300020081 Bacteria 1218
63 Ga0213876_10014364 3300021384 Bacteria 4196
64 Ga0209677_100233 3300025253 Bacteria 39376
65 Ga0209233_1003521 3300025261 Bacteria 5502
66 Ga0209455_1007018 3300025272 Bacteria 3243
67 Ga0209257_1017424 3300025304 Bacteria 2829
68 Ga0207688_10001694 3300025901 Bacteria 11687
69 Ga0207680_10118532 3300025903 Bacteria 1728
70 Ga0207647_10115556 3300025904 Bacteria 1584
71 Ga0207699_10075173 3300025906 Bacteria 2077
72 Ga0207643_10018221 3300025908 Bacteria 3845
73 Ga0207643_10096336 3300025908 Bacteria 1730
74 Ga0207671_10054585 3300025914 Bacteria 2960
75 Ga0207693_10020689 3300025915 Bacteria 5233
76 Ga0207693_10220348 3300025915 Bacteria 1491
77 Ga0207663_10015394 3300025916 Bacteria 4218
78 Ga0207660_10110181 3300025917 Bacteria 2071
79 Ga0207657_10030491 3300025919 Bacteria 4895
80 Ga0207649_10173609 3300025920 Bacteria 1503
81 Ga0207646_10003316 3300025922 Bacteria 18310
82 Ga0207700_10003685 3300025928 Bacteria 8938
83 Ga0207700_10030056 3300025928 Bacteria 3843
84 Ga0207700_10076424 3300025928 Bacteria 2598
85 Ga0207664_10021260 3300025929 Bacteria 4821
86 Ga0207664_10034007 3300025929 Bacteria 3922
87 Ga0207644_10082579 3300025931 Bacteria 2378
88 Ga0207706_10091466 3300025933 Bacteria 2675
89 Ga0207711_10171167 3300025941 Bacteria 1971
90 Ga0207689_10013657 3300025942 Bacteria 6924
91 Ga0207668_10103960 3300025972 Bacteria 2116
92 Ga0207640_10035164 3300025981 Bacteria 3133
93 Ga0207677_10201922 3300026023 Bacteria 1581
94 Ga0207703_10139526 3300026035 Bacteria 2102
95 Ga0207678_10134226 3300026067 Bacteria 2112
96 Ga0207708_10008235 3300026075 Bacteria 7724
97 Ga0207674_10155108 3300026116 Bacteria 2245
98 Ga0207674_10405897 3300026116 Bacteria 1317
99 Ga0207675_100088887 3300026118 Bacteria 2902
100 Ga0268264_10170073 3300028381 Bacteria 1970
101 Ga0307513_10026314 3300031456 Bacteria 6711
102 Ga0307513_10110231 3300031456 Bacteria 2748
103 Ga0307508_10126576 3300031616 Bacteria 2158
104 Ga0265314_10052621 3300031711 Bacteria 2829
105 Ga0307413_10165708 3300031824 Bacteria 1558
106 Ga0307410_10228541 3300031852 Bacteria 1435
107 Ga0307407_10020122 3300031903 Bacteria 3412
108 Ga0307412_10000210 3300031911 Bacteria 39741
109 Ga0307414_10105190 3300032004 Bacteria 2133
110 Ga0307507_10056200 3300033179 Bacteria 3722
111 Ga0307507_10107839 3300033179 Bacteria 2293
112 Ga0307510_10066450 3300033180 Bacteria 3641
113 Ga0373936_0041054 3300035113 Bacteria 1855
114 Ga0373953_0061735 3300035117 Bacteria 1533
115 Ga0373935_0136540 3300035692 Bacteria 1653
116 Ga0373947_0153935 3300035725 Bacteria 1482
117 Ga0373947_0161795 3300035725 Bacteria 1448
118 Ga0373937_0111804 3300036401 Bacteria 2541
119 Ga0395900_0033854 3300037418 Bacteria 5258
120 Ga0237819_00863 3300038705 Bacteria 9518
121 Ga0436365_0023545 3300039437 Bacteria 1231
122 Ga0436365_0709051 3300039437 Bacteria 32416
123 Ga0436362_0935624 3300039453 Bacteria 1990
124 Ga0436362_1240033 3300039453 Bacteria 2130
125 Ga0466965_0004364 3300044683 Bacteria 6289
126 Ga0466961_0076105 3300044693 Bacteria 2127
127 Ga0466964_0025059 3300044706 Bacteria 2328
128 Ga0466964_0071599 3300044706 Bacteria 1467
129 Ga0466970_0173342 3300044765 Bacteria 1196
130 Ga0466960_0000244 3300044901 Bacteria 18862
131 Ga0466959_0023938 3300045049 Bacteria 4521
132 Ga0466959_0190901 3300045049 Bacteria 1430
133 Ga0466958_0179814 3300045836 Bacteria 1342
134 Ga0495650_0035285 3300046471 Bacteria 2203
135 Ga0495594_0088094 3300046499 Bacteria 1738
136 Ga0495583_0000248 3300046506 Bacteria 89173
137 Ga0495606_0000936 3300046507 Bacteria 43004
138 Ga0495670_0000003 3300046691 Bacteria 326779
139 Ga0495670_0032548 3300046691 Bacteria 2593
140 Ga0495683_0000326 3300047323 Bacteria 40006
141 Ga0495673_0009212 3300047469 Bacteria 5482
142 Ga0495686_0000063 3300047472 Bacteria 228575
143 Ga0495686_0006965 3300047472 Bacteria 8541
144 Ga0496102_0363161 3300048905 Bacteria 1363
145 Ga0496108_0165128 3300048911 Bacteria 1914
146 Ga0496117_0072761 3300048920 Bacteria 2296
147 Ga0496118_0077554 3300048921 Bacteria 2356
148 Ga0496120_0082807 3300048923 Bacteria 1733
149 Ga0496121_0002915 3300048924 Bacteria 25094
150 Ga0496121_0016644 3300048924 Bacteria 7572
151 Ga0496121_0089157 3300048924 Bacteria 2416
152 Ga0496122_0048749 3300048925 Bacteria 3252
153 Ga0496123_0032108 3300048926 Bacteria 3809
154 Ga0496124_0000071 3300048927 Bacteria 220642
155 Ga0496124_0001622 3300048927 Bacteria 32242
156 Ga0496124_0062946 3300048927 Bacteria 3102
157 Ga0496124_0193525 3300048927 Bacteria 1554
158 Ga0496125_0080876 3300048928 Bacteria 2485
159 Ga0496125_0087956 3300048928 Bacteria 2344
160 Ga0495682_0008762 3300049460 Bacteria 3978
161 Ga0501032_0070425 3300049569 Bacteria 2332
162 Ga0501034_0216899 3300049571 Bacteria 1867
163 Ga0501037_0074932 3300049573 Bacteria 2458
164 Ga0501038_0030104 3300049574 Bacteria 4806
165 Ga0501039_0018626 3300049575 Bacteria 5330
166 Ga0501043_0135602 3300049579 Bacteria 1928
167 Ga0501047_0025945 3300049581 Bacteria 5635
168 Ga0501047_0328381 3300049581 Bacteria 1368
169 nmdc:mga05p37_59334_c1 3300050507 Bacteria 4712
170 nmdc:mga05p37_635943_c1 3300050507 Bacteria 1198
171 nmdc:mga06r32_102529_c1 3300050510 Bacteria 2809
172 Ga0495619_0026117 3300053085 Bacteria 3756
173 Ga0500643_004358 3300053087 Bacteria 6435
174 Ga0500566_0000588 3300053094 Bacteria 20372
175 Ga0500640_007928 3300053095 Bacteria 4169
176 Ga0500555_001212 3300053103 Bacteria 8351
177 Ga0500572_000174 3300053111 Bacteria 22807
178 Ga0500559_0006322 3300053136 Bacteria 5352
179 Ga0500573_0096510 3300053140 Bacteria 1666
180 Ga0500603_000114 3300053150 Bacteria 18972
181 Ga0500616_0075133 3300053153 Bacteria 1711
182 Ga0500630_001669 3300053159 Bacteria 10645
183 Ga0500630_033468 3300053159 Bacteria 2521
184 Ga0500639_000006 3300053163 Bacteria 165068
185 Ga0500637_0051314 3300053178 Bacteria 2351
186 Ga0466962_0025420 3300061719 Bacteria 2843
187 Ga0530510_0013967 3300061734 Bacteria 5659
188 2548694545 2547132424 Bacteria 8348532
189 2552107053 2551306166 Bacteria 9731570
190 2558908110 2558860112 Bacteria 9931328
191 2600225398 2599185359 Bacteria 4772316
192 2644514517 2643221692 Bacteria 7282860
193 2738746903 2738541281 Bacteria 5112672
194 2739356133 2738543032 Bacteria 5115625
195 2816506828 2816332139 Bacteria 9138787
196 2819713709 2818991466 Bacteria 4748179
197 2830077194 2830075706 Bacteria 3855215
198 2867315734 2867312974 Bacteria 7058875
199 2867323800 2867319477 Bacteria 7069771
200 2870789411 2870782633 Bacteria 9624083
201 2879166966 2879163058 Bacteria 4223965
202 2909401157 2909399089 Bacteria 3922598
203 2928528313 2928526807 Bacteria 4760224
204 2928969865 2928968154 Bacteria 4633371
205 641336432 641228493 Bacteria 3999591
206 643390255 643348555 Bacteria 3914947
207 Ga0466971_0016490
208 JGI24745J21846_1006205
209 Ga0070682_100014206
210 Ga0070660_100099253
211 Ga0070661_100023363
212 Ga0070692_10019018
213 Ga0070671_100097692
214 Ga0070674_100249346
215 Ga0070711_100023956
216 Ga0070700_100102564
217 Ga0070663_100143923
218 Ga0070678_100104020
219 Ga0070662_100276058
220 Ga0070685_10057941
221 Ga0070707_100007401
222 Ga0070707_100255359
223 Ga0070684_100182540
224 Ga0070665_100351864
225 Ga0070664_100091629
226 Ga0068857_100204160
227 Ga0068854_100005169
228 Ga0068854_100045519
229 Ga0068852_100394244
230 Ga0068864_100373175
231 Ga0068851_10081057
232 Ga0068870_10064277
233 Ga0068863_100248863
234 Ga0068858_100273492
235 Ga0081455_10016547
236 Ga0081538_10081798
237 Ga0081539_10004696
238 Ga0070717_10060182
239 Ga0070717_10079969
240 Ga0070717_10207733
241 Ga0070712_100009293
242 Ga0070712_100117254
243 Ga0075428_100413139
244 Ga0075430_100224560
245 Ga0075431_100116772
246 Ga0075429_100080673
247 Ga0075435_100127695
248 Ga0105251_10070015
249 Ga0105244_10100831
250 Ga0111539_10170548
251 Ga0105245_10026255
252 Ga0105245_10064213
253 Ga0114129_10035098
254 Ga0105243_10035094
255 Ga0105237_10031546
256 Ga0105237_10288169
257 Ga0105238_10152995
258 Ga0105239_10012942
259 Ga0105239_10113024
260 Ga0105246_10202472
261 Ga0157370_10212250
262 Ga0157369_10279462
263 Ga0157372_10144295
264 Ga0157375_10245590
265 Ga0157375_10618466
266 Ga0157377_10115463
267 Ga0206356_10085689
268 Ga0206354_10310339
269 Ga0213876_10014364
270 Ga0209677_100233
271 Ga0209233_1003521
272 Ga0209455_1007018
273 Ga0209257_1017424
274 Ga0207688_10001694
275 Ga0207680_10118532
276 Ga0207647_10115556
277 Ga0207699_10075173
278 Ga0207643_10018221
279 Ga0207643_10096336
280 Ga0207671_10054585
281 Ga0207693_10020689
282 Ga0207693_10220348
283 Ga0207663_10015394
284 Ga0207660_10110181
285 Ga0207657_10030491
286 Ga0207649_10173609
287 Ga0207646_10003316
288 Ga0207700_10003685
289 Ga0207700_10030056
290 Ga0207700_10076424
291 Ga0207664_10021260
292 Ga0207664_10034007
293 Ga0207644_10082579
294 Ga0207706_10091466
295 Ga0207711_10171167
296 Ga0207689_10013657
297 Ga0207668_10103960
298 Ga0207640_10035164
299 Ga0207677_10201922
300 Ga0207703_10139526
301 Ga0207678_10134226
302 Ga0207708_10008235
303 Ga0207674_10155108
304 Ga0207674_10405897
305 Ga0207675_100088887
306 Ga0268264_10170073
307 Ga0307513_10026314
308 Ga0307513_10110231
309 Ga0307508_10126576
310 Ga0265314_10052621
311 Ga0307413_10165708
312 Ga0307410_10228541
313 Ga0307407_10020122
314 Ga0307412_10000210
315 Ga0307414_10105190
316 Ga0307507_10056200
317 Ga0307507_10107839
318 Ga0307510_10066450
319 Ga0373936_0041054
320 Ga0373953_0061735
321 Ga0373935_0136540
322 Ga0373947_0153935
323 Ga0373947_0161795
324 Ga0373937_0111804
325 Ga0395900_0033854
326 Ga0237819_00863
327 Ga0436365_0023545
328 Ga0436365_0709051
329 Ga0436362_0935624
330 Ga0436362_1240033
331 Ga0466965_0004364
332 Ga0466961_0076105
333 Ga0466964_0025059
334 Ga0466964_0071599
335 Ga0466970_0173342
336 Ga0466960_0000244
337 Ga0466959_0023938
338 Ga0466959_0190901
339 Ga0466958_0179814
340 Ga0495650_0035285
341 Ga0495594_0088094
342 Ga0495583_0000248
343 Ga0495606_0000936
344 Ga0495670_0000003
345 Ga0495670_0032548
346 Ga0495683_0000326
347 Ga0495673_0009212
348 Ga0495686_0000063
349 Ga0495686_0006965
350 Ga0496102_0363161
351 Ga0496108_0165128
352 Ga0496117_0072761
353 Ga0496118_0077554
354 Ga0496120_0082807
355 Ga0496121_0002915
356 Ga0496121_0016644
357 Ga0496121_0089157
358 Ga0496122_0048749
359 Ga0496123_0032108
360 Ga0496124_0000071
361 Ga0496124_0001622
362 Ga0496124_0062946
363 Ga0496124_0193525
364 Ga0496125_0080876
365 Ga0496125_0087956
366 Ga0495682_0008762
367 Ga0501032_0070425
368 Ga0501034_0216899
369 Ga0501037_0074932
370 Ga0501038_0030104
371 Ga0501039_0018626
372 Ga0501043_0135602
373 Ga0501047_0025945
374 Ga0501047_0328381
375 nmdc:mga05p37_59334_c1
376 nmdc:mga05p37_635943_c1
377 nmdc:mga06r32_102529_c1
378 Ga0495619_0026117
379 Ga0500643_004358
380 Ga0500566_0000588
381 Ga0500640_007928
382 Ga0500555_001212
383 Ga0500572_000174
384 Ga0500559_0006322
385 Ga0500573_0096510
386 Ga0500603_000114
387 Ga0500616_0075133
388 Ga0500630_001669
389 Ga0500630_033468
390 Ga0500639_000006
391 Ga0500637_0051314
392 Ga0466962_0025420
393 Ga0530510_0013967
394 2548694545
395 2552107053
396 2558908110
397 2600225398
398 2644514517
399 2738746903
400 2739356133
401 2816506828
402 2819713709
403 2830077194
404 2867315734
405 2867323800
406 2870789411
407 2879166966
408 2909401157
409 2928528313
410 2928969865
411 641336432
412 643390255

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01063

Aminotran_4

Amino-transferase class IV

112

355

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3jz6-assembly1.cif.gz_B crystal structure of mycobacterium smegmatis branched chain aminotransferase in complex with pyridoxal-5'-phosphate at 1.9 angstrom. 0.9694 4 365
5u3f-assembly1.cif.gz_B structure of mycobacterium tuberculosis ilve, a branched-chain amino acid transaminase, in complex with d-cycloserine derivative 0.9679 31 365
3ht5-assembly1.cif.gz_A-2 crystal structure of ilve a branched chain amino acid transaminase from mycobacterium tuberculosis 0.9674 31 365
5u3f-assembly1.cif.gz_A structure of mycobacterium tuberculosis ilve, a branched-chain amino acid transaminase, in complex with d-cycloserine derivative 0.9668 31 365
5u3f-assembly1.cif.gz_B structure of mycobacterium tuberculosis ilve, a branched-chain amino acid transaminase, in complex with d-cycloserine derivative 0.965 31 365
ID Description Score Start End Superfamily
af_P9WQ75_8_180_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9621 5 177 3.90.180.10
3jz6A02 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.9598 176 346 3.20.10.10
af_P9WQ75_8_180_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9566 5 177 3.90.180.10
3jz6B01 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain 0.9526 4 175 3.30.470.10
5u3fA01 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain 0.9481 31 170 3.30.470.10
ID Description Score Start End GO Terms
AF-A0A3E2BUH7-F1-model_v4 deleted 0.9806 213 366
AF-A0A2S8M2X7-F1-model_v4 deleted 0.9781 103 365
AF-A0A6J7C082-F1-model_v4 Unannotated protein 0.9732 69 365 GO:0004084
GO:0008652
GO:0009082
AF-A0A1U1JCX0-F1-model_v4 deleted 0.9714 184 365
AF-A0A354LVD4-F1-model_v4 deleted 0.9711 99 365

Map