F315285

General Info

Members Datasets Scaffolds Average Seq Length
206 163 203 236

Family's Representative Sequence

Representative Sequence 3300031241|Ga0265325_10000470|Ga0265325_1000047032
Length 241
Sequence MRLLTRFPGLIGTSLAALALLAAPPLMKAHSESAVQVPAPALDETAPPQGLETVVIAGGCFWGVQAVFQHTNGVTKAVSGYAGGTQKDADYEIVSTGRTGHAESVAVTFDPRVVSYGKILQVYFSVAHNPTELNYQGPDHGPQYRSEIFPQSEEQAKVAKAYIVQLDAAKTFPKPIVTKTDTMKAAFFPAEAYHQDYATLHPHQPYIMFNDAPKVANLKATFAALYREKPVLVADAQAPGH

Samples

Sample ID Description Type Environment
1 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
2 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
3 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
58 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
92 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
93 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
94 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
95 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
96 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
97 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
98 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
99 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
100 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
101 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
102 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
103 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
104 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
105 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
106 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
107 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
108 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
109 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
110 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
111 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
112 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
113 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
114 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
115 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
116 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
117 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
118 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
119 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
120 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
121 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
122 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
123 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
124 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
125 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
126 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
127 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
128 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
129 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
130 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
131 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
132 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
133 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
134 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
145 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
146 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
147 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
148 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
149 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
150 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
151 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
153 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
154 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
155 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
156 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
157 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
158 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
159 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
160 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
161 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
162 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
163 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.57
Metatranscriptomes 0.97
Isolates 1.46

Biome Distribution

Category Percentage (%)
Aerial Root 0.97
Bulb 0
Endosphere 3.4
Nodule 0
Rhizoplane 8.74
Rhizosphere 84.95
Stem 0
Stem Tuber 0
Unclassified 1.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100267282 3300005329 Bacteria 1627
2 Ga0070683_101166705 3300005329 Bacteria 740
3 Ga0070680_100019985 3300005336 Bacteria 5309
4 Ga0070680_100398385 3300005336 Bacteria 1173
5 Ga0068868_100054504 3300005338 Bacteria 3151
6 Ga0068868_100137777 3300005338 Bacteria 2002
7 Ga0070689_100022931 3300005340 Bacteria 4667
8 Ga0070687_100007954 3300005343 Bacteria 4464
9 Ga0070668_100250926 3300005347 Bacteria 1469
10 Ga0070675_100005886 3300005354 Bacteria 9396
11 Ga0070674_100099591 3300005356 Bacteria 2115
12 Ga0070667_100234706 3300005367 Bacteria 1636
13 Ga0070701_10019047 3300005438 Bacteria 3237
14 Ga0070711_100068685 3300005439 Bacteria 2491
15 Ga0070678_100025198 3300005456 Bacteria 3997
16 Ga0070681_10365863 3300005458 Bacteria 1352
17 Ga0068867_100033346 3300005459 Bacteria 3728
18 Ga0070679_100064306 3300005530 Bacteria 3656
19 Ga0070679_100428545 3300005530 Bacteria 1268
20 Ga0070679_100591961 3300005530 Bacteria 1052
21 Ga0068853_100056058 3300005539 Bacteria 3397
22 Ga0068853_100090015 3300005539 Bacteria 2696
23 Ga0070686_100009216 3300005544 Bacteria 5538
24 Ga0070696_100026016 3300005546 Bacteria 3981
25 Ga0068855_100262755 3300005563 Bacteria 1922
26 Ga0068855_100616714 3300005563 Bacteria 1168
27 Ga0070664_100041903 3300005564 Bacteria 3864
28 Ga0068857_100070304 3300005577 Bacteria 3117
29 Ga0068856_100070937 3300005614 Bacteria 3447
30 Ga0068856_100111904 3300005614 Bacteria 2727
31 Ga0070702_100152694 3300005615 Bacteria 1484
32 Ga0068852_100049108 3300005616 Bacteria 3608
33 Ga0068852_100103172 3300005616 Bacteria 2579
34 Ga0068859_100047920 3300005617 Bacteria 4293
35 Ga0068859_100122891 3300005617 Bacteria 2663
36 Ga0068859_100839696 3300005617 Bacteria 1005
37 Ga0068864_100015524 3300005618 Bacteria 6332
38 Ga0068861_100074836 3300005719 Bacteria 2634
39 Ga0068851_10011763 3300005834 Bacteria 4109
40 Ga0068863_100006571 3300005841 Bacteria 11409
41 Ga0068863_100075276 3300005841 Bacteria 3194
42 Ga0068858_100036936 3300005842 Bacteria 4529
43 Ga0068860_100003820 3300005843 Bacteria 15493
44 Ga0068860_100060403 3300005843 Bacteria 3602
45 Ga0068862_100000125 3300005844 Bacteria 89536
46 Ga0068862_100205627 3300005844 Bacteria 1777
47 Ga0081540_1001879 3300005983 Bacteria 17582
48 Ga0070712_100024389 3300006175 Bacteria 4008
49 Ga0068871_100086174 3300006358 Bacteria 2609
50 Ga0075428_100439719 3300006844 Bacteria 1397
51 Ga0075430_100015763 3300006846 Bacteria 6437
52 Ga0075431_100003490 3300006847 Bacteria 15243
53 Ga0068865_100013906 3300006881 Bacteria 5102
54 Ga0068865_100018770 3300006881 Bacteria 4468
55 Ga0097620_100047920 3300006931 Bacteria 4293
56 Ga0097620_100122889 3300006931 Bacteria 2663
57 Ga0097620_100839702 3300006931 Bacteria 1005
58 Ga0105240_10095111 3300009093 Bacteria 3633
59 Ga0111539_10025730 3300009094 Bacteria 7210
60 Ga0105247_10002592 3300009101 Bacteria 12237
61 Ga0105247_10121799 3300009101 Bacteria 1691
62 Ga0105243_10080417 3300009148 Bacteria 2658
63 Ga0105248_10017687 3300009177 Bacteria 7862
64 Ga0105248_10128976 3300009177 Bacteria 2853
65 Ga0105238_10072150 3300009551 Bacteria 3449
66 Ga0105249_10000015 3300009553 Bacteria 282138
67 Ga0105249_10137371 3300009553 Bacteria 2341
68 Ga0099796_10048457 3300010159 Bacteria 1465
69 Ga0157374_10082705 3300013296 Bacteria 3049
70 Ga0163162_10511550 3300013306 Bacteria 1331
71 Ga0157372_10488828 3300013307 Bacteria 1435
72 Ga0157375_10606797 3300013308 Bacteria 1253
73 Ga0157380_10025536 3300014326 Bacteria 4480
74 Ga0182008_10034521 3300014497 Bacteria 2536
75 Ga0157377_10012378 3300014745 Bacteria 4290
76 Ga0157379_10152903 3300014968 Bacteria 2082
77 Ga0157379_10176025 3300014968 Bacteria 1932
78 Ga0157376_10200650 3300014969 Bacteria 1835
79 Ga0206356_10684534 3300020070 Bacteria 1579
80 Ga0206353_11938090 3300020082 Bacteria 2305
81 Ga0207710_10003826 3300025900 Bacteria 6649
82 Ga0207710_10130667 3300025900 Bacteria 1206
83 Ga0207643_10015142 3300025908 Bacteria 4195
84 Ga0207695_10074817 3300025913 Bacteria 3447
85 Ga0207693_10085006 3300025915 Bacteria 2479
86 Ga0207660_10053758 3300025917 Bacteria 2872
87 Ga0207662_10001149 3300025918 Bacteria 12521
88 Ga0207649_10201543 3300025920 Bacteria 1406
89 Ga0207652_10283394 3300025921 Bacteria 1495
90 Ga0207681_10075390 3300025923 Bacteria 2366
91 Ga0207694_10164153 3300025924 Bacteria 1795
92 Ga0207659_10029182 3300025926 Bacteria 3757
93 Ga0207659_10151197 3300025926 Bacteria 1813
94 Ga0207690_10216977 3300025932 Bacteria 1462
95 Ga0207704_10141794 3300025938 Bacteria 1682
96 Ga0207704_10584498 3300025938 Bacteria 912
97 Ga0207691_10038068 3300025940 Bacteria 4450
98 Ga0207691_10339115 3300025940 Bacteria 1287
99 Ga0207711_10277587 3300025941 Bacteria 1543
100 Ga0207661_10090653 3300025944 Bacteria 2546
101 Ga0207712_10000023 3300025961 Bacteria 282081
102 Ga0207640_10031611 3300025981 Bacteria 3273
103 Ga0207677_10083254 3300026023 Bacteria 2302
104 Ga0207639_10011980 3300026041 Bacteria 6033
105 Ga0207678_10248808 3300026067 Bacteria 1522
106 Ga0207708_10021847 3300026075 Bacteria 4828
107 Ga0207676_10176365 3300026095 Bacteria 1867
108 Ga0207675_100006496 3300026118 Bacteria 11061
109 Ga0207683_10164886 3300026121 Bacteria 2005
110 Ga0207698_10521847 3300026142 Bacteria 1159
111 Ga0268265_10000049 3300028380 Bacteria 177242
112 Ga0268264_10002225 3300028381 Bacteria 17207
113 Ga0265338_10070663 3300028800 Bacteria 2991
114 Ga0265338_10110019 3300028800 Bacteria 2222
115 Ga0265330_10057926 3300031235 Bacteria 1689
116 Ga0265320_10000088 3300031240 Bacteria 77379
117 Ga0265325_10000470 3300031241 Bacteria 29219
118 Ga0265325_10062928 3300031241 Bacteria 1879
119 Ga0265339_10028760 3300031249 Bacteria 3158
120 Ga0265339_10171871 3300031249 Bacteria 1084
121 Ga0265331_10027275 3300031250 Bacteria 2864
122 Ga0265331_10072862 3300031250 Bacteria 1604
123 Ga0265327_10021620 3300031251 Bacteria 3876
124 Ga0265316_10025310 3300031344 Bacteria 4954
125 Ga0265316_10037179 3300031344 Bacteria 3932
126 Ga0307513_10078854 3300031456 Bacteria 3405
127 Ga0265313_10060201 3300031595 Bacteria 1782
128 Ga0265314_10053885 3300031711 Bacteria 2787
129 Ga0265314_10099359 3300031711 Bacteria 1875
130 Ga0265342_10000631 3300031712 Bacteria 36866
131 Ga0307407_10304667 3300031903 Bacteria 1112
132 Ga0307409_100078132 3300031995 Bacteria 2661
133 Ga0307414_10105669 3300032004 Bacteria 2129
134 Ga0307411_10102282 3300032005 Bacteria 2030
135 Ga0373959_0020611 3300034820 Bacteria 1259
136 Ga0373938_0038250 3300034957 Bacteria 1057
137 Ga0373939_0052235 3300035114 Bacteria 1273
138 Ga0373961_0027789 3300035241 Bacteria 1555
139 Ga0373931_0002612 3300035691 Bacteria 8014
140 Ga0373937_0626206 3300036401 Bacteria 1021
141 Ga0436365_0197441 3300039437 Bacteria 1169
142 Ga0436365_0999637 3300039437 Bacteria 960
143 Ga0439459_0050650 3300042438 Bacteria 911
144 Ga0466959_0172614 3300045049 Bacteria 1516
145 Ga0495637_0188944 3300046520 Bacteria 761
146 Ga0495648_0019701 3300046524 Bacteria 4731
147 Ga0496100_0047055 3300048903 Bacteria 2777
148 Ga0496101_0063853 3300048904 Bacteria 2681
149 Ga0496102_0250440 3300048905 Bacteria 1670
150 Ga0496104_0112183 3300048907 Bacteria 2614
151 Ga0496105_0068481 3300048908 Bacteria 2932
152 Ga0496106_0138728 3300048909 Bacteria 1911
153 Ga0496107_0059605 3300048910 Bacteria 2762
154 Ga0496107_0107256 3300048910 Bacteria 2052
155 Ga0496108_0028852 3300048911 Bacteria 4592
156 Ga0496109_0116259 3300048912 Bacteria 2489
157 Ga0496110_0082138 3300048913 Bacteria 2873
158 Ga0496111_0098392 3300048914 Bacteria 2148
159 Ga0496112_0119169 3300048915 Bacteria 2609
160 Ga0496113_0444071 3300048916 Bacteria 1042
161 Ga0496113_0514087 3300048916 Bacteria 961
162 Ga0496114_0098460 3300048917 Bacteria 2493
163 Ga0496115_0037918 3300048918 Bacteria 3822
164 Ga0496115_0054445 3300048918 Bacteria 3212
165 Ga0496126_0025268 3300048929 Bacteria 5718
166 Ga0501032_0040048 3300049569 Bacteria 3185
167 Ga0501033_0050182 3300049570 Bacteria 3096
168 Ga0501034_0000119 3300049571 Bacteria 144440
169 Ga0501034_0027614 3300049571 Bacteria 5771
170 Ga0501034_0117921 3300049571 Bacteria 2642
171 Ga0501037_0054447 3300049573 Bacteria 2925
172 Ga0501038_0030050 3300049574 Bacteria 4810
173 Ga0501038_0174281 3300049574 Bacteria 1739
174 Ga0501040_0015777 3300049576 Bacteria 4994
175 Ga0501042_0038964 3300049578 Bacteria 3376
176 Ga0501043_0118010 3300049579 Bacteria 2081
177 Ga0501047_0245075 3300049581 Bacteria 1641
178 Ga0501048_0005195 3300049582 Bacteria 9919
179 Ga0501068_0033255 3300049584 Bacteria 3070
180 Ga0501069_0024041 3300049585 Bacteria 3323
181 Ga0501070_0080142 3300049586 Bacteria 2701
182 Ga0501070_0289417 3300049586 Bacteria 1335
183 Ga0501074_0026620 3300049590 Bacteria 4193
184 Ga0501080_0056646 3300049742 Bacteria 3649
185 Ga0501080_0066112 3300049742 Bacteria 3362
186 Ga0501081_0116292 3300049743 Bacteria 1901
187 Ga0501083_0049306 3300049744 Bacteria 2838
188 Ga0501083_0167088 3300049744 Bacteria 1438
189 Ga0501044_0060561 3300049823 Bacteria 3875
190 Ga0501044_0251321 3300049823 Bacteria 1709
191 Ga0501045_0015983 3300049824 Bacteria 5324
192 nmdc:mga0qj67_114228_c1 3300050509 Bacteria 2181
193 nmdc:mga06r32_95756_c1 3300050510 Bacteria 2906
194 Ga0500583_0077009 3300053092 Bacteria 1605
195 Ga0500595_009262 3300053119 Bacteria 3981
196 Ga0500642_0089778 3300053130 Bacteria 1419
197 Ga0500559_0021718 3300053136 Bacteria 2722
198 Ga0500616_0096505 3300053153 Bacteria 1453
199 Ga0500645_000036 3300053730 Bacteria 113063
200 Ga0500645_013961 3300053730 Bacteria 2569
201 Ga0501084_0015596 3300054114 Bacteria 6302
202 Ga0501082_0039685 3300060353 Bacteria 4061
203 Ga0530510_0163716 3300061734 Bacteria 1646

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039437 Ga0436365_0999637 Ga0436365_0999637_168_827 189
2 3300025940 Ga0207691_10339115 Ga0207691_103391151 194
3 3300031903 Ga0307407_10304667 Ga0307407_103046671 195
4 3300031995 Ga0307409_100078132 Ga0307409_1000781321 195
5 3300032004 Ga0307414_10105669 Ga0307414_101056691 195
6 3300032005 Ga0307411_10102282 Ga0307411_101022822 195
7 3300035691 Ga0373931_0002612 Ga0373931_0002612_4960_5583 203
8 3300005983 Ga0081540_1001879 Ga0081540_10018794 205
9 3300005458 Ga0070681_10365863 Ga0070681_103658631 207
10 3300005530 Ga0070679_100591961 Ga0070679_1005919611 207
11 3300005614 Ga0068856_100111904 Ga0068856_1001119045 207
12 3300020082 Ga0206353_11938090 Ga0206353_119380904 207
13 3300025913 Ga0207695_10074817 Ga0207695_100748173 207
14 3300009093 Ga0105240_10095111 Ga0105240_100951112 208
15 3300046520 Ga0495637_0188944 Ga0495637_0188944_21_668 211
16 iso_pu_bacteria 2830075706 2830075712 212
17 iso_pu_bacteria 2990265787 2990268443 212
18 iso_pu_bacteria 2993693658 2993696524 212
19 3300046524 Ga0495648_0019701 Ga0495648_0019701_247_906 214
20 3300006175 Ga0070712_100024389 Ga0070712_1000243893 216
21 3300025915 Ga0207693_10085006 Ga0207693_100850063 216
22 3300049571 Ga0501034_0000119 Ga0501034_0000119_12843_13538 216
23 3300049744 Ga0501083_0167088 Ga0501083_0167088_43_738 216
24 3300042438 Ga0439459_0050650 Ga0439459_0050650_156_863 222
25 3300049571 Ga0501034_0117921 Ga0501034_0117921_148_846 223
26 3300049586 Ga0501070_0289417 Ga0501070_0289417_348_1046 223
27 3300049823 Ga0501044_0251321 Ga0501044_0251321_175_876 224
28 3300009101 Ga0105247_10121799 Ga0105247_101217992 225
29 3300025900 Ga0207710_10130667 Ga0207710_101306672 225
30 3300049576 Ga0501040_0015777 Ga0501040_0015777_1925_2671 225
31 3300049590 Ga0501074_0026620 Ga0501074_0026620_2112_2858 225
32 3300049742 Ga0501080_0066112 Ga0501080_0066112_2168_2914 225
33 3300053119 Ga0500595_009262 Ga0500595_009262_3020_3709 225
34 3300061734 Ga0530510_0163716 Ga0530510_0163716_475_1221 225
35 3300005843 Ga0068860_100003820 Ga0068860_10000382014 226
36 3300005844 Ga0068862_100000125 Ga0068862_10000012551 226
37 3300009101 Ga0105247_10002592 Ga0105247_100025925 226
38 3300009553 Ga0105249_10000015 Ga0105249_10000015166 226
39 3300025900 Ga0207710_10003826 Ga0207710_100038264 226
40 3300025961 Ga0207712_10000023 Ga0207712_10000023119 226
41 3300028380 Ga0268265_10000049 Ga0268265_10000049146 226
42 3300028381 Ga0268264_10002225 Ga0268264_100022254 226
43 3300028800 Ga0265338_10070663 Ga0265338_100706633 226
44 3300031240 Ga0265320_10000088 Ga0265320_1000008831 226
45 3300031249 Ga0265339_10028760 Ga0265339_100287603 226
46 3300031456 Ga0307513_10078854 Ga0307513_100788543 226
47 3300048916 Ga0496113_0444071 Ga0496113_0444071_221_973 226
48 3300006844 Ga0075428_100439719 Ga0075428_1004397192 227
49 3300006846 Ga0075430_100015763 Ga0075430_1000157633 227
50 3300006847 Ga0075431_100003490 Ga0075431_10000349011 227
51 3300028800 Ga0265338_10110019 Ga0265338_101100192 227
52 3300031344 Ga0265316_10037179 Ga0265316_100371795 227
53 3300031595 Ga0265313_10060201 Ga0265313_100602012 227
54 3300048929 Ga0496126_0025268 Ga0496126_0025268_1078_1779 227
55 3300050509 nmdc:mga0qj67_114228_c1 nmdc:mga0qj67_114228_c1_719_1414 227
56 3300050510 nmdc:mga06r32_95756_c1 nmdc:mga06r32_95756_c1_881_1576 227
57 3300053730 Ga0500645_000036 Ga0500645_000036_74247_75011 227
58 3300005336 Ga0070680_100398385 Ga0070680_1003983851 228
59 3300005338 Ga0068868_100054504 Ga0068868_1000545043 228
60 3300005340 Ga0070689_100022931 Ga0070689_1000229312 228
61 3300005343 Ga0070687_100007954 Ga0070687_1000079543 228
62 3300005347 Ga0070668_100250926 Ga0070668_1002509262 228
63 3300005354 Ga0070675_100005886 Ga0070675_1000058868 228
64 3300005356 Ga0070674_100099591 Ga0070674_1000995912 228
65 3300005438 Ga0070701_10019047 Ga0070701_100190472 228
66 3300005456 Ga0070678_100025198 Ga0070678_1000251982 228
67 3300005459 Ga0068867_100033346 Ga0068867_1000333463 228
68 3300005544 Ga0070686_100009216 Ga0070686_1000092163 228
69 3300005546 Ga0070696_100026016 Ga0070696_1000260162 228
70 3300005615 Ga0070702_100152694 Ga0070702_1001526942 228
71 3300005617 Ga0068859_100047920 Ga0068859_1000479202 228
72 3300005719 Ga0068861_100074836 Ga0068861_1000748363 228
73 3300005841 Ga0068863_100006571 Ga0068863_1000065714 228
74 3300005842 Ga0068858_100036936 Ga0068858_1000369362 228
75 3300005843 Ga0068860_100060403 Ga0068860_1000604033 228
76 3300005844 Ga0068862_100205627 Ga0068862_1002056272 228
77 3300006881 Ga0068865_100013906 Ga0068865_1000139062 228
78 3300006931 Ga0097620_100047920 Ga0097620_1000479206 228
79 3300009148 Ga0105243_10080417 Ga0105243_100804173 228
80 3300009177 Ga0105248_10017687 Ga0105248_100176873 228
81 3300009553 Ga0105249_10137371 Ga0105249_101373712 228
82 3300013308 Ga0157375_10606797 Ga0157375_106067972 228
83 3300014326 Ga0157380_10025536 Ga0157380_100255365 228
84 3300014745 Ga0157377_10012378 Ga0157377_100123782 228
85 3300025908 Ga0207643_10015142 Ga0207643_100151422 228
86 3300025918 Ga0207662_10001149 Ga0207662_100011492 228
87 3300025923 Ga0207681_10075390 Ga0207681_100753901 228
88 3300025926 Ga0207659_10029182 Ga0207659_100291824 228
89 3300025938 Ga0207704_10141794 Ga0207704_101417942 228
90 3300025940 Ga0207691_10038068 Ga0207691_100380685 228
91 3300026075 Ga0207708_10021847 Ga0207708_100218476 228
92 3300026118 Ga0207675_100006496 Ga0207675_1000064963 228
93 3300026121 Ga0207683_10164886 Ga0207683_101648862 228
94 3300031711 Ga0265314_10053885 Ga0265314_100538854 228
95 3300053136 Ga0500559_0021718 Ga0500559_0021718_985_1770 228
96 3300005617 Ga0068859_100122891 Ga0068859_1001228912 229
97 3300006931 Ga0097620_100122889 Ga0097620_1001228892 229
98 3300009094 Ga0111539_10025730 Ga0111539_100257305 229
99 3300031249 Ga0265339_10171871 Ga0265339_101718712 229
100 3300031250 Ga0265331_10027275 Ga0265331_100272752 229
101 3300031251 Ga0265327_10021620 Ga0265327_100216205 229
102 3300031344 Ga0265316_10025310 Ga0265316_100253103 229
103 3300053130 Ga0500642_0089778 Ga0500642_0089778_497_1195 229
104 3300053153 Ga0500616_0096505 Ga0500616_0096505_610_1308 229
105 3300045049 Ga0466959_0172614 Ga0466959_0172614_92_799 230
106 3300034820 Ga0373959_0020611 Ga0373959_0020611_80_787 231
107 3300034957 Ga0373938_0038250 Ga0373938_0038250_218_925 231
108 3300035114 Ga0373939_0052235 Ga0373939_0052235_334_1041 231
109 3300048904 Ga0496101_0063853 Ga0496101_0063853_801_1508 231
110 3300048905 Ga0496102_0250440 Ga0496102_0250440_876_1583 231
111 3300048907 Ga0496104_0112183 Ga0496104_0112183_697_1404 231
112 3300048908 Ga0496105_0068481 Ga0496105_0068481_876_1583 231
113 3300048910 Ga0496107_0059605 Ga0496107_0059605_672_1379 231
114 3300048912 Ga0496109_0116259 Ga0496109_0116259_703_1410 231
115 3300048913 Ga0496110_0082138 Ga0496110_0082138_844_1551 231
116 3300048914 Ga0496111_0098392 Ga0496111_0098392_673_1380 231
117 3300048915 Ga0496112_0119169 Ga0496112_0119169_474_1181 231
118 3300048916 Ga0496113_0514087 Ga0496113_0514087_186_893 231
119 3300048917 Ga0496114_0098460 Ga0496114_0098460_1493_2200 231
120 3300048918 Ga0496115_0054445 Ga0496115_0054445_1356_2063 231
121 3300053092 Ga0500583_0077009 Ga0500583_0077009_691_1443 231
122 3300053730 Ga0500645_013961 Ga0500645_013961_1759_2511 231
123 3300005329 Ga0070683_101166705 Ga0070683_1011667051 232
124 3300005564 Ga0070664_100041903 Ga0070664_1000419034 232
125 3300005616 Ga0068852_100049108 Ga0068852_1000491082 232
126 3300013306 Ga0163162_10511550 Ga0163162_105115502 232
127 3300026142 Ga0207698_10521847 Ga0207698_105218472 232
128 3300031235 Ga0265330_10057926 Ga0265330_100579261 232
129 3300031241 Ga0265325_10062928 Ga0265325_100629282 232
130 3300031250 Ga0265331_10072862 Ga0265331_100728622 232
131 3300035241 Ga0373961_0027789 Ga0373961_0027789_56_763 232
132 3300009177 Ga0105248_10128976 Ga0105248_101289766 233
133 3300010159 Ga0099796_10048457 Ga0099796_100484571 233
134 3300014497 Ga0182008_10034521 Ga0182008_100345213 233
135 3300014968 Ga0157379_10152903 Ga0157379_101529032 233
136 3300025926 Ga0207659_10151197 Ga0207659_101511972 233
137 3300025938 Ga0207704_10584498 Ga0207704_105844981 233
138 3300025941 Ga0207711_10277587 Ga0207711_102775871 233
139 3300036401 Ga0373937_0626206 Ga0373937_0626206_67_786 233
140 3300039437 Ga0436365_0197441 Ga0436365_0197441_407_1126 233
141 3300048903 Ga0496100_0047055 Ga0496100_0047055_981_1694 233
142 3300048909 Ga0496106_0138728 Ga0496106_0138728_195_908 233
143 3300048911 Ga0496108_0028852 Ga0496108_0028852_1026_1739 233
144 3300005336 Ga0070680_100019985 Ga0070680_1000199853 234
145 3300005530 Ga0070679_100064306 Ga0070679_1000643062 234
146 3300005563 Ga0068855_100262755 Ga0068855_1002627553 234
147 3300005616 Ga0068852_100103172 Ga0068852_1001031725 234
148 3300013307 Ga0157372_10488828 Ga0157372_104888282 234
149 3300020070 Ga0206356_10684534 Ga0206356_106845342 234
150 3300025917 Ga0207660_10053758 Ga0207660_100537586 234
151 3300025932 Ga0207690_10216977 Ga0207690_102169772 234
152 3300031711 Ga0265314_10099359 Ga0265314_100993592 234
153 3300031712 Ga0265342_10000631 Ga0265342_1000063133 234
154 3300048918 Ga0496115_0037918 Ga0496115_0037918_2699_3421 234
155 3300031241 Ga0265325_10000470 Ga0265325_1000047032 235
156 3300048910 Ga0496107_0107256 Ga0496107_0107256_106_831 235
157 3300049569 Ga0501032_0040048 Ga0501032_0040048_748_1494 235
158 3300049570 Ga0501033_0050182 Ga0501033_0050182_1882_2628 235
159 3300049571 Ga0501034_0027614 Ga0501034_0027614_1336_2082 235
160 3300049573 Ga0501037_0054447 Ga0501037_0054447_1054_1800 235
161 3300049574 Ga0501038_0030050 Ga0501038_0030050_2198_2944 235
162 3300049578 Ga0501042_0038964 Ga0501042_0038964_1571_2317 235
163 3300049579 Ga0501043_0118010 Ga0501043_0118010_181_927 235
164 3300049581 Ga0501047_0245075 Ga0501047_0245075_620_1366 235
165 3300049582 Ga0501048_0005195 Ga0501048_0005195_1677_2423 235
166 3300049584 Ga0501068_0033255 Ga0501068_0033255_2049_2795 235
167 3300049585 Ga0501069_0024041 Ga0501069_0024041_2176_2922 235
168 3300049586 Ga0501070_0080142 Ga0501070_0080142_1336_2082 235
169 3300049743 Ga0501081_0116292 Ga0501081_0116292_460_1206 235
170 3300049744 Ga0501083_0049306 Ga0501083_0049306_226_972 235
171 3300049823 Ga0501044_0060561 Ga0501044_0060561_2533_3279 235
172 3300049824 Ga0501045_0015983 Ga0501045_0015983_2018_2764 235
173 3300054114 Ga0501084_0015596 Ga0501084_0015596_1888_2634 235
174 3300060353 Ga0501082_0039685 Ga0501082_0039685_1165_1911 235
175 3300005530 Ga0070679_100428545 Ga0070679_1004285452 239
176 3300005539 Ga0068853_100090015 Ga0068853_1000900153 239
177 3300025921 Ga0207652_10283394 Ga0207652_102833942 239
178 3300026041 Ga0207639_10011980 Ga0207639_100119802 239
179 3300005439 Ga0070711_100068685 Ga0070711_1000686853 240
180 3300009551 Ga0105238_10072150 Ga0105238_100721502 240
181 3300025924 Ga0207694_10164153 Ga0207694_101641532 240
182 3300049574 Ga0501038_0174281 Ga0501038_0174281_881_1663 240
183 3300049742 Ga0501080_0056646 Ga0501080_0056646_28_891 240
184 3300005329 Ga0070683_100267282 Ga0070683_1002672822 243
185 3300005338 Ga0068868_100137777 Ga0068868_1001377771 243
186 3300005367 Ga0070667_100234706 Ga0070667_1002347062 243
187 3300005539 Ga0068853_100056058 Ga0068853_1000560584 243
188 3300005563 Ga0068855_100616714 Ga0068855_1006167142 243
189 3300005577 Ga0068857_100070304 Ga0068857_1000703043 243
190 3300005614 Ga0068856_100070937 Ga0068856_1000709372 243
191 3300005617 Ga0068859_100839696 Ga0068859_1008396961 243
192 3300005618 Ga0068864_100015524 Ga0068864_1000155245 243
193 3300005834 Ga0068851_10011763 Ga0068851_100117632 243
194 3300005841 Ga0068863_100075276 Ga0068863_1000752764 243
195 3300006358 Ga0068871_100086174 Ga0068871_1000861742 243
196 3300006881 Ga0068865_100018770 Ga0068865_1000187701 243
197 3300006931 Ga0097620_100839702 Ga0097620_1008397021 243
198 3300013296 Ga0157374_10082705 Ga0157374_100827052 243
199 3300014968 Ga0157379_10176025 Ga0157379_101760252 243
200 3300014969 Ga0157376_10200650 Ga0157376_102006502 243
201 3300025920 Ga0207649_10201543 Ga0207649_102015432 243
202 3300025944 Ga0207661_10090653 Ga0207661_100906534 243
203 3300025981 Ga0207640_10031611 Ga0207640_100316114 243
204 3300026023 Ga0207677_10083254 Ga0207677_100832543 243
205 3300026067 Ga0207678_10248808 Ga0207678_102488082 243
206 3300026095 Ga0207676_10176365 Ga0207676_101763652 243

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01625

PMSR

Peptide methionine sulfoxide reductase

53

208

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4gwb-assembly1.cif.gz_A-2 crystal structure of putative peptide methionine sulfoxide reductase from sinorhizobium meliloti 1021 0.9675 50 200
1nwa-assembly1.cif.gz_A structure of mycobacterium tuberculosis methionine sulfoxide reductase a in complex with protein-bound methionine 0.9586 49 200
7e43-assembly2.cif.gz_A structural insights into a bifunctional peptide methionine sulfoxide reductase msra/b fusion protein from helicobacter pylori 0.9542 49 200
3bqf-assembly1.cif.gz_A structure of the central domain (msra) of neisseria meningitidis pilb (complex with a substrate) 0.9486 47 200
7e43-assembly1.cif.gz_B structural insights into a bifunctional peptide methionine sulfoxide reductase msra/b fusion protein from helicobacter pylori 0.9481 49 200
ID Description Score Start End Superfamily
af_P9WJM5_1_166_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9537 47 199 3.30.1060.10
af_Q551H3_1_147_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9314 50 197 3.30.1060.10
af_B6TNT5_14_185_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9296 44 198 3.30.1060.10
af_Q551H3_1_147_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9132 50 197 3.30.1060.10
af_Q5AD39_5_182_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9122 44 200 3.30.1060.10
ID Description Score Start End GO Terms
AF-A0A531M5G0-F1-model_v4 peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) 1.001 52 219 GO:0008113
GO:0033744
AF-A0A529LRA0-F1-model_v4 peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) 1 59 229 GO:0008113
GO:0033744
AF-A0A2N7VCB4-F1-model_v4 peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) 1 58 190 GO:0008113
AF-A0A434SKU4-F1-model_v4 peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) 0.9989 59 229 GO:0008113
GO:0033744
AF-A0A529P3D4-F1-model_v4 peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) 0.9989 59 229 GO:0008113
GO:0033744

Feature Viewer

pLDDT pTM Quality
87.79 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map